F417796

General Info

Members Datasets Scaffolds Average Seq Length
349 252 698 523

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100024312|Ga0068868_1000243123
Length 594
Sequence LISSDDILSITQRVQAENGRPRRFVYHAADALHCDSACATDRMGKETSVSDHGRRGSGRRDFLRAGLLSGAAAAGALPVLAAAQNAATSEPHVSSFEFDEITIGQLADGMASGKYTASGIAEKYLARIEEIDRGGPRLNSVIETNPDALEIAAGLDKERKEKGPRGPLHGIPVLVKDNLDTADKMMTTAGSLALVGSKPAKDSFVVQRLRAAGAVILGKTNLSEWANIRSTHSTSGWSGRGGQTKNAYALDRNPCGSSSGSGAAISANLCAVAIGTETDGSIVCPANANGIVGIKPTVGLTSRSGIIPISHTQDGAGPLTRTVRDAAILLGAITGVDPEDKATSESQGKGFSDYTKFLDPKGLKGARIGVVRKYFGFSDSVDRLMDECIAVLKKEGAILVDPADITTLGKFDDSEFMVFLYELKADLNAYLKKLGPSAPVKSLQEIINFNEKNRDKEMPYFGQDIFLKAEAKGSLTEKEYLDAMAKNRQLAKIEGIDVLMDKHKLDALVAPTGSPAWLTDLVNGDHSGGGSSNAAAVAGYPNINVPAGNLWGLPVGISFFGRAWSEPTLIKLAYAFEQATKARITPKFLPTAKL

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
100 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
152 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
155 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
161 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
162 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
167 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
168 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
169 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
181 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
191 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
192 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
196 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
244 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
245 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 2643221559 Lysobacter sp. Root559 Isolate Unclassified
249 2643221586 Lysobacter sp. Root667 Isolate Unclassified
250 2643221593 Lysobacter sp. Root690 Isolate Unclassified
251 2643221612 Lysobacter sp. Root76 Isolate Unclassified
252 2643221727 Lysobacter sp. Root96 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.57
Metatranscriptomes 0
Isolates 1.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.58
Nodule 0
Rhizoplane 5.44
Rhizosphere 83.95
Stem 0
Stem Tuber 0
Unclassified 0.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100024312 3300005338 Bacteria 4596
2 JGI24752J21851_1001720 3300001976 Bacteria 2931
3 JGI25151J46595_10000875 3300003187 Bacteria 23771
4 Ga0055526_1002188 3300003771 Bacteria 13402
5 Ga0055537_1001018 3300003773 Bacteria 12676
6 Ga0055524_1001196 3300003775 Bacteria 15423
7 Ga0055534_1000515 3300003784 Bacteria 20870
8 Ga0055528_1000337 3300003790 Bacteria 39377
9 Ga0065715_10000384 3300005293 Bacteria 12754
10 Ga0070658_10111221 3300005327 Bacteria 2270
11 Ga0070683_100000306 3300005329 Bacteria 33609
12 Ga0070690_100000023 3300005330 Bacteria 72780
13 Ga0070670_100100510 3300005331 Bacteria 2490
14 Ga0070677_10021601 3300005333 Bacteria 2363
15 Ga0070666_10000919 3300005335 Bacteria 17863
16 Ga0070680_100014180 3300005336 Bacteria 6225
17 Ga0070682_100011325 3300005337 Bacteria 5094
18 Ga0070660_100005093 3300005339 Bacteria 9079
19 Ga0070689_100002242 3300005340 Bacteria 12563
20 Ga0070689_100006297 3300005340 Bacteria 8197
21 Ga0070689_100084197 3300005340 Bacteria 2499
22 Ga0070691_10028789 3300005341 Bacteria 2598
23 Ga0070661_100002838 3300005344 Bacteria 11906
24 Ga0070675_100008302 3300005354 Bacteria 8057
25 Ga0070671_100104584 3300005355 Bacteria 2376
26 Ga0070673_100013939 3300005364 Bacteria 5582
27 Ga0070673_100043715 3300005364 Bacteria 3464
28 Ga0070688_100002847 3300005365 Bacteria 8812
29 Ga0070688_100025742 3300005365 Bacteria 3488
30 Ga0070659_100016667 3300005366 Bacteria 5519
31 Ga0070667_100001919 3300005367 Bacteria 18451
32 Ga0070667_100012612 3300005367 Bacteria 6990
33 Ga0070709_10000312 3300005434 Bacteria 30748
34 Ga0070714_100047433 3300005435 Bacteria 3649
35 Ga0070713_100000072 3300005436 Bacteria 64154
36 Ga0070713_100000162 3300005436 Bacteria 45425
37 Ga0070710_10074662 3300005437 Bacteria 1963
38 Ga0070705_100031383 3300005440 Bacteria 2942
39 Ga0070694_100005187 3300005444 Bacteria 7865
40 Ga0070708_100032097 3300005445 Bacteria 4552
41 Ga0070708_100089526 3300005445 Bacteria 2800
42 Ga0070663_100002426 3300005455 Bacteria 10489
43 Ga0070663_100003587 3300005455 Bacteria 8964
44 Ga0070678_100046911 3300005456 Bacteria 3102
45 Ga0070678_100069880 3300005456 Unclassified 2623
46 Ga0070681_10005411 3300005458 Bacteria 12331
47 Ga0070681_10210117 3300005458 Bacteria 1862
48 Ga0068867_100005078 3300005459 Bacteria 9296
49 Ga0070685_10006430 3300005466 Bacteria 5990
50 Ga0070706_100121818 3300005467 Bacteria 2431
51 Ga0070698_100033125 3300005471 Bacteria 5352
52 Ga0070698_100130000 3300005471 Bacteria 2474
53 Ga0070699_100037575 3300005518 Bacteria 4192
54 Ga0070699_100053892 3300005518 Bacteria 3481
55 Ga0070679_100001679 3300005530 Bacteria 19948
56 Ga0070679_100077271 3300005530 Bacteria 3318
57 Ga0070684_100000680 3300005535 Bacteria 23440
58 Ga0070686_100012634 3300005544 Bacteria 4814
59 Ga0070686_100058023 3300005544 Bacteria 2489
60 Ga0070696_100007208 3300005546 Bacteria 7427
61 Ga0070693_100013342 3300005547 Bacteria 4183
62 Ga0070665_100003822 3300005548 Bacteria 15943
63 Ga0070664_100003218 3300005564 Bacteria 13202
64 Ga0070664_100018612 3300005564 Bacteria 5710
65 Ga0068857_100001275 3300005577 Bacteria 19765
66 Ga0068857_100147661 3300005577 Bacteria 2128
67 Ga0068856_100001522 3300005614 Bacteria 24315
68 Ga0068852_100080230 3300005616 Bacteria 2892
69 Ga0068859_100002820 3300005617 Bacteria 17620
70 Ga0068859_100095777 3300005617 Bacteria 3021
71 Ga0068859_100137485 3300005617 Bacteria 2517
72 Ga0068864_100003169 3300005618 Bacteria 13604
73 Ga0068866_10006580 3300005718 Bacteria 4845
74 Ga0068851_10038272 3300005834 Bacteria 2405
75 Ga0068863_100009207 3300005841 Bacteria 9635
76 Ga0068863_100031639 3300005841 Bacteria 5048
77 Ga0068863_100051161 3300005841 Bacteria 3916
78 Ga0068863_100149789 3300005841 Bacteria 2232
79 Ga0068858_100003481 3300005842 Bacteria 15606
80 Ga0068858_100089310 3300005842 Bacteria 2867
81 Ga0068860_100000594 3300005843 Bacteria 43176
82 Ga0068860_100111468 3300005843 Bacteria 2616
83 Ga0068862_100020117 3300005844 Bacteria 5574
84 Ga0068862_100066019 3300005844 Bacteria 3117
85 Ga0070717_10089395 3300006028 Bacteria 2598
86 Ga0075365_10009762 3300006038 Bacteria 5545
87 Ga0070716_100001254 3300006173 Bacteria 11163
88 Ga0070712_100011418 3300006175 Bacteria 5632
89 Ga0097621_100130042 3300006237 Bacteria 2142
90 Ga0075428_100012544 3300006844 Bacteria 9423
91 Ga0075430_100010086 3300006846 Bacteria 7994
92 Ga0075433_10010265 3300006852 Bacteria 7512
93 Ga0075434_100000104 3300006871 Bacteria 47845
94 Ga0075434_100005120 3300006871 Bacteria 11901
95 Ga0075434_100013749 3300006871 Bacteria 7718
96 Ga0075434_100072610 3300006871 Bacteria 3433
97 Ga0068865_100023164 3300006881 Bacteria 4063
98 Ga0075436_100002230 3300006914 Bacteria 13387
99 Ga0075436_100006434 3300006914 Bacteria 8048
100 Ga0075436_100063378 3300006914 Bacteria 2555
101 Ga0097620_100002820 3300006931 Bacteria 17620
102 Ga0097620_100095769 3300006931 Bacteria 3021
103 Ga0097620_100137486 3300006931 Bacteria 2517
104 Ga0075435_100000354 3300007076 Bacteria 28199
105 Ga0105240_10002404 3300009093 Bacteria 30105
106 Ga0105240_10007054 3300009093 Bacteria 16382
107 Ga0111539_10003269 3300009094 Bacteria 21423
108 Ga0111539_10011554 3300009094 Bacteria 11082
109 Ga0105245_10185454 3300009098 Bacteria 1990
110 Ga0105247_10032832 3300009101 Bacteria 3154
111 Ga0114129_10006304 3300009147 Bacteria 16821
112 Ga0114129_10106698 3300009147 Bacteria 3869
113 Ga0114129_10296569 3300009147 Bacteria 2156
114 Ga0105241_10005642 3300009174 Bacteria 9233
115 Ga0105248_10005831 3300009177 Bacteria 13537
116 Ga0105238_10050931 3300009551 Bacteria 4167
117 Ga0105238_10096088 3300009551 Bacteria 2950
118 Ga0105249_10002253 3300009553 Bacteria 16736
119 Ga0105239_10066384 3300010375 Bacteria 3963
120 Ga0105246_10000779 3300011119 Bacteria 18081
121 Ga0157373_10120250 3300013100 Bacteria 1846
122 Ga0157371_10096515 3300013102 Bacteria 2095
123 Ga0157369_10027358 3300013105 Bacteria 6322
124 Ga0157374_10168291 3300013296 Unclassified 2137
125 Ga0157378_10002286 3300013297 Bacteria 17016
126 Ga0163162_10087032 3300013306 Bacteria 3203
127 Ga0163162_10097823 3300013306 Bacteria 3023
128 Ga0157372_10013933 3300013307 Bacteria 8592
129 Ga0157372_10047215 3300013307 Bacteria 4784
130 Ga0157372_10250181 3300013307 Bacteria 2057
131 Ga0163163_10002960 3300014325 Bacteria 14369
132 Ga0163163_10039032 3300014325 Bacteria 4632
133 Ga0182008_10036820 3300014497 Bacteria 2448
134 Ga0157377_10000192 3300014745 Bacteria 34317
135 Ga0157379_10000740 3300014968 Bacteria 26415
136 Ga0157379_10150044 3300014968 Bacteria 2102
137 Ga0157376_10001132 3300014969 Bacteria 17491
138 Ga0157376_10003919 3300014969 Bacteria 10289
139 Ga0157376_10018508 3300014969 Bacteria 5343
140 Ga0182006_1018262 3300015261 Bacteria 2965
141 Ga0213872_10000290 3300021361 Bacteria 42933
142 Ga0209026_1002468 3300025250 Bacteria 6916
143 Ga0209565_1000001 3300025263 Bacteria 2950419
144 Ga0209673_1000001 3300025273 Bacteria 3176258
145 Ga0209675_1000001 3300025291 Bacteria 2950293
146 Ga0209025_1000036 3300025294 Bacteria 404113
147 Ga0209564_1000001 3300025295 Bacteria 3176258
148 Ga0209256_1000002 3300025299 Bacteria 1906740
149 Ga0207682_10025899 3300025893 Bacteria 2327
150 Ga0207642_10008477 3300025899 Bacteria 3530
151 Ga0207680_10007414 3300025903 Bacteria 5345
152 Ga0207647_10035768 3300025904 Bacteria 3162
153 Ga0207699_10000541 3300025906 Bacteria 18660
154 Ga0207699_10005063 3300025906 Bacteria 6304
155 Ga0207699_10012420 3300025906 Unclassified 4332
156 Ga0207645_10001871 3300025907 Bacteria 16993
157 Ga0207645_10034014 3300025907 Bacteria 3275
158 Ga0207654_10028024 3300025911 Bacteria 3067
159 Ga0207707_10002022 3300025912 Bacteria 18412
160 Ga0207707_10079863 3300025912 Bacteria 2856
161 Ga0207695_10002822 3300025913 Bacteria 25243
162 Ga0207693_10000119 3300025915 Bacteria 69804
163 Ga0207693_10012678 3300025915 Bacteria 6808
164 Ga0207693_10077949 3300025915 Bacteria 2594
165 Ga0207660_10028081 3300025917 Bacteria 3846
166 Ga0207662_10009257 3300025918 Bacteria 5413
167 Ga0207657_10003048 3300025919 Bacteria 17919
168 Ga0207657_10086807 3300025919 Bacteria 2618
169 Ga0207649_10000167 3300025920 Bacteria 53742
170 Ga0207652_10004588 3300025921 Bacteria 11203
171 Ga0207652_10101272 3300025921 Bacteria 2544
172 Ga0207694_10074476 3300025924 Bacteria 2657
173 Ga0207650_10000168 3300025925 Bacteria 78419
174 Ga0207659_10000180 3300025926 Bacteria 37729
175 Ga0207687_10097812 3300025927 Bacteria 2154
176 Ga0207700_10001695 3300025928 Bacteria 12519
177 Ga0207700_10041731 3300025928 Bacteria 3359
178 Ga0207670_10124437 3300025936 Bacteria 1879
179 Ga0207704_10013447 3300025938 Bacteria 4095
180 Ga0207665_10028456 3300025939 Bacteria 3690
181 Ga0207691_10002220 3300025940 Bacteria 18981
182 Ga0207691_10011778 3300025940 Bacteria 8393
183 Ga0207711_10000623 3300025941 Bacteria 35575
184 Ga0207711_10022159 3300025941 Bacteria 5311
185 Ga0207689_10001725 3300025942 Bacteria 20675
186 Ga0207661_10000169 3300025944 Bacteria 42018
187 Ga0207679_10000857 3300025945 Bacteria 19470
188 Ga0207679_10085964 3300025945 Bacteria 2417
189 Ga0207651_10003083 3300025960 Bacteria 8096
190 Ga0207651_10042273 3300025960 Bacteria 3032
191 Ga0207668_10018683 3300025972 Bacteria 4369
192 Ga0207658_10001949 3300025986 Bacteria 15412
193 Ga0207703_10000889 3300026035 Bacteria 29312
194 Ga0207678_10002274 3300026067 Bacteria 17390
195 Ga0207678_10007797 3300026067 Bacteria 9453
196 Ga0207702_10005410 3300026078 Bacteria 11176
197 Ga0207641_10000149 3300026088 Bacteria 99331
198 Ga0207641_10034644 3300026088 Bacteria 4202
199 Ga0207641_10052640 3300026088 Bacteria 3449
200 Ga0207648_10001480 3300026089 Bacteria 25838
201 Ga0207648_10007545 3300026089 Bacteria 10674
202 Ga0207676_10003789 3300026095 Bacteria 10691
203 Ga0207674_10002394 3300026116 Bacteria 23701
204 Ga0207674_10074536 3300026116 Bacteria 3405
205 Ga0207675_100048623 3300026118 Bacteria 3959
206 Ga0207675_100053160 3300026118 Bacteria 3779
207 Ga0207683_10002200 3300026121 Bacteria 17135
208 Ga0207683_10062325 3300026121 Bacteria 3284
209 Ga0209999_1000443 3300027543 Bacteria 6379
210 Ga0207428_10024917 3300027907 Bacteria 5016
211 Ga0268266_10010465 3300028379 Bacteria 8107
212 Ga0268266_10012874 3300028379 Bacteria 7222
213 Ga0307517_10001109 3300028786 Bacteria 45519
214 Ga0307517_10112987 3300028786 Bacteria 2053
215 Ga0307515_10144882 3300028794 Bacteria 2523
216 Ga0307513_10013415 3300031456 Bacteria 10055
217 Ga0307513_10081821 3300031456 Bacteria 3326
218 Ga0307509_10003145 3300031507 Bacteria 25579
219 Ga0307509_10004938 3300031507 Bacteria 18878
220 Ga0307509_10060348 3300031507 Bacteria 4009
221 Ga0307508_10004351 3300031616 Bacteria 13853
222 Ga0307508_10004696 3300031616 Bacteria 13236
223 Ga0307508_10009523 3300031616 Bacteria 8928
224 Ga0307514_10085067 3300031649 Bacteria 2326
225 Ga0316576_10000918 3300031727 Bacteria 15041
226 Ga0307413_10001673 3300031824 Bacteria 8621
227 Ga0307409_100059467 3300031995 Bacteria 2974
228 Ga0307416_100008280 3300032002 Bacteria 6694
229 Ga0307510_10011738 3300033180 Bacteria 10395
230 Ga0307510_10020438 3300033180 Bacteria 7733
231 Ga0373948_0000512 3300034817 Bacteria 4855
232 Ga0373928_0000193 3300035084 Bacteria 11706
233 Ga0373929_0000350 3300035085 Bacteria 8597
234 Ga0373940_0000908 3300035088 Bacteria 4995
235 Ga0373949_0002810 3300035090 Bacteria 4333
236 Ga0373951_0001357 3300035091 Bacteria 6430
237 Ga0373952_0000168 3300035092 Bacteria 10016
238 Ga0373932_0000676 3300035112 Bacteria 10316
239 Ga0373939_0000207 3300035114 Bacteria 16310
240 Ga0373941_0001215 3300035115 Bacteria 5404
241 Ga0373960_0000066 3300035121 Bacteria 14802
242 Ga0373961_0000881 3300035241 Bacteria 10074
243 Ga0373931_0000370 3300035691 Bacteria 18463
244 Ga0373935_0004586 3300035692 Bacteria 8122
245 Ga0373937_0119549 3300036401 Bacteria 2455
246 Ga0316584_0087079 3300036712 Bacteria 2338
247 Ga0395899_0013155 3300037312 Bacteria 6328
248 Ga0395900_0004877 3300037418 Bacteria 14129
249 Ga0395905_0031621 3300037471 Bacteria 4981
250 Ga0395905_0051544 3300037471 Bacteria 3855
251 Ga0436364_0682900 3300037853 Bacteria 8884
252 Ga0436361_1196706 3300039447 Bacteria 36697
253 Ga0439447_002245 3300041407 Bacteria 7085
254 Ga0451577_0000070 3300042876 Bacteria 238621
255 Ga0453684_0000263 3300044712 Bacteria 226494
256 Ga0453684_0000444 3300044712 Bacteria 167501
257 Ga0453684_0026671 3300044712 Bacteria 8330
258 Ga0453684_0091845 3300044712 Bacteria 3745
259 Ga0451576_0036804 3300045051 Bacteria 5186
260 Ga0451576_0062990 3300045051 Bacteria 3866
261 Ga0451576_0096259 3300045051 Bacteria 3079
262 Ga0451576_0163473 3300045051 Bacteria 2323
263 Ga0466967_0126721 3300045976 Bacteria 2366
264 Ga0495592_0000131 3300046454 Bacteria 66382
265 Ga0495580_0020045 3300046472 Bacteria 4957
266 Ga0495580_0027695 3300046472 Bacteria 4123
267 Ga0495584_0000006 3300046491 Bacteria 301775
268 Ga0495594_0001294 3300046499 Bacteria 13053
269 Ga0495594_0042258 3300046499 Bacteria 2496
270 Ga0495594_0056732 3300046499 Bacteria 2162
271 Ga0495596_0005926 3300046500 Bacteria 5701
272 Ga0495583_0000878 3300046506 Bacteria 36404
273 Ga0495616_0000361 3300046513 Bacteria 35729
274 Ga0495630_0010385 3300046517 Bacteria 6721
275 Ga0495643_0000648 3300046522 Bacteria 41187
276 Ga0495609_0008275 3300046538 Bacteria 5101
277 Ga0495633_0032949 3300046558 Bacteria 2500
278 Ga0495668_0003266 3300046616 Bacteria 12327
279 Ga0495661_0022168 3300046665 Bacteria 4134
280 Ga0495636_0001192 3300047318 Bacteria 9814
281 Ga0495674_0101507 3300047319 Bacteria 2447
282 Ga0495672_0005921 3300047320 Bacteria 9582
283 Ga0495686_0001746 3300047472 Bacteria 22303
284 Ga0496101_0007120 3300048904 Bacteria 7234
285 Ga0496102_0010229 3300048905 Bacteria 8065
286 Ga0496103_0009307 3300048906 Bacteria 5821
287 Ga0496103_0048889 3300048906 Bacteria 2614
288 Ga0496105_0107142 3300048908 Bacteria 2307
289 Ga0496106_0000196 3300048909 Bacteria 42639
290 Ga0496107_0022031 3300048910 Bacteria 4500
291 Ga0496108_0000893 3300048911 Bacteria 23234
292 Ga0496109_0000055 3300048912 Bacteria 121528
293 Ga0496109_0077590 3300048912 Bacteria 3057
294 Ga0496110_0002537 3300048913 Bacteria 13728
295 Ga0496110_0008231 3300048913 Bacteria 8381
296 Ga0496111_0052206 3300048914 Bacteria 2952
297 Ga0496112_0000107 3300048915 Bacteria 52331
298 Ga0496112_0025715 3300048915 Bacteria 5653
299 Ga0496113_0015432 3300048916 Bacteria 5249
300 Ga0496113_0016734 3300048916 Bacteria 5071
301 Ga0496114_0000678 3300048917 Bacteria 25278
302 Ga0496115_0120365 3300048918 Bacteria 2160
303 Ga0501032_0032582 3300049569 Bacteria 3571
304 Ga0501034_0015132 3300049571 Bacteria 7929
305 Ga0501038_0035100 3300049574 Bacteria 4405
306 Ga0501042_0024146 3300049578 Bacteria 4263
307 Ga0501043_0022953 3300049579 Bacteria 4892
308 Ga0501046_0007258 3300049580 Bacteria 9745
309 Ga0501047_0003056 3300049581 Bacteria 15875
310 Ga0501048_0013926 3300049582 Bacteria 5963
311 Ga0501048_0027605 3300049582 Bacteria 4123
312 Ga0501068_0044692 3300049584 Bacteria 2667
313 Ga0501069_0026009 3300049585 Bacteria 3204
314 Ga0501071_0019224 3300049587 Bacteria 4739
315 Ga0501071_0116770 3300049587 Bacteria 1976
316 Ga0501072_0072070 3300049588 Bacteria 2730
317 Ga0501073_0001600 3300049589 Bacteria 16770
318 Ga0501075_0015032 3300049591 Bacteria 5552
319 Ga0501075_0023709 3300049591 Bacteria 4494
320 Ga0501076_0007146 3300049592 Bacteria 8114
321 Ga0501235_001045 3300049669 Bacteria 5765
322 Ga0501080_0032193 3300049742 Bacteria 4888
323 Ga0501080_0085558 3300049742 Bacteria 2930
324 Ga0501081_0004082 3300049743 Bacteria 9356
325 Ga0501083_0007578 3300049744 Bacteria 7690
326 Ga0501265_000933 3300049762 Bacteria 3274
327 nmdc:mga05p37_200242_c1 3300050507 Bacteria 2419
328 nmdc:mga05p37_244338_c1 3300050507 Bacteria 2156
329 nmdc:mga08y16_3055_c1 3300050511 Bacteria 17296
330 nmdc:mga08y16_79423_c1 3300050511 Bacteria 3419
331 nmdc:mga08y16_7995_c1 3300050511 Bacteria 11067
332 nmdc:mga0n895_279_c1 3300050512 Bacteria 33669
333 nmdc:mga0rr50_267_c1 3300050513 Bacteria 28320
334 nmdc:mga0rr50_27850_c1 3300050513 Bacteria 3964
335 nmdc:mga08x19_3045_c1 3300050514 Bacteria 10075
336 nmdc:mga08x19_504_c1 3300050514 Bacteria 25890
337 nmdc:mga08x19_54798_c1 3300050514 Bacteria 2568
338 nmdc:mga08x19_916_c1 3300050514 Bacteria 18626
339 nmdc:mga0a205_379_c1 3300050515 Bacteria 33748
340 Ga0500592_002601 3300053116 Bacteria 2898
341 Ga0500607_054668 3300053121 Bacteria 2113
342 Ga0500586_012909 3300053145 Bacteria 2445
343 Ga0501084_0092675 3300054114 Bacteria 2536
344 Ga0501082_0002667 3300060353 Bacteria 15590
345 2643816157 2643221559 Bacteria 4424915
346 2643938185 2643221586 Bacteria 4446529
347 2643975389 2643221593 Bacteria 6296053
348 2644077757 2643221612 Bacteria 4361984
349 2644695950 2643221727 Bacteria 4415595
350 Ga0068868_100024312
351 JGI24752J21851_1001720
352 JGI25151J46595_10000875
353 Ga0055526_1002188
354 Ga0055537_1001018
355 Ga0055524_1001196
356 Ga0055534_1000515
357 Ga0055528_1000337
358 Ga0065715_10000384
359 Ga0070658_10111221
360 Ga0070683_100000306
361 Ga0070690_100000023
362 Ga0070670_100100510
363 Ga0070677_10021601
364 Ga0070666_10000919
365 Ga0070680_100014180
366 Ga0070682_100011325
367 Ga0070660_100005093
368 Ga0070689_100002242
369 Ga0070689_100006297
370 Ga0070689_100084197
371 Ga0070691_10028789
372 Ga0070661_100002838
373 Ga0070675_100008302
374 Ga0070671_100104584
375 Ga0070673_100013939
376 Ga0070673_100043715
377 Ga0070688_100002847
378 Ga0070688_100025742
379 Ga0070659_100016667
380 Ga0070667_100001919
381 Ga0070667_100012612
382 Ga0070709_10000312
383 Ga0070714_100047433
384 Ga0070713_100000072
385 Ga0070713_100000162
386 Ga0070710_10074662
387 Ga0070705_100031383
388 Ga0070694_100005187
389 Ga0070708_100032097
390 Ga0070708_100089526
391 Ga0070663_100002426
392 Ga0070663_100003587
393 Ga0070678_100046911
394 Ga0070678_100069880
395 Ga0070681_10005411
396 Ga0070681_10210117
397 Ga0068867_100005078
398 Ga0070685_10006430
399 Ga0070706_100121818
400 Ga0070698_100033125
401 Ga0070698_100130000
402 Ga0070699_100037575
403 Ga0070699_100053892
404 Ga0070679_100001679
405 Ga0070679_100077271
406 Ga0070684_100000680
407 Ga0070686_100012634
408 Ga0070686_100058023
409 Ga0070696_100007208
410 Ga0070693_100013342
411 Ga0070665_100003822
412 Ga0070664_100003218
413 Ga0070664_100018612
414 Ga0068857_100001275
415 Ga0068857_100147661
416 Ga0068856_100001522
417 Ga0068852_100080230
418 Ga0068859_100002820
419 Ga0068859_100095777
420 Ga0068859_100137485
421 Ga0068864_100003169
422 Ga0068866_10006580
423 Ga0068851_10038272
424 Ga0068863_100009207
425 Ga0068863_100031639
426 Ga0068863_100051161
427 Ga0068863_100149789
428 Ga0068858_100003481
429 Ga0068858_100089310
430 Ga0068860_100000594
431 Ga0068860_100111468
432 Ga0068862_100020117
433 Ga0068862_100066019
434 Ga0070717_10089395
435 Ga0075365_10009762
436 Ga0070716_100001254
437 Ga0070712_100011418
438 Ga0097621_100130042
439 Ga0075428_100012544
440 Ga0075430_100010086
441 Ga0075433_10010265
442 Ga0075434_100000104
443 Ga0075434_100005120
444 Ga0075434_100013749
445 Ga0075434_100072610
446 Ga0068865_100023164
447 Ga0075436_100002230
448 Ga0075436_100006434
449 Ga0075436_100063378
450 Ga0097620_100002820
451 Ga0097620_100095769
452 Ga0097620_100137486
453 Ga0075435_100000354
454 Ga0105240_10002404
455 Ga0105240_10007054
456 Ga0111539_10003269
457 Ga0111539_10011554
458 Ga0105245_10185454
459 Ga0105247_10032832
460 Ga0114129_10006304
461 Ga0114129_10106698
462 Ga0114129_10296569
463 Ga0105241_10005642
464 Ga0105248_10005831
465 Ga0105238_10050931
466 Ga0105238_10096088
467 Ga0105249_10002253
468 Ga0105239_10066384
469 Ga0105246_10000779
470 Ga0157373_10120250
471 Ga0157371_10096515
472 Ga0157369_10027358
473 Ga0157374_10168291
474 Ga0157378_10002286
475 Ga0163162_10087032
476 Ga0163162_10097823
477 Ga0157372_10013933
478 Ga0157372_10047215
479 Ga0157372_10250181
480 Ga0163163_10002960
481 Ga0163163_10039032
482 Ga0182008_10036820
483 Ga0157377_10000192
484 Ga0157379_10000740
485 Ga0157379_10150044
486 Ga0157376_10001132
487 Ga0157376_10003919
488 Ga0157376_10018508
489 Ga0182006_1018262
490 Ga0213872_10000290
491 Ga0209026_1002468
492 Ga0209565_1000001
493 Ga0209673_1000001
494 Ga0209675_1000001
495 Ga0209025_1000036
496 Ga0209564_1000001
497 Ga0209256_1000002
498 Ga0207682_10025899
499 Ga0207642_10008477
500 Ga0207680_10007414
501 Ga0207647_10035768
502 Ga0207699_10000541
503 Ga0207699_10005063
504 Ga0207699_10012420
505 Ga0207645_10001871
506 Ga0207645_10034014
507 Ga0207654_10028024
508 Ga0207707_10002022
509 Ga0207707_10079863
510 Ga0207695_10002822
511 Ga0207693_10000119
512 Ga0207693_10012678
513 Ga0207693_10077949
514 Ga0207660_10028081
515 Ga0207662_10009257
516 Ga0207657_10003048
517 Ga0207657_10086807
518 Ga0207649_10000167
519 Ga0207652_10004588
520 Ga0207652_10101272
521 Ga0207694_10074476
522 Ga0207650_10000168
523 Ga0207659_10000180
524 Ga0207687_10097812
525 Ga0207700_10001695
526 Ga0207700_10041731
527 Ga0207670_10124437
528 Ga0207704_10013447
529 Ga0207665_10028456
530 Ga0207691_10002220
531 Ga0207691_10011778
532 Ga0207711_10000623
533 Ga0207711_10022159
534 Ga0207689_10001725
535 Ga0207661_10000169
536 Ga0207679_10000857
537 Ga0207679_10085964
538 Ga0207651_10003083
539 Ga0207651_10042273
540 Ga0207668_10018683
541 Ga0207658_10001949
542 Ga0207703_10000889
543 Ga0207678_10002274
544 Ga0207678_10007797
545 Ga0207702_10005410
546 Ga0207641_10000149
547 Ga0207641_10034644
548 Ga0207641_10052640
549 Ga0207648_10001480
550 Ga0207648_10007545
551 Ga0207676_10003789
552 Ga0207674_10002394
553 Ga0207674_10074536
554 Ga0207675_100048623
555 Ga0207675_100053160
556 Ga0207683_10002200
557 Ga0207683_10062325
558 Ga0209999_1000443
559 Ga0207428_10024917
560 Ga0268266_10010465
561 Ga0268266_10012874
562 Ga0307517_10001109
563 Ga0307517_10112987
564 Ga0307515_10144882
565 Ga0307513_10013415
566 Ga0307513_10081821
567 Ga0307509_10003145
568 Ga0307509_10004938
569 Ga0307509_10060348
570 Ga0307508_10004351
571 Ga0307508_10004696
572 Ga0307508_10009523
573 Ga0307514_10085067
574 Ga0316576_10000918
575 Ga0307413_10001673
576 Ga0307409_100059467
577 Ga0307416_100008280
578 Ga0307510_10011738
579 Ga0307510_10020438
580 Ga0373948_0000512
581 Ga0373928_0000193
582 Ga0373929_0000350
583 Ga0373940_0000908
584 Ga0373949_0002810
585 Ga0373951_0001357
586 Ga0373952_0000168
587 Ga0373932_0000676
588 Ga0373939_0000207
589 Ga0373941_0001215
590 Ga0373960_0000066
591 Ga0373961_0000881
592 Ga0373931_0000370
593 Ga0373935_0004586
594 Ga0373937_0119549
595 Ga0316584_0087079
596 Ga0395899_0013155
597 Ga0395900_0004877
598 Ga0395905_0031621
599 Ga0395905_0051544
600 Ga0436364_0682900
601 Ga0436361_1196706
602 Ga0439447_002245
603 Ga0451577_0000070
604 Ga0453684_0000263
605 Ga0453684_0000444
606 Ga0453684_0026671
607 Ga0453684_0091845
608 Ga0451576_0036804
609 Ga0451576_0062990
610 Ga0451576_0096259
611 Ga0451576_0163473
612 Ga0466967_0126721
613 Ga0495592_0000131
614 Ga0495580_0020045
615 Ga0495580_0027695
616 Ga0495584_0000006
617 Ga0495594_0001294
618 Ga0495594_0042258
619 Ga0495594_0056732
620 Ga0495596_0005926
621 Ga0495583_0000878
622 Ga0495616_0000361
623 Ga0495630_0010385
624 Ga0495643_0000648
625 Ga0495609_0008275
626 Ga0495633_0032949
627 Ga0495668_0003266
628 Ga0495661_0022168
629 Ga0495636_0001192
630 Ga0495674_0101507
631 Ga0495672_0005921
632 Ga0495686_0001746
633 Ga0496101_0007120
634 Ga0496102_0010229
635 Ga0496103_0009307
636 Ga0496103_0048889
637 Ga0496105_0107142
638 Ga0496106_0000196
639 Ga0496107_0022031
640 Ga0496108_0000893
641 Ga0496109_0000055
642 Ga0496109_0077590
643 Ga0496110_0002537
644 Ga0496110_0008231
645 Ga0496111_0052206
646 Ga0496112_0000107
647 Ga0496112_0025715
648 Ga0496113_0015432
649 Ga0496113_0016734
650 Ga0496114_0000678
651 Ga0496115_0120365
652 Ga0501032_0032582
653 Ga0501034_0015132
654 Ga0501038_0035100
655 Ga0501042_0024146
656 Ga0501043_0022953
657 Ga0501046_0007258
658 Ga0501047_0003056
659 Ga0501048_0013926
660 Ga0501048_0027605
661 Ga0501068_0044692
662 Ga0501069_0026009
663 Ga0501071_0019224
664 Ga0501071_0116770
665 Ga0501072_0072070
666 Ga0501073_0001600
667 Ga0501075_0015032
668 Ga0501075_0023709
669 Ga0501076_0007146
670 Ga0501235_001045
671 Ga0501080_0032193
672 Ga0501080_0085558
673 Ga0501081_0004082
674 Ga0501083_0007578
675 Ga0501265_000933
676 nmdc:mga05p37_200242_c1
677 nmdc:mga05p37_244338_c1
678 nmdc:mga08y16_3055_c1
679 nmdc:mga08y16_79423_c1
680 nmdc:mga08y16_7995_c1
681 nmdc:mga0n895_279_c1
682 nmdc:mga0rr50_267_c1
683 nmdc:mga0rr50_27850_c1
684 nmdc:mga08x19_3045_c1
685 nmdc:mga08x19_504_c1
686 nmdc:mga08x19_54798_c1
687 nmdc:mga08x19_916_c1
688 nmdc:mga0a205_379_c1
689 Ga0500592_002601
690 Ga0500607_054668
691 Ga0500586_012909
692 Ga0501084_0092675
693 Ga0501082_0002667
694 2643816157
695 2643938185
696 2643975389
697 2644077757
698 2644695950

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01425

Amidase

Amidase

120

570

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1m21-assembly2.cif.gz_B crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin 0.9837 47 536
1m21-assembly2.cif.gz_B crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin 0.9777 47 536
5ac3-assembly1.cif.gz_A crystal structure of pam12a 0.9716 46 538
1m22-assembly2.cif.gz_B x-ray structure of native peptide amidase from stenotrophomonas maltophilia at 1.4 a 0.967 46 536
5ac3-assembly1.cif.gz_A crystal structure of pam12a 0.9658 46 538
ID Description Score Start End Superfamily
1m22A00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.967 46 536 3.90.1300.10
1m22A00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9572 46 536 3.90.1300.10
af_A0A0P0XRM7_54_372_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9464 45 343 3.90.1300.10
af_A0A0P0WV09_96_533_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9419 120 536 3.90.1300.10
af_A0A1P8B760_22_510_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9408 45 536 3.90.1300.10
ID Description Score Start End GO Terms
AF-A0A3M0Z6X4-F1-model_v4 deleted 0.9932 51 265
AF-A0A836VI75-F1-model_v4 Amidase (EC 3.5.1.4) 0.9881 61 211 GO:0016787
AF-A0A6L8JK38-F1-model_v4 deleted 0.9874 69 232
AF-A0A7V8VWX2-F1-model_v4 Amidase domain-containing protein 0.9803 304 536
AF-A0A3B9LUU2-F1-model_v4 Amidase (EC 3.5.1.4) 0.9785 79 212 GO:0004040

Map