F417784

General Info

Members Datasets Scaffolds Average Seq Length
349 225 698 316

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100081738|Ga0070683_1000817383
Length 327
Sequence VIEAEPRPQRPDAAPRAADATPPPAQNRREWAIDVHGLTKRYGGRAVVDDLAIRVGRGLIFGFLGPNGSGKTTTIRMLCGLLTPDAGEGTCLGHDLRREAAAIKREVGYMTQRFSLYEDLSIEENLDFVARMYGVAGRRRAIDDTLARLLSGGWKQRLALAACMLHEPQLLLLDEPTAGVDPKARRDFWEEIHALAADGITVLVSTHYMDEAERCHRLAYINLGKLLVEGTPDEVIAHSGLHTSLVALGAGGDERALARLARELRDAPGVDTVIPFGLTLRVSGRDAAALGAALAPLRALPQFAVEPTATSLEDVFVNLMQQAAPNA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
134 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
138 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
139 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
158 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
220 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
221 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
222 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
223 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 2547132512 Azospira oryzae 6a3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.29
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.01
Nodule 0
Rhizoplane 4.87
Rhizosphere 91.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100081738 3300005329 Bacteria 3025
2 JGI24743J22301_10000574 3300001991 Bacteria 4414
3 JGI24749J21850_1003682 3300002076 Bacteria 2142
4 JGI25153J46596_10000652 3300003215 Bacteria 21214
5 JGI25404J52841_10003229 3300003659 Bacteria 3196
6 Ga0070676_10015111 3300005328 Bacteria 4255
7 Ga0070690_100010796 3300005330 Bacteria 5327
8 Ga0070677_10001674 3300005333 Bacteria 7002
9 Ga0068869_100009925 3300005334 Bacteria 6188
10 Ga0068869_100177146 3300005334 Bacteria 1670
11 Ga0070666_10039914 3300005335 Bacteria 3130
12 Ga0070682_100065908 3300005337 Bacteria 2303
13 Ga0068868_100004954 3300005338 Bacteria 9353
14 Ga0070660_100051033 3300005339 Bacteria 3184
15 Ga0070660_100118807 3300005339 Bacteria 2108
16 Ga0070687_100002215 3300005343 Bacteria 7205
17 Ga0070661_100009229 3300005344 Bacteria 6818
18 Ga0070661_100314478 3300005344 Bacteria 1222
19 Ga0070675_100301246 3300005354 Bacteria 1412
20 Ga0070671_100181799 3300005355 Bacteria 1780
21 Ga0070674_100009866 3300005356 Bacteria 5744
22 Ga0070688_100029027 3300005365 Bacteria 3308
23 Ga0070659_100007319 3300005366 Bacteria 8018
24 Ga0070659_100017386 3300005366 Bacteria 5410
25 Ga0070659_100215740 3300005366 Bacteria 1583
26 Ga0070659_100226966 3300005366 Bacteria 1542
27 Ga0070667_100004107 3300005367 Bacteria 12327
28 Ga0070663_100021627 3300005455 Bacteria 4282
29 Ga0070663_100026652 3300005455 Bacteria 3917
30 Ga0070678_100505414 3300005456 Bacteria 1067
31 Ga0070662_100173021 3300005457 Bacteria 1697
32 Ga0068867_100029850 3300005459 Bacteria 3930
33 Ga0070685_10006983 3300005466 Bacteria 5761
34 Ga0070684_100009762 3300005535 Bacteria 7578
35 Ga0070684_100021250 3300005535 Bacteria 5396
36 Ga0070684_100398004 3300005535 Bacteria 1269
37 Ga0068853_100022278 3300005539 Bacteria 5290
38 Ga0068853_100201238 3300005539 Bacteria 1813
39 Ga0070665_100185904 3300005548 Bacteria 2078
40 Ga0070665_100188236 3300005548 Bacteria 2065
41 Ga0070665_100304650 3300005548 Bacteria 1596
42 Ga0068855_100073164 3300005563 Bacteria 3982
43 Ga0068855_100099744 3300005563 Bacteria 3344
44 Ga0070664_100008304 3300005564 Bacteria 8400
45 Ga0068857_100120200 3300005577 Bacteria 2365
46 Ga0068854_100006046 3300005578 Bacteria 7671
47 Ga0068856_100118527 3300005614 Bacteria 2648
48 Ga0068856_100364593 3300005614 Bacteria 1463
49 Ga0070702_100032924 3300005615 Bacteria 2847
50 Ga0068859_100013262 3300005617 Bacteria 8269
51 Ga0068864_100068186 3300005618 Bacteria 3090
52 Ga0068864_100499010 3300005618 Bacteria 1170
53 Ga0068861_100056080 3300005719 Bacteria 3006
54 Ga0068851_10011385 3300005834 Bacteria 4170
55 Ga0068851_10037623 3300005834 Bacteria 2426
56 Ga0068870_10174864 3300005840 Bacteria 1284
57 Ga0068863_100176041 3300005841 Bacteria 2053
58 Ga0068858_100003991 3300005842 Bacteria 14556
59 Ga0068858_100023871 3300005842 Bacteria 5698
60 Ga0068858_100044467 3300005842 Bacteria 4116
61 Ga0068858_100122125 3300005842 Bacteria 2436
62 Ga0068860_100031184 3300005843 Bacteria 5125
63 Ga0081455_10002468 3300005937 Bacteria 21998
64 Ga0081540_1000119 3300005983 Bacteria 84020
65 Ga0097621_100011877 3300006237 Bacteria 6439
66 Ga0097621_100064664 3300006237 Bacteria 3009
67 Ga0068871_100037073 3300006358 Bacteria 3886
68 Ga0068871_100063908 3300006358 Bacteria 3011
69 Ga0068871_100101861 3300006358 Bacteria 2406
70 Ga0068871_100224280 3300006358 Bacteria 1629
71 Ga0075430_100072748 3300006846 Bacteria 2883
72 Ga0075434_100032916 3300006871 Bacteria 5113
73 Ga0068865_100004386 3300006881 Bacteria 8502
74 Ga0068865_100028783 3300006881 Bacteria 3680
75 Ga0097620_100013262 3300006931 Bacteria 8269
76 Ga0075435_100077674 3300007076 Bacteria 2722
77 Ga0105240_10124901 3300009093 Bacteria 3094
78 Ga0105240_10132013 3300009093 Bacteria 2995
79 Ga0105240_10136098 3300009093 Bacteria 2942
80 Ga0105240_10145307 3300009093 Bacteria 2831
81 Ga0105240_10310712 3300009093 Bacteria 1800
82 Ga0111539_10029999 3300009094 Bacteria 6616
83 Ga0105245_10460136 3300009098 Bacteria 1282
84 Ga0105241_10001737 3300009174 Bacteria 16532
85 Ga0105241_10059887 3300009174 Bacteria 2929
86 Ga0105241_10423941 3300009174 Bacteria 1171
87 Ga0105242_10044767 3300009176 Bacteria 3585
88 Ga0105248_10002703 3300009177 Bacteria 19702
89 Ga0105237_10035214 3300009545 Bacteria 5067
90 Ga0105237_10114794 3300009545 Bacteria 2686
91 Ga0105238_10064925 3300009551 Bacteria 3651
92 Ga0105249_10041157 3300009553 Bacteria 4199
93 Ga0105239_10016575 3300010375 Bacteria 8145
94 Ga0105239_10113165 3300010375 Bacteria 3009
95 Ga0105246_10063560 3300011119 Bacteria 2575
96 Ga0105246_10200026 3300011119 Bacteria 1553
97 Ga0157373_10006082 3300013100 Bacteria 9025
98 Ga0157371_10010980 3300013102 Bacteria 7018
99 Ga0157370_10017509 3300013104 Bacteria 7230
100 Ga0157370_10173549 3300013104 Bacteria 2004
101 Ga0157369_10283466 3300013105 Bacteria 1725
102 Ga0157369_10321754 3300013105 Bacteria 1608
103 Ga0157374_10012426 3300013296 Bacteria 7407
104 Ga0157374_10024302 3300013296 Bacteria 5432
105 Ga0157374_10046827 3300013296 Bacteria 4006
106 Ga0163162_10039639 3300013306 Bacteria 4708
107 Ga0163162_10134667 3300013306 Bacteria 2581
108 Ga0157372_10025142 3300013307 Bacteria 6471
109 Ga0157375_10014975 3300013308 Bacteria 6934
110 Ga0157375_10295101 3300013308 Bacteria 1784
111 Ga0163163_10000002 3300014325 Bacteria 609846
112 Ga0163163_10006602 3300014325 Bacteria 10162
113 Ga0163163_10009901 3300014325 Bacteria 8544
114 Ga0163163_10182872 3300014325 Bacteria 2144
115 Ga0157380_10001795 3300014326 Bacteria 14166
116 Ga0157377_10008719 3300014745 Bacteria 4956
117 Ga0157379_10001093 3300014968 Bacteria 22136
118 Ga0157379_10005241 3300014968 Bacteria 11138
119 Ga0157379_10024664 3300014968 Bacteria 5338
120 Ga0157379_10302323 3300014968 Bacteria 1458
121 Ga0157376_10036398 3300014969 Bacteria 3987
122 Ga0157376_10038514 3300014969 Bacteria 3890
123 Ga0157376_10396041 3300014969 Bacteria 1334
124 Ga0163161_10051506 3300017792 Bacteria 2982
125 Ga0206356_10689694 3300020070 Bacteria 1457
126 Ga0213876_10003596 3300021384 Bacteria 8819
127 Ga0207666_1003684 3300025271 Bacteria 1891
128 Ga0207673_1002232 3300025290 Bacteria 2188
129 Ga0209758_1000008 3300025297 Bacteria 1215263
130 Ga0207697_10000102 3300025315 Bacteria 38762
131 Ga0207656_10008202 3300025321 Bacteria 3833
132 Ga0207656_10023675 3300025321 Bacteria 2475
133 Ga0207682_10001321 3300025893 Bacteria 11400
134 Ga0207692_10048574 3300025898 Bacteria 2137
135 Ga0207688_10002802 3300025901 Bacteria 9466
136 Ga0207680_10016253 3300025903 Bacteria 3902
137 Ga0207647_10003834 3300025904 Bacteria 11247
138 Ga0207645_10001496 3300025907 Bacteria 19113
139 Ga0207643_10000470 3300025908 Bacteria 26123
140 Ga0207643_10042537 3300025908 Bacteria 2562
141 Ga0207654_10057722 3300025911 Bacteria 2257
142 Ga0207707_10011742 3300025912 Bacteria 7622
143 Ga0207695_10023424 3300025913 Bacteria 6976
144 Ga0207695_10045367 3300025913 Bacteria 4666
145 Ga0207695_10098610 3300025913 Bacteria 2921
146 Ga0207695_10130493 3300025913 Bacteria 2471
147 Ga0207695_10157571 3300025913 Bacteria 2204
148 Ga0207695_10167214 3300025913 Bacteria 2126
149 Ga0207660_10005461 3300025917 Bacteria 8253
150 Ga0207657_10000258 3300025919 Bacteria 56256
151 Ga0207657_10207508 3300025919 Bacteria 1573
152 Ga0207649_10203140 3300025920 Bacteria 1401
153 Ga0207649_10204793 3300025920 Bacteria 1396
154 Ga0207652_10020996 3300025921 Bacteria 5386
155 Ga0207681_10181216 3300025923 Bacteria 1604
156 Ga0207694_10039340 3300025924 Bacteria 3639
157 Ga0207694_10040005 3300025924 Bacteria 3609
158 Ga0207650_10004777 3300025925 Bacteria 9256
159 Ga0207659_10035817 3300025926 Bacteria 3433
160 Ga0207664_10028711 3300025929 Bacteria 4230
161 Ga0207706_10004796 3300025933 Bacteria 12667
162 Ga0207686_10027534 3300025934 Bacteria 3330
163 Ga0207670_10009515 3300025936 Bacteria 5549
164 Ga0207669_10005353 3300025937 Bacteria 5749
165 Ga0207704_10023588 3300025938 Bacteria 3319
166 Ga0207704_10081384 3300025938 Bacteria 2094
167 Ga0207691_10000461 3300025940 Bacteria 40281
168 Ga0207711_10034281 3300025941 Bacteria 4300
169 Ga0207711_10041135 3300025941 Bacteria 3935
170 Ga0207689_10000356 3300025942 Bacteria 42960
171 Ga0207661_10245918 3300025944 Bacteria 1588
172 Ga0207679_10068505 3300025945 Bacteria 2666
173 Ga0207679_10365475 3300025945 Bacteria 1261
174 Ga0207667_10079684 3300025949 Bacteria 3394
175 Ga0207667_10150385 3300025949 Bacteria 2396
176 Ga0207667_10404897 3300025949 Bacteria 1389
177 Ga0207651_10020919 3300025960 Bacteria 3961
178 Ga0207640_10028791 3300025981 Bacteria 3401
179 Ga0207640_10174286 3300025981 Bacteria 1606
180 Ga0207658_10030771 3300025986 Bacteria 3804
181 Ga0207703_10025119 3300026035 Bacteria 4686
182 Ga0207703_10051377 3300026035 Bacteria 3340
183 Ga0207639_10030068 3300026041 Bacteria 3981
184 Ga0207678_10000424 3300026067 Bacteria 38334
185 Ga0207678_10005824 3300026067 Bacteria 10982
186 Ga0207708_10001390 3300026075 Bacteria 18199
187 Ga0207702_10130804 3300026078 Bacteria 2258
188 Ga0207702_10505128 3300026078 Bacteria 1179
189 Ga0207641_10070394 3300026088 Bacteria 3005
190 Ga0207648_10000608 3300026089 Bacteria 40199
191 Ga0207676_10015368 3300026095 Bacteria 5519
192 Ga0207676_10220919 3300026095 Bacteria 1687
193 Ga0207674_10002874 3300026116 Bacteria 21399
194 Ga0207674_10007315 3300026116 Bacteria 12863
195 Ga0207674_10102347 3300026116 Bacteria 2844
196 Ga0207675_100004345 3300026118 Bacteria 13695
197 Ga0207675_100151501 3300026118 Bacteria 2207
198 Ga0207675_100311596 3300026118 Bacteria 1535
199 Ga0207683_10006740 3300026121 Bacteria 9829
200 Ga0207683_10337438 3300026121 Bacteria 1382
201 Ga0207698_10060390 3300026142 Bacteria 2948
202 Ga0268266_10010455 3300028379 Bacteria 8110
203 Ga0268266_10016285 3300028379 Bacteria 6355
204 Ga0268266_10086418 3300028379 Bacteria 2742
205 Ga0268266_10091790 3300028379 Bacteria 2663
206 Ga0268266_10407908 3300028379 Bacteria 1286
207 Ga0268265_10251888 3300028380 Bacteria 1564
208 Ga0268264_10201426 3300028381 Bacteria 1821
209 Ga0265323_10034116 3300028653 Bacteria 1881
210 Ga0265336_10019409 3300028666 Bacteria 2193
211 Ga0307515_10089570 3300028794 Bacteria 3872
212 Ga0265338_10000050 3300028800 Bacteria 213659
213 Ga0265338_10025721 3300028800 Bacteria 5963
214 Ga0265338_10126377 3300028800 Bacteria 2028
215 Ga0265338_10260448 3300028800 Bacteria 1275
216 Ga0265324_10000881 3300029957 Bacteria 19167
217 Ga0265324_10007073 3300029957 Bacteria 4599
218 Ga0265332_10000021 3300031238 Bacteria 217090
219 Ga0265328_10000009 3300031239 Bacteria 179784
220 Ga0265320_10000027 3300031240 Bacteria 163439
221 Ga0265325_10005533 3300031241 Bacteria 7795
222 Ga0265340_10098647 3300031247 Bacteria 1359
223 Ga0265339_10108655 3300031249 Bacteria 1437
224 Ga0265339_10183005 3300031249 Bacteria 1042
225 Ga0265327_10004823 3300031251 Bacteria 11690
226 Ga0265327_10011257 3300031251 Bacteria 6185
227 Ga0265327_10015971 3300031251 Bacteria 4805
228 Ga0265316_10111136 3300031344 Bacteria 2075
229 Ga0307513_10002833 3300031456 Bacteria 23769
230 Ga0307509_10000513 3300031507 Bacteria 66105
231 Ga0307408_100031315 3300031548 Bacteria 3703
232 Ga0265313_10015186 3300031595 Bacteria 4502
233 Ga0307406_10016427 3300031901 Bacteria 4300
234 Ga0307407_10005029 3300031903 Bacteria 5693
235 Ga0307412_10021620 3300031911 Bacteria 3933
236 Ga0307409_100006020 3300031995 Bacteria 7073
237 Ga0307416_100013883 3300032002 Bacteria 5492
238 Ga0307414_10169815 3300032004 Bacteria 1742
239 Ga0307411_10000645 3300032005 Bacteria 12655
240 Ga0373930_0002490 3300034816 Bacteria 2851
241 Ga0373938_0004481 3300034957 Bacteria 2337
242 Ga0373944_0000106 3300035089 Bacteria 15258
243 Ga0373949_0003475 3300035090 Bacteria 3739
244 Ga0373932_0000001 3300035112 Bacteria 1459067
245 Ga0373962_0000177 3300035242 Bacteria 13601
246 Ga0373931_0000008 3300035691 Bacteria 362269
247 Ga0373935_0009272 3300035692 Bacteria 5891
248 Ga0373927_0014581 3300035695 Bacteria 5199
249 Ga0373927_0122080 3300035695 Bacteria 1700
250 Ga0373933_0135797 3300035724 Bacteria 1550
251 Ga0373925_0000513 3300037068 Bacteria 39022
252 Ga0373925_0006186 3300037068 Bacteria 8841
253 Ga0373925_0300360 3300037068 Bacteria 1296
254 Ga0395900_0145450 3300037418 Bacteria 2424
255 Ga0395905_0079090 3300037471 Bacteria 3082
256 Ga0395905_0337459 3300037471 Bacteria 1398
257 Ga0395901_0004345 3300038443 Bacteria 14294
258 Ga0395901_0146870 3300038443 Bacteria 2478
259 Ga0436365_1367603 3300039437 Bacteria 10991
260 Ga0436360_0139528 3300039438 Bacteria 1627
261 Ga0436361_0459486 3300039447 Bacteria 1840
262 Ga0451577_0009366 3300042876 Bacteria 9440
263 Ga0453684_0000866 3300044712 Bacteria 101700
264 Ga0453684_0013201 3300044712 Bacteria 13468
265 Ga0451576_0321924 3300045051 Bacteria 1618
266 Ga0451576_0641912 3300045051 Bacteria 1115
267 Ga0495650_0115048 3300046471 Bacteria 995
268 Ga0495580_0006791 3300046472 Bacteria 9278
269 Ga0495628_0000041 3300046516 Bacteria 102320
270 Ga0495630_0093399 3300046517 Bacteria 2274
271 Ga0495621_0009535 3300046539 Bacteria 2951
272 Ga0495675_0028703 3300047444 Bacteria 3546
273 Ga0496100_0012224 3300048903 Bacteria 4915
274 Ga0496101_0082287 3300048904 Bacteria 2382
275 Ga0496102_0044197 3300048905 Bacteria 4042
276 Ga0496104_0016885 3300048907 Bacteria 6638
277 Ga0496104_0027772 3300048907 Bacteria 5238
278 Ga0496105_0013371 3300048908 Bacteria 6514
279 Ga0496105_0021837 3300048908 Bacteria 5181
280 Ga0496107_0016006 3300048910 Bacteria 5262
281 Ga0496107_0437613 3300048910 Bacteria 972
282 Ga0496108_0006058 3300048911 Bacteria 9781
283 Ga0496109_0040049 3300048912 Bacteria 4243
284 Ga0496110_0003053 3300048913 Bacteria 12695
285 Ga0496110_0035040 3300048913 Bacteria 4352
286 Ga0496111_0240546 3300048914 Bacteria 1344
287 Ga0496113_0122827 3300048916 Bacteria 2032
288 Ga0496114_0035784 3300048917 Bacteria 4101
289 Ga0496115_0010276 3300048918 Bacteria 6987
290 Ga0496125_0106142 3300048928 Bacteria 2051
291 Ga0501031_0000310 3300049568 Bacteria 27898
292 Ga0501032_0000058 3300049569 Bacteria 98163
293 Ga0501032_0092669 3300049569 Bacteria 2004
294 Ga0501032_0168098 3300049569 Bacteria 1438
295 Ga0501033_0000001 3300049570 Bacteria 795921
296 Ga0501033_0004051 3300049570 Bacteria 11835
297 Ga0501033_0009454 3300049570 Bacteria 7506
298 Ga0501033_0010466 3300049570 Bacteria 7115
299 Ga0501033_0014301 3300049570 Bacteria 6031
300 Ga0501034_0002245 3300049571 Bacteria 23785
301 Ga0501034_0177779 3300049571 Bacteria 2094
302 Ga0501036_0017660 3300049572 Bacteria 5970
303 Ga0501036_0361830 3300049572 Bacteria 1211
304 Ga0501037_0078130 3300049573 Bacteria 2401
305 Ga0501037_0110512 3300049573 Bacteria 1980
306 Ga0501038_0064182 3300049574 Bacteria 3132
307 Ga0501038_0080535 3300049574 Bacteria 2745
308 Ga0501038_0354125 3300049574 Bacteria 1143
309 Ga0501043_0034332 3300049579 Bacteria 3989
310 Ga0501043_0041434 3300049579 Bacteria 3618
311 Ga0501043_0043705 3300049579 Bacteria 3522
312 Ga0501043_0089911 3300049579 Bacteria 2414
313 Ga0501046_0088954 3300049580 Bacteria 2378
314 Ga0501046_0166257 3300049580 Bacteria 1657
315 Ga0501047_0000665 3300049581 Bacteria 35776
316 Ga0501047_0003236 3300049581 Bacteria 15441
317 Ga0501047_0007081 3300049581 Bacteria 10534
318 Ga0501048_0188555 3300049582 Bacteria 1461
319 Ga0501073_0016158 3300049589 Bacteria 5409
320 Ga0501073_0329608 3300049589 Bacteria 1054
321 Ga0501080_0049532 3300049742 Bacteria 3910
322 Ga0501080_0095617 3300049742 Bacteria 2759
323 Ga0501083_0018884 3300049744 Bacteria 4800
324 Ga0501083_0073479 3300049744 Bacteria 2273
325 Ga0501035_0007024 3300049822 Bacteria 10521
326 Ga0501035_0013117 3300049822 Bacteria 7647
327 Ga0501035_0018929 3300049822 Bacteria 6343
328 Ga0501035_0082190 3300049822 Bacteria 2843
329 Ga0501035_0122743 3300049822 Bacteria 2269
330 Ga0501035_0226039 3300049822 Bacteria 1596
331 Ga0501044_0000014 3300049823 Bacteria 244619
332 Ga0501044_0000967 3300049823 Bacteria 34577
333 Ga0501044_0004273 3300049823 Bacteria 16025
334 Ga0501044_0029627 3300049823 Bacteria 5770
335 Ga0501044_0123294 3300049823 Bacteria 2590
336 nmdc:mga0qj67_67306_c1 3300050509 Bacteria 2853
337 nmdc:mga08y16_42793_c1 3300050511 Bacteria 4743
338 nmdc:mga0n895_21070_c1 3300050512 Bacteria 6092
339 nmdc:mga0n895_332110_c1 3300050512 Bacteria 1540
340 nmdc:mga0rr50_51705_c1 3300050513 Bacteria 3050
341 nmdc:mga08x19_252197_c1 3300050514 Bacteria 1218
342 nmdc:mga0a205_7389_c1 3300050515 Bacteria 9951
343 Ga0500595_000623 3300053119 Bacteria 21193
344 Ga0500607_021706 3300053121 Bacteria 3615
345 Ga0500573_0000002 3300053140 Bacteria 407088
346 Ga0500636_0001715 3300053177 Bacteria 11994
347 Ga0500625_074262 3300053729 Bacteria 1503
348 Ga0501084_0091421 3300054114 Bacteria 2555
349 2548847934 2547132512 Bacteria 3416496
350 Ga0070683_100081738
351 JGI24743J22301_10000574
352 JGI24749J21850_1003682
353 JGI25153J46596_10000652
354 JGI25404J52841_10003229
355 Ga0070676_10015111
356 Ga0070690_100010796
357 Ga0070677_10001674
358 Ga0068869_100009925
359 Ga0068869_100177146
360 Ga0070666_10039914
361 Ga0070682_100065908
362 Ga0068868_100004954
363 Ga0070660_100051033
364 Ga0070660_100118807
365 Ga0070687_100002215
366 Ga0070661_100009229
367 Ga0070661_100314478
368 Ga0070675_100301246
369 Ga0070671_100181799
370 Ga0070674_100009866
371 Ga0070688_100029027
372 Ga0070659_100007319
373 Ga0070659_100017386
374 Ga0070659_100215740
375 Ga0070659_100226966
376 Ga0070667_100004107
377 Ga0070663_100021627
378 Ga0070663_100026652
379 Ga0070678_100505414
380 Ga0070662_100173021
381 Ga0068867_100029850
382 Ga0070685_10006983
383 Ga0070684_100009762
384 Ga0070684_100021250
385 Ga0070684_100398004
386 Ga0068853_100022278
387 Ga0068853_100201238
388 Ga0070665_100185904
389 Ga0070665_100188236
390 Ga0070665_100304650
391 Ga0068855_100073164
392 Ga0068855_100099744
393 Ga0070664_100008304
394 Ga0068857_100120200
395 Ga0068854_100006046
396 Ga0068856_100118527
397 Ga0068856_100364593
398 Ga0070702_100032924
399 Ga0068859_100013262
400 Ga0068864_100068186
401 Ga0068864_100499010
402 Ga0068861_100056080
403 Ga0068851_10011385
404 Ga0068851_10037623
405 Ga0068870_10174864
406 Ga0068863_100176041
407 Ga0068858_100003991
408 Ga0068858_100023871
409 Ga0068858_100044467
410 Ga0068858_100122125
411 Ga0068860_100031184
412 Ga0081455_10002468
413 Ga0081540_1000119
414 Ga0097621_100011877
415 Ga0097621_100064664
416 Ga0068871_100037073
417 Ga0068871_100063908
418 Ga0068871_100101861
419 Ga0068871_100224280
420 Ga0075430_100072748
421 Ga0075434_100032916
422 Ga0068865_100004386
423 Ga0068865_100028783
424 Ga0097620_100013262
425 Ga0075435_100077674
426 Ga0105240_10124901
427 Ga0105240_10132013
428 Ga0105240_10136098
429 Ga0105240_10145307
430 Ga0105240_10310712
431 Ga0111539_10029999
432 Ga0105245_10460136
433 Ga0105241_10001737
434 Ga0105241_10059887
435 Ga0105241_10423941
436 Ga0105242_10044767
437 Ga0105248_10002703
438 Ga0105237_10035214
439 Ga0105237_10114794
440 Ga0105238_10064925
441 Ga0105249_10041157
442 Ga0105239_10016575
443 Ga0105239_10113165
444 Ga0105246_10063560
445 Ga0105246_10200026
446 Ga0157373_10006082
447 Ga0157371_10010980
448 Ga0157370_10017509
449 Ga0157370_10173549
450 Ga0157369_10283466
451 Ga0157369_10321754
452 Ga0157374_10012426
453 Ga0157374_10024302
454 Ga0157374_10046827
455 Ga0163162_10039639
456 Ga0163162_10134667
457 Ga0157372_10025142
458 Ga0157375_10014975
459 Ga0157375_10295101
460 Ga0163163_10000002
461 Ga0163163_10006602
462 Ga0163163_10009901
463 Ga0163163_10182872
464 Ga0157380_10001795
465 Ga0157377_10008719
466 Ga0157379_10001093
467 Ga0157379_10005241
468 Ga0157379_10024664
469 Ga0157379_10302323
470 Ga0157376_10036398
471 Ga0157376_10038514
472 Ga0157376_10396041
473 Ga0163161_10051506
474 Ga0206356_10689694
475 Ga0213876_10003596
476 Ga0207666_1003684
477 Ga0207673_1002232
478 Ga0209758_1000008
479 Ga0207697_10000102
480 Ga0207656_10008202
481 Ga0207656_10023675
482 Ga0207682_10001321
483 Ga0207692_10048574
484 Ga0207688_10002802
485 Ga0207680_10016253
486 Ga0207647_10003834
487 Ga0207645_10001496
488 Ga0207643_10000470
489 Ga0207643_10042537
490 Ga0207654_10057722
491 Ga0207707_10011742
492 Ga0207695_10023424
493 Ga0207695_10045367
494 Ga0207695_10098610
495 Ga0207695_10130493
496 Ga0207695_10157571
497 Ga0207695_10167214
498 Ga0207660_10005461
499 Ga0207657_10000258
500 Ga0207657_10207508
501 Ga0207649_10203140
502 Ga0207649_10204793
503 Ga0207652_10020996
504 Ga0207681_10181216
505 Ga0207694_10039340
506 Ga0207694_10040005
507 Ga0207650_10004777
508 Ga0207659_10035817
509 Ga0207664_10028711
510 Ga0207706_10004796
511 Ga0207686_10027534
512 Ga0207670_10009515
513 Ga0207669_10005353
514 Ga0207704_10023588
515 Ga0207704_10081384
516 Ga0207691_10000461
517 Ga0207711_10034281
518 Ga0207711_10041135
519 Ga0207689_10000356
520 Ga0207661_10245918
521 Ga0207679_10068505
522 Ga0207679_10365475
523 Ga0207667_10079684
524 Ga0207667_10150385
525 Ga0207667_10404897
526 Ga0207651_10020919
527 Ga0207640_10028791
528 Ga0207640_10174286
529 Ga0207658_10030771
530 Ga0207703_10025119
531 Ga0207703_10051377
532 Ga0207639_10030068
533 Ga0207678_10000424
534 Ga0207678_10005824
535 Ga0207708_10001390
536 Ga0207702_10130804
537 Ga0207702_10505128
538 Ga0207641_10070394
539 Ga0207648_10000608
540 Ga0207676_10015368
541 Ga0207676_10220919
542 Ga0207674_10002874
543 Ga0207674_10007315
544 Ga0207674_10102347
545 Ga0207675_100004345
546 Ga0207675_100151501
547 Ga0207675_100311596
548 Ga0207683_10006740
549 Ga0207683_10337438
550 Ga0207698_10060390
551 Ga0268266_10010455
552 Ga0268266_10016285
553 Ga0268266_10086418
554 Ga0268266_10091790
555 Ga0268266_10407908
556 Ga0268265_10251888
557 Ga0268264_10201426
558 Ga0265323_10034116
559 Ga0265336_10019409
560 Ga0307515_10089570
561 Ga0265338_10000050
562 Ga0265338_10025721
563 Ga0265338_10126377
564 Ga0265338_10260448
565 Ga0265324_10000881
566 Ga0265324_10007073
567 Ga0265332_10000021
568 Ga0265328_10000009
569 Ga0265320_10000027
570 Ga0265325_10005533
571 Ga0265340_10098647
572 Ga0265339_10108655
573 Ga0265339_10183005
574 Ga0265327_10004823
575 Ga0265327_10011257
576 Ga0265327_10015971
577 Ga0265316_10111136
578 Ga0307513_10002833
579 Ga0307509_10000513
580 Ga0307408_100031315
581 Ga0265313_10015186
582 Ga0307406_10016427
583 Ga0307407_10005029
584 Ga0307412_10021620
585 Ga0307409_100006020
586 Ga0307416_100013883
587 Ga0307414_10169815
588 Ga0307411_10000645
589 Ga0373930_0002490
590 Ga0373938_0004481
591 Ga0373944_0000106
592 Ga0373949_0003475
593 Ga0373932_0000001
594 Ga0373962_0000177
595 Ga0373931_0000008
596 Ga0373935_0009272
597 Ga0373927_0014581
598 Ga0373927_0122080
599 Ga0373933_0135797
600 Ga0373925_0000513
601 Ga0373925_0006186
602 Ga0373925_0300360
603 Ga0395900_0145450
604 Ga0395905_0079090
605 Ga0395905_0337459
606 Ga0395901_0004345
607 Ga0395901_0146870
608 Ga0436365_1367603
609 Ga0436360_0139528
610 Ga0436361_0459486
611 Ga0451577_0009366
612 Ga0453684_0000866
613 Ga0453684_0013201
614 Ga0451576_0321924
615 Ga0451576_0641912
616 Ga0495650_0115048
617 Ga0495580_0006791
618 Ga0495628_0000041
619 Ga0495630_0093399
620 Ga0495621_0009535
621 Ga0495675_0028703
622 Ga0496100_0012224
623 Ga0496101_0082287
624 Ga0496102_0044197
625 Ga0496104_0016885
626 Ga0496104_0027772
627 Ga0496105_0013371
628 Ga0496105_0021837
629 Ga0496107_0016006
630 Ga0496107_0437613
631 Ga0496108_0006058
632 Ga0496109_0040049
633 Ga0496110_0003053
634 Ga0496110_0035040
635 Ga0496111_0240546
636 Ga0496113_0122827
637 Ga0496114_0035784
638 Ga0496115_0010276
639 Ga0496125_0106142
640 Ga0501031_0000310
641 Ga0501032_0000058
642 Ga0501032_0092669
643 Ga0501032_0168098
644 Ga0501033_0000001
645 Ga0501033_0004051
646 Ga0501033_0009454
647 Ga0501033_0010466
648 Ga0501033_0014301
649 Ga0501034_0002245
650 Ga0501034_0177779
651 Ga0501036_0017660
652 Ga0501036_0361830
653 Ga0501037_0078130
654 Ga0501037_0110512
655 Ga0501038_0064182
656 Ga0501038_0080535
657 Ga0501038_0354125
658 Ga0501043_0034332
659 Ga0501043_0041434
660 Ga0501043_0043705
661 Ga0501043_0089911
662 Ga0501046_0088954
663 Ga0501046_0166257
664 Ga0501047_0000665
665 Ga0501047_0003236
666 Ga0501047_0007081
667 Ga0501048_0188555
668 Ga0501073_0016158
669 Ga0501073_0329608
670 Ga0501080_0049532
671 Ga0501080_0095617
672 Ga0501083_0018884
673 Ga0501083_0073479
674 Ga0501035_0007024
675 Ga0501035_0013117
676 Ga0501035_0018929
677 Ga0501035_0082190
678 Ga0501035_0122743
679 Ga0501035_0226039
680 Ga0501044_0000014
681 Ga0501044_0000967
682 Ga0501044_0004273
683 Ga0501044_0029627
684 Ga0501044_0123294
685 nmdc:mga0qj67_67306_c1
686 nmdc:mga08y16_42793_c1
687 nmdc:mga0n895_21070_c1
688 nmdc:mga0n895_332110_c1
689 nmdc:mga0rr50_51705_c1
690 nmdc:mga08x19_252197_c1
691 nmdc:mga0a205_7389_c1
692 Ga0500595_000623
693 Ga0500607_021706
694 Ga0500573_0000002
695 Ga0500636_0001715
696 Ga0500625_074262
697 Ga0501084_0091421
698 2548847934

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

48

178

0.95

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

95

209

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9418 25 237
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9369 26 244
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9271 24 237
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9243 25 236
5lj9-assembly3.cif.gz_C structure of the e. coli macb abc domain (c2221) 0.923 25 237
ID Description Score Start End Superfamily
1vplA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9369 26 244 3.40.50.300
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9329 26 237 3.40.50.300
af_Q8T664_36_360_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9272 25 237 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9268 20 245 3.40.50.300
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9243 25 236 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2G1UQ51-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.9418 24 242 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A2W7B2T3-F1-model_v4 Multidrug ABC transporter ATP-binding protein 0.9403 25 227 GO:0005524
GO:0016887
AF-A0A7C2SEV6-F1-model_v4 ABC transporter ATP-binding protein 0.9346 24 230 GO:0005524
GO:0016887
AF-A0A3N5FSY3-F1-model_v4 ABC transporter ATP-binding protein 0.9336 24 237 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A661B4R1-F1-model_v4 Cell division ATP-binding protein FtsE 0.9329 113 235 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0051301

Map