F417699

General Info

Members Datasets Scaffolds Average Seq Length
348 238 696 384

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0004416|Ga0501031_0004416_4610_5824
Length 404
Sequence VLRDADHGGTDVNKAILALVDGTVFEGRALGYEGETCGEVVFNTAMTGYQEVLTDPSYKGQIVTMTCPHIGNYGVTSEDEESRRVWAEGFIIKESSGLASNWRSRQYLHEYLRQAKIVALEGIDTRALTRHLREKGAQQGVISHTDLEPSRVLEKARQAPSIIGRDLAAAVTCATPYPWTIGTGAWSPRLKQDGTRTAVSSARQWKVVAYDFGIKQNILRRLVDIGCDVTVVPASTPAAAVLAMNPDGVFLSNGPGDPEGVPYAIEAVRQLIGRKPIFGICLGHQLLGLALGLETYKLKFGHHGANHPVLDLRSGRVEITSQNHNFAVKGPGRGRGKDEPTILSTKFGRVRISHTSLNDESVEGMICLDQPVFSVQYHPEASPGPHDSAYLFEEFAQLMEKSHG

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
4 3300003397 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
187 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
188 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
189 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
214 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
215 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
216 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
217 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
222 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
223 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
224 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
225 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
226 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.29
Rhizosphere 97.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0004416 3300049568 Bacteria 9113
2 SwRhRL2b_contig_595538 2162886007 Bacteria 1379
3 JGI26145J50221_1000515 3300003371 Bacteria 3331
4 JGI26133J50247_100138 3300003397 Bacteria 1660
5 Ga0065704_10075949 3300005289 Bacteria 5336
6 Ga0065712_10073988 3300005290 Bacteria 4200
7 Ga0065707_10093087 3300005295 Bacteria 3677
8 Ga0070658_10007591 3300005327 Bacteria 8751
9 Ga0070658_10041381 3300005327 Bacteria 3718
10 Ga0070658_10106673 3300005327 Bacteria 2318
11 Ga0070676_10001216 3300005328 Bacteria 12921
12 Ga0070690_100000194 3300005330 Bacteria 31512
13 Ga0070690_100009124 3300005330 Bacteria 5739
14 Ga0070690_100032417 3300005330 Bacteria 3264
15 Ga0070670_100015946 3300005331 Bacteria 6447
16 Ga0068869_100013312 3300005334 Bacteria 5468
17 Ga0070680_100008501 3300005336 Bacteria 7863
18 Ga0070682_100055403 3300005337 Bacteria 2490
19 Ga0070682_100142949 3300005337 Bacteria 1633
20 Ga0070660_100011776 3300005339 Bacteria 6228
21 Ga0070689_100027427 3300005340 Bacteria 4293
22 Ga0070687_100020708 3300005343 Bacteria 3080
23 Ga0070661_100004059 3300005344 Bacteria 10080
24 Ga0070661_100031153 3300005344 Bacteria 3856
25 Ga0070668_100004431 3300005347 Bacteria 10424
26 Ga0070669_100005657 3300005353 Bacteria 9026
27 Ga0070675_100012044 3300005354 Bacteria 6779
28 Ga0070674_100002350 3300005356 Bacteria 10434
29 Ga0070673_100002253 3300005364 Bacteria 11686
30 Ga0070673_100362829 3300005364 Bacteria 1288
31 Ga0070688_100004041 3300005365 Bacteria 7613
32 Ga0070659_100016929 3300005366 Bacteria 5479
33 Ga0070667_100038453 3300005367 Bacteria 4011
34 Ga0070709_10074866 3300005434 Bacteria 2195
35 Ga0070714_100003082 3300005435 Bacteria 12370
36 Ga0070713_100001622 3300005436 Bacteria 14423
37 Ga0070711_100024054 3300005439 Bacteria 3969
38 Ga0070711_100055462 3300005439 Bacteria 2738
39 Ga0070711_100067047 3300005439 Bacteria 2517
40 Ga0070694_100006786 3300005444 Bacteria 6953
41 Ga0070678_100007856 3300005456 Bacteria 6347
42 Ga0070681_10005863 3300005458 Bacteria 11895
43 Ga0070681_10043825 3300005458 Bacteria 4479
44 Ga0070681_10136708 3300005458 Bacteria 2381
45 Ga0070681_10178838 3300005458 Bacteria 2043
46 Ga0068867_100199184 3300005459 Bacteria 1602
47 Ga0070706_100004434 3300005467 Bacteria 13561
48 Ga0070679_100072699 3300005530 Bacteria 3431
49 Ga0070679_100242125 3300005530 Bacteria 1761
50 Ga0070672_100023212 3300005543 Bacteria 4569
51 Ga0070686_100011701 3300005544 Bacteria 4986
52 Ga0070695_100015194 3300005545 Bacteria 4647
53 Ga0070696_100005817 3300005546 Bacteria 8228
54 Ga0070665_100010717 3300005548 Bacteria 9281
55 Ga0070665_100202430 3300005548 Bacteria 1986
56 Ga0070665_100274174 3300005548 Bacteria 1689
57 Ga0068855_100006509 3300005563 Bacteria 14203
58 Ga0068855_100014560 3300005563 Bacteria 9475
59 Ga0068855_100193464 3300005563 Bacteria 2293
60 Ga0070664_100006913 3300005564 Bacteria 9142
61 Ga0070664_100219138 3300005564 Bacteria 1702
62 Ga0070702_100023018 3300005615 Bacteria 3304
63 Ga0068852_100315349 3300005616 Bacteria 1517
64 Ga0068866_10010297 3300005718 Bacteria 4004
65 Ga0068870_10009424 3300005840 Bacteria 4441
66 Ga0068858_100276706 3300005842 Bacteria 1598
67 Ga0068858_100357299 3300005842 Bacteria 1400
68 Ga0068862_100026227 3300005844 Bacteria 4898
69 Ga0081455_10001969 3300005937 Bacteria 24600
70 Ga0081455_10053560 3300005937 Bacteria 3446
71 Ga0075432_10000459 3300006058 Bacteria 12064
72 Ga0097621_100048440 3300006237 Bacteria 3448
73 Ga0068871_100007265 3300006358 Bacteria 7901
74 Ga0068871_100090904 3300006358 Bacteria 2543
75 Ga0075428_100041045 3300006844 Bacteria 5089
76 Ga0075430_100002997 3300006846 Bacteria 14135
77 Ga0075430_100005182 3300006846 Bacteria 10978
78 Ga0075430_100012948 3300006846 Bacteria 7110
79 Ga0075431_100022418 3300006847 Bacteria 6455
80 Ga0075431_100073549 3300006847 Bacteria 3526
81 Ga0075431_100105549 3300006847 Bacteria 2907
82 Ga0075433_10054187 3300006852 Bacteria 3498
83 Ga0075434_100020995 3300006871 Bacteria 6343
84 Ga0075429_100005494 3300006880 Bacteria 10914
85 Ga0068865_100004728 3300006881 Bacteria 8223
86 Ga0105240_10000644 3300009093 Bacteria 64391
87 Ga0105240_10095917 3300009093 Bacteria 3615
88 Ga0105245_10004258 3300009098 Bacteria 12687
89 Ga0114129_10000835 3300009147 Bacteria 39878
90 Ga0114129_10046839 3300009147 Bacteria 6076
91 Ga0114129_10211519 3300009147 Bacteria 2621
92 Ga0114129_10287762 3300009147 Bacteria 2194
93 Ga0105243_10159561 3300009148 Bacteria 1943
94 Ga0105242_10011584 3300009176 Bacteria 6782
95 Ga0105248_10658784 3300009177 Bacteria 1181
96 Ga0105249_10017399 3300009553 Bacteria 6381
97 Ga0105249_10166633 3300009553 Bacteria 2133
98 Ga0105239_10018626 3300010375 Bacteria 7669
99 Ga0105239_10475402 3300010375 Bacteria 1419
100 Ga0157371_10076752 3300013102 Bacteria 2366
101 Ga0157370_10017847 3300013104 Bacteria 7151
102 Ga0157369_10068077 3300013105 Bacteria 3825
103 Ga0157374_10120399 3300013296 Bacteria 2532
104 Ga0157378_10008190 3300013297 Bacteria 9115
105 Ga0157378_10079648 3300013297 Bacteria 2958
106 Ga0157372_10047225 3300013307 Bacteria 4783
107 Ga0157375_10006171 3300013308 Bacteria 10443
108 Ga0157375_10091192 3300013308 Bacteria 3108
109 Ga0157380_10104224 3300014326 Bacteria 2368
110 Ga0157377_10014874 3300014745 Bacteria 3969
111 Ga0157379_10156807 3300014968 Bacteria 2054
112 Ga0157376_10002662 3300014969 Bacteria 12138
113 Ga0213875_10000002 3300021388 Bacteria 921066
114 Ga0213875_10002455 3300021388 Bacteria 11068
115 Ga0213871_10000579 3300021441 Bacteria 5156
116 Ga0207642_10012542 3300025899 Bacteria 3063
117 Ga0207688_10091667 3300025901 Bacteria 1745
118 Ga0207645_10004288 3300025907 Bacteria 10580
119 Ga0207705_10016252 3300025909 Bacteria 5336
120 Ga0207705_10056894 3300025909 Bacteria 2821
121 Ga0207705_10078426 3300025909 Bacteria 2404
122 Ga0207707_10012846 3300025912 Bacteria 7286
123 Ga0207707_10091895 3300025912 Bacteria 2652
124 Ga0207707_10174191 3300025912 Bacteria 1880
125 Ga0207695_10002661 3300025913 Bacteria 26121
126 Ga0207695_10057948 3300025913 Bacteria 4023
127 Ga0207663_10085878 3300025916 Bacteria 2073
128 Ga0207663_10163973 3300025916 Bacteria 1572
129 Ga0207660_10005426 3300025917 Bacteria 8274
130 Ga0207662_10006623 3300025918 Bacteria 6256
131 Ga0207662_10012361 3300025918 Bacteria 4752
132 Ga0207657_10001426 3300025919 Bacteria 25509
133 Ga0207649_10041829 3300025920 Bacteria 2792
134 Ga0207681_10012681 3300025923 Bacteria 5204
135 Ga0207694_10000435 3300025924 Bacteria 38792
136 Ga0207650_10015822 3300025925 Bacteria 5260
137 Ga0207700_10000647 3300025928 Bacteria 20348
138 Ga0207664_10016657 3300025929 Bacteria 5367
139 Ga0207664_10244252 3300025929 Bacteria 1564
140 Ga0207644_10265902 3300025931 Bacteria 1373
141 Ga0207690_10007833 3300025932 Bacteria 6343
142 Ga0207706_10000793 3300025933 Bacteria 32687
143 Ga0207686_10005315 3300025934 Bacteria 6907
144 Ga0207670_10006155 3300025936 Bacteria 6637
145 Ga0207704_10003273 3300025938 Bacteria 7355
146 Ga0207704_10047623 3300025938 Bacteria 2564
147 Ga0207691_10000089 3300025940 Bacteria 77701
148 Ga0207689_10008288 3300025942 Bacteria 9058
149 Ga0207679_10003844 3300025945 Bacteria 9315
150 Ga0207679_10037995 3300025945 Bacteria 3428
151 Ga0207667_10022570 3300025949 Bacteria 6948
152 Ga0207667_10048913 3300025949 Bacteria 4469
153 Ga0207651_10054610 3300025960 Bacteria 2738
154 Ga0207651_10181766 3300025960 Bacteria 1669
155 Ga0207712_10077057 3300025961 Bacteria 2415
156 Ga0207668_10076170 3300025972 Bacteria 2414
157 Ga0207658_10002353 3300025986 Bacteria 13897
158 Ga0207658_10033173 3300025986 Bacteria 3681
159 Ga0207677_10081518 3300026023 Bacteria 2322
160 Ga0207703_10233056 3300026035 Bacteria 1652
161 Ga0207678_10091979 3300026067 Bacteria 2593
162 Ga0207708_10001017 3300026075 Bacteria 20984
163 Ga0207648_10004237 3300026089 Bacteria 14821
164 Ga0207674_10008535 3300026116 Bacteria 11818
165 Ga0207683_10002511 3300026121 Bacteria 16011
166 Ga0207698_10090796 3300026142 Bacteria 2499
167 Ga0209973_1000120 3300027252 Bacteria 4691
168 Ga0209969_1000238 3300027360 Bacteria 7340
169 Ga0209967_1000094 3300027364 Bacteria 11815
170 Ga0209981_1000201 3300027378 Bacteria 7405
171 Ga0209996_1000001 3300027395 Bacteria 64824
172 Ga0209984_1000104 3300027424 Bacteria 9635
173 Ga0210000_1000133 3300027462 Bacteria 10665
174 Ga0209995_1000203 3300027471 Bacteria 9509
175 Ga0209968_1000073 3300027526 Bacteria 18065
176 Ga0209999_1000813 3300027543 Bacteria 5148
177 Ga0209970_1000461 3300027614 Bacteria 6963
178 Ga0210002_1000025 3300027617 Bacteria 22909
179 Ga0209983_1000402 3300027665 Bacteria 9270
180 Ga0209971_1000462 3300027682 Bacteria 10792
181 Ga0209966_1000133 3300027695 Bacteria 31066
182 Ga0209998_10000165 3300027717 Bacteria 24428
183 Ga0209974_10000773 3300027876 Bacteria 10888
184 Ga0209974_10005891 3300027876 Bacteria 4296
185 Ga0207428_10033213 3300027907 Bacteria 4240
186 Ga0268266_10010555 3300028379 Bacteria 8064
187 Ga0268265_10006799 3300028380 Bacteria 7741
188 Ga0268265_10036976 3300028380 Bacteria 3580
189 Ga0268264_10056784 3300028381 Bacteria 3273
190 Ga0268264_10244064 3300028381 Bacteria 1665
191 Ga0265323_10010621 3300028653 Bacteria 3728
192 Ga0265338_10011891 3300028800 Bacteria 9996
193 Ga0265338_10143006 3300028800 Bacteria 1871
194 Ga0265330_10005608 3300031235 Bacteria 6247
195 Ga0265330_10045000 3300031235 Bacteria 1947
196 Ga0265332_10000101 3300031238 Bacteria 74058
197 Ga0265320_10005498 3300031240 Bacteria 8123
198 Ga0265325_10034001 3300031241 Bacteria 2716
199 Ga0265329_10006564 3300031242 Bacteria 4605
200 Ga0265329_10011306 3300031242 Bacteria 3246
201 Ga0265329_10022758 3300031242 Bacteria 2093
202 Ga0265340_10003905 3300031247 Bacteria 8398
203 Ga0265331_10000048 3300031250 Bacteria 182667
204 Ga0265331_10004665 3300031250 Bacteria 8490
205 Ga0265316_10000897 3300031344 Bacteria 32597
206 Ga0265316_10004073 3300031344 Bacteria 14621
207 Ga0265316_10288716 3300031344 Bacteria 1197
208 Ga0307408_100014977 3300031548 Bacteria 5161
209 Ga0307408_100071228 3300031548 Bacteria 2570
210 Ga0265314_10001664 3300031711 Bacteria 24215
211 Ga0265342_10008540 3300031712 Bacteria 7327
212 Ga0307416_100265302 3300032002 Bacteria 1681
213 Ga0307411_10042237 3300032005 Bacteria 2907
214 Ga0373931_0093697 3300035691 Bacteria 1678
215 Ga0373935_0044679 3300035692 Bacteria 2793
216 Ga0373927_0086788 3300035695 Bacteria 2031
217 Ga0373947_0223136 3300035725 Bacteria 1239
218 Ga0373937_0007136 3300036401 Bacteria 9655
219 Ga0436364_0612043 3300037853 Bacteria 326330
220 Ga0436364_0810236 3300037853 Bacteria 2200
221 Ga0436364_1229252 3300037853 Bacteria 10018
222 Ga0436365_1646043 3300039437 Bacteria 3323
223 Ga0436360_0364875 3300039438 Bacteria 26855
224 Ga0453684_0401124 3300044712 Bacteria 1536
225 Ga0451576_0031129 3300045051 Bacteria 5691
226 Ga0451576_0032580 3300045051 Bacteria 5546
227 Ga0451576_0239664 3300045051 Bacteria 1895
228 Ga0466967_0032980 3300045976 Bacteria 4379
229 Ga0495592_0142470 3300046454 Bacteria 1666
230 Ga0495651_0008601 3300046462 Bacteria 7824
231 Ga0495653_0041801 3300046463 Bacteria 3576
232 Ga0495580_0029388 3300046472 Bacteria 3990
233 Ga0495664_0003111 3300046477 Bacteria 9006
234 Ga0495594_0023816 3300046499 Bacteria 3283
235 Ga0495630_0000298 3300046517 Bacteria 39988
236 Ga0495630_0094001 3300046517 Bacteria 2266
237 Ga0495587_0011206 3300046536 Bacteria 5685
238 Ga0495645_0011557 3300046543 Bacteria 6218
239 Ga0495667_0034571 3300046559 Bacteria 3379
240 Ga0495635_0036342 3300046663 Bacteria 3414
241 Ga0495657_0000007 3300046675 Bacteria 222471
242 Ga0495646_0099329 3300046680 Bacteria 1671
243 Ga0495600_0088322 3300046809 Bacteria 2022
244 Ga0495604_0021688 3300047317 Bacteria 5128
245 Ga0495672_0193288 3300047320 Bacteria 1022
246 Ga0495684_0112951 3300047471 Bacteria 2048
247 Ga0495602_0087223 3300048088 Bacteria 2602
248 Ga0496107_0168839 3300048910 Bacteria 1623
249 Ga0501293_001226 3300049516 Bacteria 1921
250 Ga0501298_012308 3300049521 Bacteria 1499
251 Ga0501300_001551 3300049523 Bacteria 3453
252 Ga0501302_001554 3300049525 Bacteria 1270
253 Ga0501031_0003125 3300049568 Bacteria 10613
254 Ga0501031_0003310 3300049568 Bacteria 10343
255 Ga0501031_0037183 3300049568 Bacteria 3176
256 Ga0501031_0039790 3300049568 Bacteria 3068
257 Ga0501032_0019312 3300049569 Bacteria 4769
258 Ga0501032_0052859 3300049569 Bacteria 2737
259 Ga0501033_0046858 3300049570 Bacteria 3214
260 Ga0501034_0041763 3300049571 Bacteria 4640
261 Ga0501036_0001222 3300049572 Bacteria 19610
262 Ga0501036_0087873 3300049572 Bacteria 2627
263 Ga0501036_0118125 3300049572 Bacteria 2239
264 Ga0501037_0002137 3300049573 Bacteria 14302
265 Ga0501037_0011843 3300049573 Bacteria 6424
266 Ga0501037_0026928 3300049573 Bacteria 4247
267 Ga0501037_0146459 3300049573 Bacteria 1689
268 Ga0501038_0007097 3300049574 Bacteria 10346
269 Ga0501038_0009249 3300049574 Bacteria 9041
270 Ga0501038_0216956 3300049574 Bacteria 1528
271 Ga0501039_0003062 3300049575 Bacteria 12506
272 Ga0501039_0003609 3300049575 Bacteria 11603
273 Ga0501039_0004206 3300049575 Bacteria 10840
274 Ga0501039_0008703 3300049575 Bacteria 7726
275 Ga0501039_0023110 3300049575 Bacteria 4769
276 Ga0501039_0031486 3300049575 Bacteria 4090
277 Ga0501040_0033638 3300049576 Bacteria 3474
278 Ga0501041_0002704 3300049577 Bacteria 10112
279 Ga0501041_0017623 3300049577 Bacteria 4249
280 Ga0501041_0022487 3300049577 Bacteria 3775
281 Ga0501042_0001399 3300049578 Bacteria 14169
282 Ga0501042_0016427 3300049578 Bacteria 5079
283 Ga0501042_0023457 3300049578 Bacteria 4319
284 Ga0501042_0030456 3300049578 Bacteria 3810
285 Ga0501043_0007954 3300049579 Bacteria 8378
286 Ga0501043_0182945 3300049579 Bacteria 1633
287 Ga0501046_0001287 3300049580 Bacteria 24285
288 Ga0501046_0005632 3300049580 Bacteria 11181
289 Ga0501047_0041957 3300049581 Bacteria 4422
290 Ga0501047_0099663 3300049581 Bacteria 2784
291 Ga0501048_0003411 3300049582 Bacteria 12074
292 Ga0501067_0011259 3300049583 Bacteria 4950
293 Ga0501068_0007834 3300049584 Bacteria 5918
294 Ga0501069_0036316 3300049585 Bacteria 2717
295 Ga0501070_0086774 3300049586 Bacteria 2590
296 Ga0501072_0016331 3300049588 Bacteria 5695
297 Ga0501072_0282916 3300049588 Bacteria 1319
298 Ga0501073_0072885 3300049589 Bacteria 2391
299 Ga0501074_0002177 3300049590 Bacteria 13583
300 Ga0501076_0118206 3300049592 Bacteria 2146
301 Ga0501077_0013509 3300049593 Bacteria 5121
302 Ga0501077_0091540 3300049593 Bacteria 1927
303 Ga0501201_002163 3300049651 Bacteria 1801
304 Ga0501207_012309 3300049654 Bacteria 1285
305 Ga0501235_001320 3300049669 Bacteria 5242
306 Ga0501236_005128 3300049670 Bacteria 1578
307 Ga0501239_001160 3300049672 Bacteria 2216
308 Ga0501079_0005193 3300049741 Bacteria 9679
309 Ga0501079_0169030 3300049741 Bacteria 1705
310 Ga0501079_0252622 3300049741 Bacteria 1378
311 Ga0501080_0000778 3300049742 Bacteria 25920
312 Ga0501083_0015841 3300049744 Bacteria 5277
313 Ga0501083_0225677 3300049744 Bacteria 1220
314 Ga0501264_004528 3300049761 Bacteria 1261
315 Ga0501271_001007 3300049768 Bacteria 2379
316 Ga0501272_001510 3300049769 Bacteria 2214
317 Ga0501278_002488 3300049774 Bacteria 1297
318 Ga0501279_000926 3300049775 Bacteria 3876
319 Ga0501281_01689 3300049777 Bacteria 1699
320 Ga0501035_0006619 3300049822 Bacteria 10847
321 Ga0501035_0029429 3300049822 Bacteria 5008
322 Ga0501035_0037389 3300049822 Bacteria 4396
323 Ga0501035_0123290 3300049822 Bacteria 2263
324 Ga0501044_0002354 3300049823 Bacteria 21568
325 Ga0501044_0007898 3300049823 Bacteria 11699
326 nmdc:mga05p37_10353_c1 3300050507 Bacteria 11070
327 nmdc:mga05p37_239384_c1 3300050507 Bacteria 2183
328 nmdc:mga05p37_30761_c1 3300050507 Bacteria 6552
329 nmdc:mga05p37_3242_c1 3300050507 Bacteria 18957
330 nmdc:mga05p37_56688_c1 3300050507 Bacteria 4824
331 nmdc:mga0qj67_5485_c1 3300050509 Bacteria 9272
332 nmdc:mga0qj67_61376_c1 3300050509 Bacteria 2985
333 nmdc:mga06r32_152551_c1 3300050510 Bacteria 2289
334 nmdc:mga06r32_7667_c1 3300050510 Bacteria 9709
335 nmdc:mga0n895_103869_c1 3300050512 Bacteria 2854
336 nmdc:mga0n895_15323_c1 3300050512 Bacteria 6985
337 nmdc:mga0rr50_35718_c1 3300050513 Bacteria 3572
338 nmdc:mga08x19_116255_c1 3300050514 Bacteria 1788
339 nmdc:mga08x19_223027_c1 3300050514 Bacteria 1296
340 nmdc:mga08x19_96540_c1 3300050514 Bacteria 1956
341 nmdc:mga0a205_42904_c1 3300050515 Bacteria 4360
342 nmdc:mga0a205_7041_c1 3300050515 Bacteria 10159
343 Ga0495619_0126595 3300053085 Bacteria 1753
344 Ga0501084_0001785 3300054114 Bacteria 17123
345 Ga0501084_0352416 3300054114 Bacteria 1243
346 Ga0501082_0000511 3300060353 Bacteria 34443
347 Ga0501082_0167349 3300060353 Bacteria 1910
348 Ga0501082_0189318 3300060353 Bacteria 1790
349 Ga0501031_0004416
350 SwRhRL2b_contig_595538
351 JGI26145J50221_1000515
352 JGI26133J50247_100138
353 Ga0065704_10075949
354 Ga0065712_10073988
355 Ga0065707_10093087
356 Ga0070658_10007591
357 Ga0070658_10041381
358 Ga0070658_10106673
359 Ga0070676_10001216
360 Ga0070690_100000194
361 Ga0070690_100009124
362 Ga0070690_100032417
363 Ga0070670_100015946
364 Ga0068869_100013312
365 Ga0070680_100008501
366 Ga0070682_100055403
367 Ga0070682_100142949
368 Ga0070660_100011776
369 Ga0070689_100027427
370 Ga0070687_100020708
371 Ga0070661_100004059
372 Ga0070661_100031153
373 Ga0070668_100004431
374 Ga0070669_100005657
375 Ga0070675_100012044
376 Ga0070674_100002350
377 Ga0070673_100002253
378 Ga0070673_100362829
379 Ga0070688_100004041
380 Ga0070659_100016929
381 Ga0070667_100038453
382 Ga0070709_10074866
383 Ga0070714_100003082
384 Ga0070713_100001622
385 Ga0070711_100024054
386 Ga0070711_100055462
387 Ga0070711_100067047
388 Ga0070694_100006786
389 Ga0070678_100007856
390 Ga0070681_10005863
391 Ga0070681_10043825
392 Ga0070681_10136708
393 Ga0070681_10178838
394 Ga0068867_100199184
395 Ga0070706_100004434
396 Ga0070679_100072699
397 Ga0070679_100242125
398 Ga0070672_100023212
399 Ga0070686_100011701
400 Ga0070695_100015194
401 Ga0070696_100005817
402 Ga0070665_100010717
403 Ga0070665_100202430
404 Ga0070665_100274174
405 Ga0068855_100006509
406 Ga0068855_100014560
407 Ga0068855_100193464
408 Ga0070664_100006913
409 Ga0070664_100219138
410 Ga0070702_100023018
411 Ga0068852_100315349
412 Ga0068866_10010297
413 Ga0068870_10009424
414 Ga0068858_100276706
415 Ga0068858_100357299
416 Ga0068862_100026227
417 Ga0081455_10001969
418 Ga0081455_10053560
419 Ga0075432_10000459
420 Ga0097621_100048440
421 Ga0068871_100007265
422 Ga0068871_100090904
423 Ga0075428_100041045
424 Ga0075430_100002997
425 Ga0075430_100005182
426 Ga0075430_100012948
427 Ga0075431_100022418
428 Ga0075431_100073549
429 Ga0075431_100105549
430 Ga0075433_10054187
431 Ga0075434_100020995
432 Ga0075429_100005494
433 Ga0068865_100004728
434 Ga0105240_10000644
435 Ga0105240_10095917
436 Ga0105245_10004258
437 Ga0114129_10000835
438 Ga0114129_10046839
439 Ga0114129_10211519
440 Ga0114129_10287762
441 Ga0105243_10159561
442 Ga0105242_10011584
443 Ga0105248_10658784
444 Ga0105249_10017399
445 Ga0105249_10166633
446 Ga0105239_10018626
447 Ga0105239_10475402
448 Ga0157371_10076752
449 Ga0157370_10017847
450 Ga0157369_10068077
451 Ga0157374_10120399
452 Ga0157378_10008190
453 Ga0157378_10079648
454 Ga0157372_10047225
455 Ga0157375_10006171
456 Ga0157375_10091192
457 Ga0157380_10104224
458 Ga0157377_10014874
459 Ga0157379_10156807
460 Ga0157376_10002662
461 Ga0213875_10000002
462 Ga0213875_10002455
463 Ga0213871_10000579
464 Ga0207642_10012542
465 Ga0207688_10091667
466 Ga0207645_10004288
467 Ga0207705_10016252
468 Ga0207705_10056894
469 Ga0207705_10078426
470 Ga0207707_10012846
471 Ga0207707_10091895
472 Ga0207707_10174191
473 Ga0207695_10002661
474 Ga0207695_10057948
475 Ga0207663_10085878
476 Ga0207663_10163973
477 Ga0207660_10005426
478 Ga0207662_10006623
479 Ga0207662_10012361
480 Ga0207657_10001426
481 Ga0207649_10041829
482 Ga0207681_10012681
483 Ga0207694_10000435
484 Ga0207650_10015822
485 Ga0207700_10000647
486 Ga0207664_10016657
487 Ga0207664_10244252
488 Ga0207644_10265902
489 Ga0207690_10007833
490 Ga0207706_10000793
491 Ga0207686_10005315
492 Ga0207670_10006155
493 Ga0207704_10003273
494 Ga0207704_10047623
495 Ga0207691_10000089
496 Ga0207689_10008288
497 Ga0207679_10003844
498 Ga0207679_10037995
499 Ga0207667_10022570
500 Ga0207667_10048913
501 Ga0207651_10054610
502 Ga0207651_10181766
503 Ga0207712_10077057
504 Ga0207668_10076170
505 Ga0207658_10002353
506 Ga0207658_10033173
507 Ga0207677_10081518
508 Ga0207703_10233056
509 Ga0207678_10091979
510 Ga0207708_10001017
511 Ga0207648_10004237
512 Ga0207674_10008535
513 Ga0207683_10002511
514 Ga0207698_10090796
515 Ga0209973_1000120
516 Ga0209969_1000238
517 Ga0209967_1000094
518 Ga0209981_1000201
519 Ga0209996_1000001
520 Ga0209984_1000104
521 Ga0210000_1000133
522 Ga0209995_1000203
523 Ga0209968_1000073
524 Ga0209999_1000813
525 Ga0209970_1000461
526 Ga0210002_1000025
527 Ga0209983_1000402
528 Ga0209971_1000462
529 Ga0209966_1000133
530 Ga0209998_10000165
531 Ga0209974_10000773
532 Ga0209974_10005891
533 Ga0207428_10033213
534 Ga0268266_10010555
535 Ga0268265_10006799
536 Ga0268265_10036976
537 Ga0268264_10056784
538 Ga0268264_10244064
539 Ga0265323_10010621
540 Ga0265338_10011891
541 Ga0265338_10143006
542 Ga0265330_10005608
543 Ga0265330_10045000
544 Ga0265332_10000101
545 Ga0265320_10005498
546 Ga0265325_10034001
547 Ga0265329_10006564
548 Ga0265329_10011306
549 Ga0265329_10022758
550 Ga0265340_10003905
551 Ga0265331_10000048
552 Ga0265331_10004665
553 Ga0265316_10000897
554 Ga0265316_10004073
555 Ga0265316_10288716
556 Ga0307408_100014977
557 Ga0307408_100071228
558 Ga0265314_10001664
559 Ga0265342_10008540
560 Ga0307416_100265302
561 Ga0307411_10042237
562 Ga0373931_0093697
563 Ga0373935_0044679
564 Ga0373927_0086788
565 Ga0373947_0223136
566 Ga0373937_0007136
567 Ga0436364_0612043
568 Ga0436364_0810236
569 Ga0436364_1229252
570 Ga0436365_1646043
571 Ga0436360_0364875
572 Ga0453684_0401124
573 Ga0451576_0031129
574 Ga0451576_0032580
575 Ga0451576_0239664
576 Ga0466967_0032980
577 Ga0495592_0142470
578 Ga0495651_0008601
579 Ga0495653_0041801
580 Ga0495580_0029388
581 Ga0495664_0003111
582 Ga0495594_0023816
583 Ga0495630_0000298
584 Ga0495630_0094001
585 Ga0495587_0011206
586 Ga0495645_0011557
587 Ga0495667_0034571
588 Ga0495635_0036342
589 Ga0495657_0000007
590 Ga0495646_0099329
591 Ga0495600_0088322
592 Ga0495604_0021688
593 Ga0495672_0193288
594 Ga0495684_0112951
595 Ga0495602_0087223
596 Ga0496107_0168839
597 Ga0501293_001226
598 Ga0501298_012308
599 Ga0501300_001551
600 Ga0501302_001554
601 Ga0501031_0003125
602 Ga0501031_0003310
603 Ga0501031_0037183
604 Ga0501031_0039790
605 Ga0501032_0019312
606 Ga0501032_0052859
607 Ga0501033_0046858
608 Ga0501034_0041763
609 Ga0501036_0001222
610 Ga0501036_0087873
611 Ga0501036_0118125
612 Ga0501037_0002137
613 Ga0501037_0011843
614 Ga0501037_0026928
615 Ga0501037_0146459
616 Ga0501038_0007097
617 Ga0501038_0009249
618 Ga0501038_0216956
619 Ga0501039_0003062
620 Ga0501039_0003609
621 Ga0501039_0004206
622 Ga0501039_0008703
623 Ga0501039_0023110
624 Ga0501039_0031486
625 Ga0501040_0033638
626 Ga0501041_0002704
627 Ga0501041_0017623
628 Ga0501041_0022487
629 Ga0501042_0001399
630 Ga0501042_0016427
631 Ga0501042_0023457
632 Ga0501042_0030456
633 Ga0501043_0007954
634 Ga0501043_0182945
635 Ga0501046_0001287
636 Ga0501046_0005632
637 Ga0501047_0041957
638 Ga0501047_0099663
639 Ga0501048_0003411
640 Ga0501067_0011259
641 Ga0501068_0007834
642 Ga0501069_0036316
643 Ga0501070_0086774
644 Ga0501072_0016331
645 Ga0501072_0282916
646 Ga0501073_0072885
647 Ga0501074_0002177
648 Ga0501076_0118206
649 Ga0501077_0013509
650 Ga0501077_0091540
651 Ga0501201_002163
652 Ga0501207_012309
653 Ga0501235_001320
654 Ga0501236_005128
655 Ga0501239_001160
656 Ga0501079_0005193
657 Ga0501079_0169030
658 Ga0501079_0252622
659 Ga0501080_0000778
660 Ga0501083_0015841
661 Ga0501083_0225677
662 Ga0501264_004528
663 Ga0501271_001007
664 Ga0501272_001510
665 Ga0501278_002488
666 Ga0501279_000926
667 Ga0501281_01689
668 Ga0501035_0006619
669 Ga0501035_0029429
670 Ga0501035_0037389
671 Ga0501035_0123290
672 Ga0501044_0002354
673 Ga0501044_0007898
674 nmdc:mga05p37_10353_c1
675 nmdc:mga05p37_239384_c1
676 nmdc:mga05p37_30761_c1
677 nmdc:mga05p37_3242_c1
678 nmdc:mga05p37_56688_c1
679 nmdc:mga0qj67_5485_c1
680 nmdc:mga0qj67_61376_c1
681 nmdc:mga06r32_152551_c1
682 nmdc:mga06r32_7667_c1
683 nmdc:mga0n895_103869_c1
684 nmdc:mga0n895_15323_c1
685 nmdc:mga0rr50_35718_c1
686 nmdc:mga08x19_116255_c1
687 nmdc:mga08x19_223027_c1
688 nmdc:mga08x19_96540_c1
689 nmdc:mga0a205_42904_c1
690 nmdc:mga0a205_7041_c1
691 Ga0495619_0126595
692 Ga0501084_0001785
693 Ga0501084_0352416
694 Ga0501082_0000511
695 Ga0501082_0167349
696 Ga0501082_0189318

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00988

CPSase_sm_chain

Carbamoyl-phosphate synthase small chain, CPSase domain

17

142

0.99

PF00117

GATase

Glutamine amidotransferase class-I

208

398

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c30-assembly1.cif.gz_B crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s 0.9281 1 389
1a9x-assembly1.cif.gz_B carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis 0.9272 1 389
1cs0-assembly4.cif.gz_B crystal structure of carbamoyl phosphate synthetase complexed at cys269 in the small subunit with the tetrahedral mimic l-glutamate gamma-semialdehyde 0.9233 1 389
1c30-assembly1.cif.gz_B crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s 0.9209 1 389
1jdb-assembly1.cif.gz_F carbamoyl phosphate synthetase from escherichia coli 0.9205 1 389
ID Description Score Start End Superfamily
af_Q2FZ73_174_352_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9422 193 382 3.40.50.880
af_P0A6F1_2_151_3.50.30.20 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Carbamoyl-phosphate synthase small subunit, N-terminal domain 0.9402 1 149 3.50.30.20
af_P9WPK5_1_155_3.50.30.20 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Carbamoyl-phosphate synthase small subunit, N-terminal domain 0.9394 1 151 3.50.30.20
af_C6TIQ8_51_199_3.50.30.20 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Carbamoyl-phosphate synthase small subunit, N-terminal domain 0.9371 4 149 3.50.30.20
af_K7TZS8_259_480_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9364 152 388 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2S8K3P7-F1-model_v4 deleted 0.9978 211 315
AF-X1QMB8-F1-model_v4 carbamoyl-phosphate synthase (glutamine-hydrolyzing) (EC 6.3.5.5) 0.9943 217 314 GO:0005524
GO:0016874
AF-A0A7W1MN37-F1-model_v4 deleted 0.9714 193 388
AF-A0A810MLL8-F1-model_v4 deleted 0.9654 2 390
AF-A0A1G3BFP5-F1-model_v4 carbamoyl-phosphate synthase (glutamine-hydrolyzing) (EC 6.3.5.5) (Arginine-specific carbamoyl phosphate synthetase, glutamine chain) 0.9654 42 387 GO:0004088
GO:0005524
GO:0006207
GO:0006541

Map