F417762

General Info

Members Datasets Scaffolds Average Seq Length
349 272 182 141

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10014944|JGI25151J46595_100149443
Length 149
Sequence MSLLERLNSDMKQAMKEKNKDKLNVIRMVKASLQNEVISLGNNVTLSADQELTILTREVKQRKDSLLEFEKAGRADLVDKLKQELLILEEYLPQQLSEEELLEIVRVTISEVGATSKADMGKVMSAVMPKVKGQADGSSVNKAVASLLK

Samples

Sample ID Description Type Environment
1 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
2 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
3 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
4 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
5 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
6 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
7 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
8 2554235283 Bacillus safensis VK Isolate Rhizosphere
9 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
10 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
11 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
12 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
13 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
14 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
15 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
16 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
17 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
18 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
19 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
20 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
21 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
22 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
23 2643221729 Bacillus sp. Root11 Isolate Unclassified
24 2643221730 Bacillus sp. Root131 Isolate Unclassified
25 2643221735 Bacillus sp. Root920 Isolate Unclassified
26 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
27 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
28 2671180694 Paenibacillus sp. A3 Isolate Unclassified
29 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
30 2684622632 Bacillus cereus 905 Isolate Unclassified
31 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
32 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
33 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
34 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
35 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
36 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
37 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
38 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
39 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
40 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
41 2738541295 Bacillus sp. OK085 Isolate Unclassified
42 2738541358 Bacillus sp. OV752 Isolate Unclassified
43 2738543006 Bacillus sp. OK077 Isolate Unclassified
44 2738543010 Bacillus sp. YR335 Isolate Unclassified
45 2738543017 Bacillus sp. OV186 Isolate Unclassified
46 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
47 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
48 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
49 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
50 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
51 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
52 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
53 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
54 2811994870 Bacillus sp. JB4 Isolate Unclassified
55 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
56 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
57 2818991441 Niallia circulans 3243 Isolate Rhizosphere
58 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
59 2818991459 Paenibacillus sp. 597 Isolate Unclassified
60 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
61 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
62 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
63 2842682962 Bacillus sp. R-72492 Isolate Unclassified
64 2849139964 Bacillus sp. R-71875 Isolate Unclassified
65 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
66 2857581216 Bacillus sp. R-71922 Isolate Unclassified
67 2857586860 Bacillus sp. R-71935 Isolate Unclassified
68 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
69 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
70 2860837431 Bacillus sp. WR11 Isolate Unclassified
71 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
72 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
73 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
74 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
75 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
76 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
77 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
78 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
79 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
80 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
81 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
82 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
83 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
84 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
85 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
86 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
87 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
88 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
89 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
90 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
91 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
92 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
93 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
94 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
95 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
96 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
97 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
98 2919726948 Bacillus pumilus 4489 Isolate Unclassified
99 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
100 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
101 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
102 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
103 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
104 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
105 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
106 2938917290 Bacillus sp. CR71 Isolate Unclassified
107 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
108 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
109 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
110 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
111 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
112 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
113 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
114 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
115 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
116 2965761152 Bacillus sp. COPE52 Isolate Unclassified
117 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
118 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
119 2969141011 Bacillus velezensis MH25 Isolate Unclassified
120 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
121 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
122 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
123 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
124 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
125 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
126 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
127 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
128 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
129 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
130 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
131 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
132 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
133 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
134 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
135 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
136 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
137 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
138 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
139 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
140 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
141 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
142 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
143 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
144 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
145 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
146 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
147 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
148 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
149 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
150 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
151 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
152 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
153 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
154 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
155 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
156 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
157 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
158 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
159 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
160 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
165 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
175 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
176 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
177 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
178 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
182 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
185 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
239 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
240 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
241 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
253 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
254 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
255 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
256 8022653035 Bacillus sp. Rc4 Isolate Unclassified
257 8022792930 Bacillus sp. Xin Isolate Rhizosphere
258 8023438354 Bacillus sp. BH2 Isolate Unclassified
259 8023444577 Bacillus sp. BH32 Isolate Unclassified
260 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
261 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
262 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
263 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
264 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
265 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
266 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
267 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
268 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
269 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
270 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
271 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
272 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 21.2
Metatranscriptomes 30.95
Isolates 47.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 5.44
Nodule 0.29
Rhizoplane 4.01
Rhizosphere 66.48
Stem 0
Stem Tuber 0
Unclassified 23.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10014944 3300003187 Bacteria 3444
2 Ga0007410J51695_1008935 3300003574 Bacteria 691
3 Ga0007409J51694_1004769 3300003575 Bacteria 704
4 Ga0006562J51391_1000517 3300003578 Bacteria 748
5 Ga0006562J51391_1002291 3300003578 Bacteria 789
6 Ga0055532_1000046 3300003758 Bacteria 182389
7 Ga0055536_1021119 3300003781 Bacteria 1986
8 Ga0055534_1024461 3300003784 Bacteria 978
9 Ga0055541_1006413 3300003841 Bacteria 1995
10 Ga0105244_10033055 3300009036 Bacteria 2731
11 Ga0105244_10051786 3300009036 Bacteria 2092
12 Ga0105243_10275710 3300009148 Bacteria 1512
13 Ga0105249_10436868 3300009553 Bacteria 1345
14 Ga0105246_10148237 3300011119 Bacteria 1773
15 Ga0157371_10091929 3300013102 Bacteria 2149
16 Ga0224712_10397218 3300022467 Bacteria 657
17 Ga0209784_101957 3300025224 Bacteria 2330
18 Ga0209566_100741 3300025225 Bacteria 18145
19 Ga0209147_100014 3300025229 Bacteria 597841
20 Ga0209147_104281 3300025229 Bacteria 2432
21 Ga0209130_1002012 3300025284 Bacteria 11080
22 Ga0209130_1028034 3300025284 Bacteria 1188
23 Ga0209130_1030571 3300025284 Bacteria 1112
24 Ga0209675_1016293 3300025291 Bacteria 2171
25 Ga0209675_1019917 3300025291 Bacteria 1832
26 Ga0209025_1000539 3300025294 Bacteria 71638
27 Ga0209025_1001023 3300025294 Bacteria 41159
28 Ga0209025_1004879 3300025294 Bacteria 11303
29 Ga0209025_1005101 3300025294 Bacteria 10922
30 Ga0209025_1005789 3300025294 Bacteria 9913
31 Ga0207696_1011600 3300025711 Bacteria 3164
32 Ga0207696_1018483 3300025711 Bacteria 2287
33 Ga0207655_1003872 3300025728 Bacteria 10887
34 Ga0207655_1065421 3300025728 Bacteria 1380
35 Ga0207712_10280640 3300025961 Bacteria 1359
36 Ga0209969_1054977 3300027360 Bacteria 626
37 Ga0209984_1028407 3300027424 Bacteria 785
38 Ga0307416_103216125 3300032002 Bacteria 547
39 Ga0395898_1256748 3300037466 Bacteria 671
40 Ga0395898_1393181 3300037466 Bacteria 629
41 Ga0237819_00842 3300038705 Bacteria 9660
42 Ga0439439_0096749 3300041406 Bacteria 810
43 Ga0439433_0017121 3300041999 Bacteria 1608
44 Ga0439449_0008656 3300042007 Bacteria 3862
45 Ga0439462_0077924 3300042015 Bacteria 904
46 Ga0466967_0235166 3300045976 Bacteria 1746
47 Ga0495603_0238274 3300046455 Bacteria 1048
48 Ga0495591_034000 3300046458 Bacteria 1504
49 Ga0495584_0030614 3300046491 Bacteria 2725
50 Ga0495594_0384032 3300046499 Bacteria 799
51 Ga0495654_0066759 3300046530 Bacteria 1714
52 Ga0495622_0034326 3300046557 Bacteria 2366
53 Ga0495633_0437845 3300046558 Bacteria 591
54 Ga0495661_0070809 3300046665 Bacteria 2040
55 Ga0495649_0297522 3300046694 Bacteria 822
56 Ga0495649_0326392 3300046694 Bacteria 778
57 Ga0495660_0015905 3300046810 Bacteria 4342
58 Ga0495660_0105207 3300046810 Bacteria 1447
59 Ga0495636_0065283 3300047318 Bacteria 1546
60 Ga0495626_0040898 3300048091 Bacteria 2187
61 Ga0496102_0021870 3300048905 Bacteria 5662
62 Ga0496102_0552718 3300048905 Bacteria 1074
63 Ga0496102_1111351 3300048905 Bacteria 710
64 Ga0496103_0157521 3300048906 Bacteria 1456
65 Ga0496104_0343900 3300048907 Bacteria 1405
66 Ga0496104_1042033 3300048907 Bacteria 722
67 Ga0496109_0031640 3300048912 Bacteria 4751
68 Ga0496111_0003693 3300048914 Bacteria 9514
69 Ga0496111_0138313 3300048914 Bacteria 1804
70 Ga0496112_0280535 3300048915 Bacteria 1613
71 Ga0496113_0417772 3300048916 Bacteria 1077
72 Ga0496113_1458315 3300048916 Bacteria 529
73 Ga0496116_0068737 3300048919 Bacteria 2256
74 Ga0496116_0368749 3300048919 Bacteria 649
75 Ga0496121_0133772 3300048924 Bacteria 1851
76 Ga0496122_0035375 3300048925 Bacteria 4065
77 Ga0501306_002186 3300049127 Bacteria 1969
78 Ga0501306_013462 3300049127 Bacteria 1067
79 Ga0501306_044404 3300049127 Bacteria 697
80 Ga0501306_048175 3300049127 Bacteria 678
81 Ga0501308_000570 3300049128 Bacteria 2483
82 Ga0501309_003606 3300049129 Bacteria 1762
83 Ga0501309_042055 3300049129 Bacteria 700
84 Ga0501309_061523 3300049129 Bacteria 605
85 Ga0501309_076519 3300049129 Bacteria 556
86 Ga0501310_004123 3300049130 Bacteria 1447
87 Ga0501341_07340 3300049131 Bacteria 689
88 Ga0501341_10978 3300049131 Bacteria 601
89 Ga0501341_13456 3300049131 Bacteria 562
90 Ga0501341_14692 3300049131 Bacteria 545
91 Ga0501343_008862 3300049132 Bacteria 808
92 Ga0501304_008521 3300049160 Bacteria 865
93 Ga0501305_003237 3300049161 Bacteria 1831
94 Ga0501305_047795 3300049161 Bacteria 712
95 Ga0501305_063981 3300049161 Bacteria 637
96 Ga0501305_119041 3300049161 Bacteria 505
97 Ga0501307_003760 3300049162 Bacteria 1509
98 Ga0501307_035222 3300049162 Bacteria 710
99 Ga0501307_038731 3300049162 Bacteria 686
100 Ga0501307_073283 3300049162 Bacteria 549
101 Ga0501342_02269 3300049163 Bacteria 646
102 Ga0501311_022743 3300049527 Bacteria 863
103 Ga0501311_036286 3300049527 Bacteria 732
104 Ga0501312_004059 3300049528 Bacteria 1705
105 Ga0501312_031901 3300049528 Bacteria 830
106 Ga0501312_068347 3300049528 Bacteria 626
107 Ga0501312_078057 3300049528 Bacteria 596
108 Ga0501313_006736 3300049529 Bacteria 1251
109 Ga0501313_024110 3300049529 Bacteria 765
110 Ga0501313_028993 3300049529 Bacteria 712
111 Ga0501313_051342 3300049529 Bacteria 571
112 Ga0501314_019257 3300049530 Bacteria 700
113 Ga0501314_019775 3300049530 Bacteria 693
114 Ga0501315_028360 3300049531 Bacteria 794
115 Ga0501315_032234 3300049531 Bacteria 760
116 Ga0501315_044205 3300049531 Bacteria 683
117 Ga0501315_088014 3300049531 Bacteria 535
118 Ga0501316_000467 3300049532 Bacteria 2784
119 Ga0501316_007584 3300049532 Bacteria 1182
120 Ga0501316_020338 3300049532 Bacteria 832
121 Ga0501316_064142 3300049532 Bacteria 547
122 Ga0501316_068492 3300049532 Bacteria 534
123 Ga0501317_032067 3300049533 Bacteria 767
124 Ga0501317_033296 3300049533 Bacteria 758
125 Ga0501317_052024 3300049533 Bacteria 653
126 Ga0501317_094278 3300049533 Bacteria 533
127 Ga0501317_095026 3300049533 Bacteria 531
128 Ga0501318_032239 3300049534 Bacteria 718
129 Ga0501318_037498 3300049534 Bacteria 682
130 Ga0501318_044930 3300049534 Bacteria 642
131 Ga0501318_057754 3300049534 Bacteria 590
132 Ga0501319_012872 3300049535 Bacteria 689
133 Ga0501320_011311 3300049536 Bacteria 923
134 Ga0501320_026723 3300049536 Bacteria 699
135 Ga0501320_054352 3300049536 Bacteria 552
136 Ga0501321_018389 3300049537 Bacteria 848
137 Ga0501321_030906 3300049537 Bacteria 715
138 Ga0501322_010061 3300049538 Bacteria 724
139 Ga0501323_035618 3300049539 Bacteria 714
140 Ga0501323_039409 3300049539 Bacteria 688
141 Ga0501323_065853 3300049539 Bacteria 573
142 Ga0501323_082864 3300049539 Bacteria 526
143 Ga0501323_088256 3300049539 Bacteria 514
144 Ga0501324_012302 3300049540 Bacteria 800
145 Ga0501324_012960 3300049540 Bacteria 785
146 Ga0501324_035309 3300049540 Bacteria 558
147 Ga0501326_08336 3300049542 Bacteria 601
148 Ga0501327_04135 3300049543 Bacteria 822
149 Ga0501328_04266 3300049544 Bacteria 689
150 Ga0501329_07768 3300049545 Bacteria 634
151 Ga0501330_005889 3300049546 Bacteria 791
152 Ga0501331_06176 3300049547 Bacteria 696
153 Ga0501332_04693 3300049548 Bacteria 822
154 Ga0501332_13100 3300049548 Bacteria 575
155 Ga0501333_007982 3300049549 Bacteria 724
156 Ga0501335_015549 3300049551 Bacteria 778
157 Ga0501335_023367 3300049551 Bacteria 670
158 Ga0501335_038669 3300049551 Bacteria 557
159 Ga0501336_016143 3300049552 Bacteria 646
160 Ga0501337_004952 3300049553 Bacteria 882
161 Ga0501337_008440 3300049553 Bacteria 731
162 Ga0501338_03853 3300049554 Bacteria 898
163 Ga0501338_11136 3300049554 Bacteria 612
164 Ga0501198_092528 3300049649 Bacteria 602
165 Ga0501202_125039 3300049652 Bacteria 650
166 Ga0501208_110095 3300049655 Bacteria 598
167 Ga0587077_248360 3300059493 Bacteria 513
168 Ga0587080_057947 3300059503 Bacteria 748
169 Ga0587082_017379 3300059504 Bacteria 1133
170 Ga0587083_0021288 3300059505 Bacteria 1203
171 Ga0587083_0106879 3300059505 Bacteria 705
172 Ga0587106_035976 3300059605 Bacteria 819
173 Ga0587067_063312 3300059640 Bacteria 781
174 Ga0587067_094575 3300059640 Bacteria 683
175 Ga0587067_103954 3300059640 Bacteria 661
176 Ga0587068_051953 3300059641 Bacteria 769
177 Ga0587072_056390 3300059643 Bacteria 799
178 Ga0587072_085249 3300059643 Bacteria 689
179 Ga0587075_061887 3300059644 Bacteria 677
180 Ga0587076_044607 3300059645 Bacteria 842
181 Ga0587079_009797 3300059647 Bacteria 1502
182 Ga0587079_017627 3300059647 Bacteria 1242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003578 Ga0006562J51391_1000517 Ga0006562J51391_10005172 118
2 3300038705 Ga0237819_00842 Ga0237819_00842_9237_9650 118
3 3300042015 Ga0439462_0077924 Ga0439462_0077924_12_374 120
4 3300046558 Ga0495633_0437845 Ga0495633_0437845_104_550 120
5 3300049531 Ga0501315_044205 Ga0501315_044205_11_457 120
6 3300049534 Ga0501318_044930 Ga0501318_044930_179_625 120
7 3300049548 Ga0501332_13100 Ga0501332_13100_76_522 120
8 3300049551 Ga0501335_023367 Ga0501335_023367_10_456 120
9 3300049649 Ga0501198_092528 Ga0501198_092528_24_386 120
10 3300032002 Ga0307416_103216125 Ga0307416_1032161251 121
11 3300037466 Ga0395898_1256748 Ga0395898_1256748_197_643 121
12 3300049129 Ga0501309_076519 Ga0501309_076519_88_534 121
13 3300049131 Ga0501341_13456 Ga0501341_13456_98_544 121
14 3300049132 Ga0501343_008862 Ga0501343_008862_142_588 121
15 3300049161 Ga0501305_119041 Ga0501305_119041_10_456 121
16 3300049162 Ga0501307_073283 Ga0501307_073283_93_539 121
17 3300049163 Ga0501342_02269 Ga0501342_02269_178_624 121
18 3300049529 Ga0501313_024110 Ga0501313_024110_102_548 121
19 3300049530 Ga0501314_019775 Ga0501314_019775_226_672 121
20 3300049532 Ga0501316_068492 Ga0501316_068492_92_457 121
21 3300049534 Ga0501318_037498 Ga0501318_037498_226_672 121
22 3300049536 Ga0501320_054352 Ga0501320_054352_19_465 121
23 3300049545 Ga0501329_07768 Ga0501329_07768_170_616 121
24 3300049554 Ga0501338_11136 Ga0501338_11136_79_525 121
25 3300009036 Ga0105244_10051786 Ga0105244_100517862 122
26 3300022467 Ga0224712_10397218 Ga0224712_103972182 122
27 3300025294 Ga0209025_1001023 Ga0209025_100102338 122
28 3300025728 Ga0207655_1065421 Ga0207655_10654213 122
29 3300027360 Ga0209969_1054977 Ga0209969_10549771 122
30 3300027424 Ga0209984_1028407 Ga0209984_10284071 122
31 3300048905 Ga0496102_1111351 Ga0496102_1111351_186_632 122
32 3300048914 Ga0496111_0138313 Ga0496111_0138313_859_1305 122
33 3300048915 Ga0496112_0280535 Ga0496112_0280535_566_1012 122
34 3300048916 Ga0496113_0417772 Ga0496113_0417772_259_705 122
35 3300049127 Ga0501306_048175 Ga0501306_048175_11_457 122
36 3300049129 Ga0501309_061523 Ga0501309_061523_137_583 122
37 3300049131 Ga0501341_14692 Ga0501341_14692_78_524 122
38 3300049528 Ga0501312_068347 Ga0501312_068347_170_616 122
39 3300049533 Ga0501317_094278 Ga0501317_094278_11_457 122
40 3300049534 Ga0501318_057754 Ga0501318_057754_127_573 122
41 3300049539 Ga0501323_082864 Ga0501323_082864_60_506 122
42 3300049131 Ga0501341_07340 Ga0501341_07340_232_675 123
43 3300059493 Ga0587077_248360 Ga0587077_248360_59_502 123
44 3300059503 Ga0587080_057947 Ga0587080_057947_12_455 123
45 3300059504 Ga0587082_017379 Ga0587082_017379_12_455 123
46 3300059505 Ga0587083_0021288 Ga0587083_0021288_694_1137 123
47 3300059640 Ga0587067_094575 Ga0587067_094575_12_455 123
48 3300059644 Ga0587075_061887 Ga0587075_061887_12_455 123
49 3300059645 Ga0587076_044607 Ga0587076_044607_10_453 123
50 3300059647 Ga0587079_017627 Ga0587079_017627_12_455 123
51 3300049551 Ga0501335_015549 Ga0501335_015549_192_575 124
52 3300059505 Ga0587083_0106879 Ga0587083_0106879_235_678 124
53 3300059641 Ga0587068_051953 Ga0587068_051953_225_668 124
54 3300009036 Ga0105244_10033055 Ga0105244_100330551 127
55 3300009148 Ga0105243_10275710 Ga0105243_102757103 127
56 3300009553 Ga0105249_10436868 Ga0105249_104368683 127
57 3300011119 Ga0105246_10148237 Ga0105246_101482373 127
58 3300025291 Ga0209675_1019917 Ga0209675_10199173 128
59 3300025294 Ga0209025_1005101 Ga0209025_10051018 128
60 3300025711 Ga0207696_1011600 Ga0207696_10116004 128
61 3300025728 Ga0207655_1003872 Ga0207655_100387211 128
62 3300048905 Ga0496102_0552718 Ga0496102_0552718_200_643 128
63 3300048907 Ga0496104_1042033 Ga0496104_1042033_259_702 128
64 iso_pu_bacteria 2916971899 2916973745 129
65 3300025711 Ga0207696_1018483 Ga0207696_10184831 130
66 3300003578 Ga0006562J51391_1002291 Ga0006562J51391_10022912 135
67 3300046810 Ga0495660_0105207 Ga0495660_0105207_300_746 135
68 3300025284 Ga0209130_1002012 Ga0209130_10020121 137
69 3300025294 Ga0209025_1000539 Ga0209025_10005391 137
70 3300046499 Ga0495594_0384032 Ga0495594_0384032_58_471 137
71 3300046530 Ga0495654_0066759 Ga0495654_0066759_790_1203 137
72 3300046557 Ga0495622_0034326 Ga0495622_0034326_1636_2049 137
73 3300046694 Ga0495649_0297522 Ga0495649_0297522_133_546 137
74 3300049655 Ga0501208_110095 Ga0501208_110095_19_432 137
75 3300049540 Ga0501324_035309 Ga0501324_035309_10_426 138
76 3300049551 Ga0501335_038669 Ga0501335_038669_102_518 138
77 3300025961 Ga0207712_10280640 Ga0207712_102806402 139
78 3300049549 Ga0501333_007982 Ga0501333_007982_87_524 139
79 3300025229 Ga0209147_104281 Ga0209147_1042813 140
80 3300013102 Ga0157371_10091929 Ga0157371_100919293 142
81 iso_pu_bacteria 2929206907 2929210652 142
82 iso_pu_bacteria 2512564039 2512735020 143
83 iso_pu_bacteria 2524023129 2524186627 143
84 iso_pu_bacteria 2548877040 2550902448 143
85 iso_pu_bacteria 2551306519 2553393321 143
86 iso_pu_bacteria 2563366752 2563926925 143
87 iso_pu_bacteria 2571042143 2571528677 143
88 iso_pu_bacteria 2571042588 2573038002 143
89 iso_pu_bacteria 2576861424 2578338067 143
90 iso_pu_bacteria 2579778775 2580933769 143
91 iso_pu_bacteria 2585428059 2587737753 143
92 iso_pu_bacteria 2593339198 2595316407 143
93 iso_pu_bacteria 2600255286 2601639170 143
94 iso_pu_bacteria 2619619294 2621276448 143
95 iso_pu_bacteria 2643221543 2643737957 143
96 iso_pu_bacteria 2643221676 2644423161 143
97 iso_pu_bacteria 2643221729 2644708059 143
98 iso_pu_bacteria 2643221730 2644714788 143
99 iso_pu_bacteria 2671180330 2672337029 143
100 iso_pu_bacteria 2671180694 2673821672 143
101 iso_pu_bacteria 2684622632 2685152281 143
102 iso_pu_bacteria 2695420987 2698320880 143
103 iso_pu_bacteria 2703719227 2705996221 143
104 iso_pu_bacteria 2718218445 2721507440 143
105 iso_pu_bacteria 2721755693 2723605038 143
106 iso_pu_bacteria 2728368933 2728534174 143
107 iso_pu_bacteria 2728369359 2730135682 143
108 iso_pu_bacteria 2738541358 2739154518 143
109 iso_pu_bacteria 2738543006 2739208110 143
110 iso_pu_bacteria 2751185905 2753810917 143
111 iso_pu_bacteria 2791355222 2793186077 143
112 iso_pu_bacteria 2802428803 2802437352 143
113 iso_pu_bacteria 2816332186 2816862547 143
114 iso_pu_bacteria 2818991441 2819569322 143
115 iso_pu_bacteria 2818991443 2819583176 143
116 iso_pu_bacteria 2818991459 2819670585 143
117 iso_pu_bacteria 2821111986 2821114749 143
118 iso_pu_bacteria 2842682962 2842684537 143
119 iso_pu_bacteria 2849139964 2849142560 143
120 iso_pu_bacteria 2857453340 2857459308 143
121 iso_pu_bacteria 2857581216 2857585688 143
122 iso_pu_bacteria 2864733723 2864735310 143
123 iso_pu_bacteria 2864997549 2865000003 143
124 iso_pu_bacteria 2865002811 2865003406 143
125 iso_pu_bacteria 2881636855 2881640993 143
126 iso_pu_bacteria 2885526491 2885527895 143
127 iso_pu_bacteria 2888578766 2888580879 143
128 iso_pu_bacteria 2889042446 2889046908 143
129 iso_pu_bacteria 2889049205 2889050440 143
130 iso_pu_bacteria 2889276214 2889280951 143
131 iso_pu_bacteria 2889295896 2889296078 143
132 iso_pu_bacteria 2904113452 2904118104 143
133 iso_pu_bacteria 2904162308 2904163121 143
134 iso_pu_bacteria 2904490793 2904493812 143
135 iso_pu_bacteria 2904595352 2904598269 143
136 iso_pu_bacteria 2904755435 2904760033 143
137 iso_pu_bacteria 2907202186 2907205842 143
138 iso_pu_bacteria 2919160200 2919162891 143
139 iso_pu_bacteria 2919425241 2919427098 143
140 iso_pu_bacteria 2925326138 2925330100 143
141 iso_pu_bacteria 2929233124 2929237983 143
142 iso_pu_bacteria 2931384279 2931390355 143
143 iso_pu_bacteria 2938649242 2938650259 143
144 iso_pu_bacteria 2938917290 2938922172 143
145 iso_pu_bacteria 2939679117 2939679626 143
146 iso_pu_bacteria 2939702853 2939704704 143
147 iso_pu_bacteria 2945991243 2945997421 143
148 iso_pu_bacteria 2946053406 2946053632 143
149 iso_pu_bacteria 2947426588 2947431067 143
150 iso_pu_bacteria 2965761152 2965765560 143
151 iso_pu_bacteria 2968558590 2968564118 143
152 iso_pu_bacteria 2971403814 2971407312 143
153 iso_pu_bacteria 2971410472 2971417350 143
154 iso_pu_bacteria 2971511577 2971512671 143
155 iso_pu_bacteria 2979083700 2979087971 143
156 iso_pu_bacteria 2980125574 2980125871 143
157 iso_pu_bacteria 2980176882 2980177618 143
158 iso_pu_bacteria 2980182181 2980184367 143
159 iso_pu_bacteria 2981284811 2981287821 143
160 iso_pu_bacteria 2981289755 2981292467 143
161 iso_pu_bacteria 2981980479 2981983440 143
162 iso_pu_bacteria 2981985349 2981988523 143
163 iso_pu_bacteria 2984527788 2984530389 143
164 iso_pu_bacteria 2988225383 2988228903 143
165 iso_pu_bacteria 2990275345 2990277414 143
166 iso_pu_bacteria 2996632988 2996636047 143
167 iso_pu_bacteria 3006978542 3006981883 143
168 iso_pu_bacteria 648028048 648171106 143
169 iso_pu_bacteria 8002317523 8002323520 143
170 iso_pu_bacteria 8022621104 8022624212 143
171 iso_pu_bacteria 8022792930 8022796906 143
172 iso_pu_bacteria 8023438354 8023443129 143
173 iso_pu_bacteria 8023444577 8023445177 143
174 iso_pu_bacteria 8046991243 8046997534 143
175 iso_pu_bacteria 8054465665 8054470273 143
176 iso_pu_bacteria 8054795415 8054804773 143
177 iso_pu_bacteria 8055632911 8055635197 143
178 iso_pu_bacteria 8056533031 8056540056 143
179 iso_pu_bacteria 8057473075 8057477140 143
180 iso_pu_bacteria 8057582654 8057586742 143
181 iso_pu_bacteria 8057632132 8057635484 143
182 iso_pu_bacteria 8057733483 8057737562 143
183 iso_pu_bacteria 8057977335 8057979174 143
184 iso_pu_bacteria 2511231119 2511700330 144
185 iso_pu_bacteria 2540341094 2540607474 144
186 iso_pu_bacteria 2545555800 2545557013 144
187 iso_pu_bacteria 2554235283 2555467721 144
188 iso_pu_bacteria 2576861599 2578931269 144
189 iso_pu_bacteria 2630968484 2631985381 144
190 iso_pu_bacteria 2643221735 2644740886 144
191 iso_pu_bacteria 2648501850 2651531791 144
192 iso_pu_bacteria 2671180844 2674418857 144
193 iso_pu_bacteria 2684623153 2686997543 144
194 iso_pu_bacteria 2687453109 2687498851 144
195 iso_pu_bacteria 2695420354 2695628309 144
196 iso_pu_bacteria 2716884898 2717915989 144
197 iso_pu_bacteria 2738541295 2738813917 144
198 iso_pu_bacteria 2738543010 2739230103 144
199 iso_pu_bacteria 2808606364 2808869494 144
200 iso_pu_bacteria 2808606399 2809055839 144
201 iso_pu_bacteria 2811994870 2812316738 144
202 iso_pu_bacteria 2816332295 2817480829 144
203 iso_pu_bacteria 2818991468 2819723798 144
204 iso_pu_bacteria 2823526263 2823528720 144
205 iso_pu_bacteria 2857604169 2857606319 144
206 iso_pu_bacteria 2857609550 2857610755 144
207 iso_pu_bacteria 2860837431 2860840168 144
208 iso_pu_bacteria 2877768649 2877771215 144
209 iso_pu_bacteria 2880169592 2880172079 144
210 iso_pu_bacteria 2881644220 2881644434 144
211 iso_pu_bacteria 2897109615 2897112292 144
212 iso_pu_bacteria 2904560550 2904562169 144
213 iso_pu_bacteria 2908665501 2908668078 144
214 iso_pu_bacteria 2919093281 2919095845 144
215 iso_pu_bacteria 2919414237 2919417148 144
216 iso_pu_bacteria 2919726948 2919728434 144
217 iso_pu_bacteria 2936361878 2936367417 144
218 iso_pu_bacteria 2954773129 2954773760 144
219 iso_pu_bacteria 2956897341 2956902099 144
220 iso_pu_bacteria 2962290636 2962293446 144
221 iso_pu_bacteria 2969136845 2969139454 144
222 iso_pu_bacteria 2969141011 2969143662 144
223 iso_pu_bacteria 2969765954 2969767423 144
224 iso_pu_bacteria 2969770375 2969773264 144
225 iso_pu_bacteria 2971893375 2971895861 144
226 iso_pu_bacteria 2980492589 2980495209 144
227 iso_pu_bacteria 3001267043 3001268437 144
228 iso_pu_bacteria 3001272096 3001273910 144
229 iso_pu_bacteria 3001892409 3001897740 144
230 iso_pu_bacteria 3006858327 3006861188 144
231 iso_pu_bacteria 3006879489 3006881673 144
232 iso_pu_bacteria 3006973921 3006975977 144
233 iso_pu_bacteria 3006988479 3006988924 144
234 iso_pu_bacteria 8022630665 8022631956 144
235 iso_pu_bacteria 8022653035 8022654335 144
236 iso_pu_bacteria 8051952484 8051955212 144
237 iso_pu_bacteria 8052174270 8052176138 144
238 iso_pu_bacteria 8054280661 8054281143 144
239 iso_pu_bacteria 2593339131 2595089496 145
240 iso_pu_bacteria 2738543017 2739270432 145
241 iso_pu_bacteria 2757320391 2757567925 145
242 iso_pu_bacteria 2775507177 2777761066 145
243 iso_pu_bacteria 2775507192 2777839316 145
244 iso_pu_bacteria 2857586860 2857590628 145
245 iso_pu_bacteria 2936340661 2936341201 145
246 iso_pu_bacteria 2964375228 2964378233 145
247 3300025224 Ga0209784_101957 Ga0209784_1019572 146
248 3300003574 Ga0007410J51695_1008935 Ga0007410J51695_10089352 147
249 3300003575 Ga0007409J51694_1004769 Ga0007409J51694_10047692 147
250 3300003784 Ga0055534_1024461 Ga0055534_10244612 147
251 3300003841 Ga0055541_1006413 Ga0055541_10064131 147
252 3300025225 Ga0209566_100741 Ga0209566_1007411 147
253 3300025284 Ga0209130_1030571 Ga0209130_10305712 147
254 3300025291 Ga0209675_1016293 Ga0209675_10162932 147
255 3300025294 Ga0209025_1004879 Ga0209025_10048793 147
256 3300041406 Ga0439439_0096749 Ga0439439_0096749_12_455 147
257 3300041999 Ga0439433_0017121 Ga0439433_0017121_684_1127 147
258 3300042007 Ga0439449_0008656 Ga0439449_0008656_601_1044 147
259 3300045976 Ga0466967_0235166 Ga0466967_0235166_979_1422 147
260 3300046455 Ga0495603_0238274 Ga0495603_0238274_388_831 147
261 3300046458 Ga0495591_034000 Ga0495591_034000_486_929 147
262 3300046491 Ga0495584_0030614 Ga0495584_0030614_128_571 147
263 3300046665 Ga0495661_0070809 Ga0495661_0070809_718_1161 147
264 3300046694 Ga0495649_0326392 Ga0495649_0326392_156_599 147
265 3300046810 Ga0495660_0015905 Ga0495660_0015905_1404_1847 147
266 3300047318 Ga0495636_0065283 Ga0495636_0065283_571_1014 147
267 3300048091 Ga0495626_0040898 Ga0495626_0040898_58_501 147
268 3300048907 Ga0496104_0343900 Ga0496104_0343900_259_702 147
269 3300048912 Ga0496109_0031640 Ga0496109_0031640_773_1216 147
270 3300048914 Ga0496111_0003693 Ga0496111_0003693_5270_5713 147
271 3300048916 Ga0496113_1458315 Ga0496113_1458315_16_459 147
272 3300048919 Ga0496116_0068737 Ga0496116_0068737_1311_1754 147
273 3300048919 Ga0496116_0368749 Ga0496116_0368749_74_517 147
274 3300048924 Ga0496121_0133772 Ga0496121_0133772_474_917 147
275 3300048925 Ga0496122_0035375 Ga0496122_0035375_3346_3789 147
276 3300049127 Ga0501306_002186 Ga0501306_002186_1501_1944 147
277 3300049127 Ga0501306_044404 Ga0501306_044404_235_678 147
278 3300049128 Ga0501308_000570 Ga0501308_000570_848_1291 147
279 3300049129 Ga0501309_003606 Ga0501309_003606_18_461 147
280 3300049129 Ga0501309_042055 Ga0501309_042055_238_681 147
281 3300049130 Ga0501310_004123 Ga0501310_004123_312_755 147
282 3300049131 Ga0501341_10978 Ga0501341_10978_127_570 147
283 3300049160 Ga0501304_008521 Ga0501304_008521_410_853 147
284 3300049161 Ga0501305_003237 Ga0501305_003237_369_812 147
285 3300049161 Ga0501305_047795 Ga0501305_047795_30_473 147
286 3300049161 Ga0501305_063981 Ga0501305_063981_182_625 147
287 3300049162 Ga0501307_003760 Ga0501307_003760_384_827 147
288 3300049162 Ga0501307_035222 Ga0501307_035222_36_479 147
289 3300049162 Ga0501307_038731 Ga0501307_038731_13_456 147
290 3300049527 Ga0501311_022743 Ga0501311_022743_317_760 147
291 3300049527 Ga0501311_036286 Ga0501311_036286_20_463 147
292 3300049528 Ga0501312_004059 Ga0501312_004059_314_757 147
293 3300049528 Ga0501312_031901 Ga0501312_031901_353_796 147
294 3300049529 Ga0501313_006736 Ga0501313_006736_158_601 147
295 3300049529 Ga0501313_028993 Ga0501313_028993_238_681 147
296 3300049530 Ga0501314_019257 Ga0501314_019257_238_681 147
297 3300049531 Ga0501315_028360 Ga0501315_028360_40_483 147
298 3300049531 Ga0501315_032234 Ga0501315_032234_238_681 147
299 3300049531 Ga0501315_088014 Ga0501315_088014_64_507 147
300 3300049532 Ga0501316_000467 Ga0501316_000467_1171_1614 147
301 3300049532 Ga0501316_020338 Ga0501316_020338_36_479 147
302 3300049532 Ga0501316_064142 Ga0501316_064142_76_519 147
303 3300049533 Ga0501317_032067 Ga0501317_032067_13_456 147
304 3300049533 Ga0501317_052024 Ga0501317_052024_189_632 147
305 3300049533 Ga0501317_095026 Ga0501317_095026_69_512 147
306 3300049534 Ga0501318_032239 Ga0501318_032239_36_479 147
307 3300049535 Ga0501319_012872 Ga0501319_012872_232_675 147
308 3300049536 Ga0501320_011311 Ga0501320_011311_14_457 147
309 3300049536 Ga0501320_026723 Ga0501320_026723_236_679 147
310 3300049537 Ga0501321_030906 Ga0501321_030906_238_681 147
311 3300049538 Ga0501322_010061 Ga0501322_010061_262_705 147
312 3300049539 Ga0501323_035618 Ga0501323_035618_238_681 147
313 3300049539 Ga0501323_039409 Ga0501323_039409_221_664 147
314 3300049539 Ga0501323_065853 Ga0501323_065853_111_554 147
315 3300049539 Ga0501323_088256 Ga0501323_088256_15_458 147
316 3300049540 Ga0501324_012302 Ga0501324_012302_35_478 147
317 3300049540 Ga0501324_012960 Ga0501324_012960_115_558 147
318 3300049542 Ga0501326_08336 Ga0501326_08336_127_570 147
319 3300049543 Ga0501327_04135 Ga0501327_04135_230_673 147
320 3300049544 Ga0501328_04266 Ga0501328_04266_227_670 147
321 3300049546 Ga0501330_005889 Ga0501330_005889_322_765 147
322 3300049547 Ga0501331_06176 Ga0501331_06176_233_676 147
323 3300049548 Ga0501332_04693 Ga0501332_04693_148_591 147
324 3300049552 Ga0501336_016143 Ga0501336_016143_170_613 147
325 3300049553 Ga0501337_004952 Ga0501337_004952_214_657 147
326 3300049554 Ga0501338_03853 Ga0501338_03853_232_675 147
327 3300049652 Ga0501202_125039 Ga0501202_125039_21_464 147
328 3300059605 Ga0587106_035976 Ga0587106_035976_13_456 147
329 3300059640 Ga0587067_063312 Ga0587067_063312_13_456 147
330 3300059640 Ga0587067_103954 Ga0587067_103954_15_458 147
331 3300059643 Ga0587072_056390 Ga0587072_056390_225_668 147
332 3300059643 Ga0587072_085249 Ga0587072_085249_13_456 147
333 3300059647 Ga0587079_009797 Ga0587079_009797_384_827 147
334 3300049127 Ga0501306_013462 Ga0501306_013462_610_1056 148
335 3300049528 Ga0501312_078057 Ga0501312_078057_101_547 148
336 3300049529 Ga0501313_051342 Ga0501313_051342_107_553 148
337 3300049532 Ga0501316_007584 Ga0501316_007584_13_459 148
338 3300049533 Ga0501317_033296 Ga0501317_033296_85_531 148
339 3300049537 Ga0501321_018389 Ga0501321_018389_76_522 148
340 3300049553 Ga0501337_008440 Ga0501337_008440_160_606 148
341 3300003187 JGI25151J46595_10014944 JGI25151J46595_100149443 149
342 3300003758 Ga0055532_1000046 Ga0055532_100004615 149
343 3300003781 Ga0055536_1021119 Ga0055536_10211191 149
344 3300025229 Ga0209147_100014 Ga0209147_10001476 149
345 3300025284 Ga0209130_1028034 Ga0209130_10280342 149
346 3300025294 Ga0209025_1005789 Ga0209025_100578910 149
347 3300037466 Ga0395898_1393181 Ga0395898_1393181_57_506 149
348 3300048905 Ga0496102_0021870 Ga0496102_0021870_654_1103 149
349 3300048906 Ga0496103_0157521 Ga0496103_0157521_858_1307 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09424

YqeY

Yqey-like protein

4

148

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yzm-assembly1.cif.gz_A structure of rabenosyn (458-503), rab4 binding domain 0.994 53 90
2vxx-assembly1.cif.gz_B x-ray structure of dpsa from thermosynechococcus elongatus 0.9416 50 91
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.8853 1 149
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.8798 1 149
3v1b-assembly1.cif.gz_B crystal structure of de novo designed mid1-apo2 0.8625 53 91
ID Description Score Start End Superfamily
1ng6A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9812 93 149 1.10.10.410
1ng6A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9646 93 149 1.10.10.410
af_I6X831_2_93_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.959 3 92 1.10.1510.10
1ng6A01 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9581 1 92 1.10.1510.10
1ng6A01 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.948 1 92 1.10.1510.10
ID Description Score Start End GO Terms
AF-A0A1I2KSE1-F1-model_v4 GatB/YqeY domain-containing protein 0.9776 1 149 GO:0016884
AF-A0A7C1D0W7-F1-model_v4 GatB/YqeY domain-containing protein 0.9746 1 149 GO:0016884
AF-A0A0S8J303-F1-model_v4 Glutamyl-tRNA amidotransferase 0.9731 1 146 GO:0016884
AF-A0A1I2KSE1-F1-model_v4 GatB/YqeY domain-containing protein 0.9712 1 149 GO:0016884
AF-A0A7X9BYF8-F1-model_v4 GatB/YqeY domain-containing protein 0.9703 49 148 GO:0016884

Feature Viewer

pLDDT pTM Quality
95.51 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map