F417883

General Info

Members Datasets Scaffolds Average Seq Length
349 225 698 447

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10043385|Ga0105243_100433852
Length 471
Sequence MPLLDLLPLAASESNLLAAREQMAFTLAFHIVLSCIGVALPATMLVANYVGLKKGDEAAMELARRWSKAIAVTFAVGAVTGTVLSFEFGLLWPEFMDRFGAAFGVAFXXEIAVYIYGWKRLSPWAHFWSGVPMVITGIGGAFSVVAANAWMNQPQGFTLNGAGEVVDVEPLKVLFNPATGYEVAHMILAAYMVVGFLVASIYAVGMLKGRRDRLHKLGLVIPLTIACIATPVQLFVGDTAARGVADHQPAKFAAMECIYETGDNQTEYLGGVCTGDGVKGAIGIPGLDSFLVGWSTDTRVTGLNDIPEDEQPPAKTLLHLSFDAMVGIGSALMGLAIWFGFVWWKRRDIPQTPWFLRAVSVSGGAAIVALWCGWIVTEVGRQPWIVQGYMRTSEAVTEAEGIWFTFALVLLLYTGLGTGAILVLRAMSRRWRDAGLDLEGDTPYAPPAPLSSTGRKPDYVSGNRPVDGGGA

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
113 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
114 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
115 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
116 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
119 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
120 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
219 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
220 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
223 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
224 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
225 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 12.32
Rhizosphere 82.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10043385 3300009148 Bacteria 3525
2 JGI24740J21852_10006896 3300001979 Bacteria 4663
3 JGI24748J21848_1001111 3300002074 Bacteria 2921
4 JGI24034J26672_10000195 3300002239 Bacteria 8103
5 JGI24742J22300_10002582 3300002244 Bacteria 2898
6 JGI25404J52841_10000594 3300003659 Bacteria 5393
7 Ga0070683_100000226 3300005329 Bacteria 38469
8 Ga0070683_100005302 3300005329 Bacteria 10742
9 Ga0070683_100092674 3300005329 Bacteria 2838
10 Ga0070683_100103034 3300005329 Bacteria 2688
11 Ga0070670_100058203 3300005331 Bacteria 3318
12 Ga0070677_10000007 3300005333 Bacteria 74721
13 Ga0070666_10005160 3300005335 Bacteria 7995
14 Ga0070682_100000038 3300005337 Bacteria 145670
15 Ga0070682_100000072 3300005337 Bacteria 93808
16 Ga0068868_100000314 3300005338 Bacteria 32538
17 Ga0068868_100030645 3300005338 Bacteria 4125
18 Ga0070691_10000052 3300005341 Bacteria 32264
19 Ga0070691_10007204 3300005341 Bacteria 5092
20 Ga0070661_100000116 3300005344 Bacteria 66712
21 Ga0070668_100096231 3300005347 Bacteria 2340
22 Ga0070675_100000008 3300005354 Bacteria 250004
23 Ga0070688_100000066 3300005365 Bacteria 52354
24 Ga0070688_100003641 3300005365 Bacteria 7953
25 Ga0070659_100012851 3300005366 Bacteria 6221
26 Ga0070667_100042243 3300005367 Bacteria 3825
27 Ga0070713_100000061 3300005436 Bacteria 68662
28 Ga0070711_100050199 3300005439 Bacteria 2859
29 Ga0070663_100009024 3300005455 Bacteria 6159
30 Ga0070678_100022184 3300005456 Bacteria 4201
31 Ga0070662_100000079 3300005457 Bacteria 53583
32 Ga0070681_10031996 3300005458 Bacteria 5281
33 Ga0068867_100000246 3300005459 Bacteria 35737
34 Ga0068867_100071772 3300005459 Bacteria 2590
35 Ga0070685_10000165 3300005466 Bacteria 43529
36 Ga0070685_10000230 3300005466 Bacteria 36879
37 Ga0070679_100000077 3300005530 Bacteria 74222
38 Ga0070679_100002291 3300005530 Bacteria 17304
39 Ga0070684_100059157 3300005535 Bacteria 3350
40 Ga0070684_100090535 3300005535 Bacteria 2721
41 Ga0070684_100123341 3300005535 Bacteria 2332
42 Ga0068853_100001022 3300005539 Bacteria 19725
43 Ga0070672_100000018 3300005543 Bacteria 70205
44 Ga0070693_100065495 3300005547 Bacteria 2124
45 Ga0070665_100000306 3300005548 Bacteria 76666
46 Ga0070664_100052635 3300005564 Bacteria 3448
47 Ga0068854_100000044 3300005578 Bacteria 91882
48 Ga0068854_100034195 3300005578 Bacteria 3549
49 Ga0068856_100000654 3300005614 Bacteria 37552
50 Ga0068852_100000050 3300005616 Bacteria 84306
51 Ga0068851_10000669 3300005834 Bacteria 14656
52 Ga0068863_100000039 3300005841 Bacteria 161450
53 Ga0068863_100008208 3300005841 Bacteria 10204
54 Ga0068858_100000178 3300005842 Bacteria 67760
55 Ga0068858_100000454 3300005842 Bacteria 42918
56 Ga0068860_100021006 3300005843 Bacteria 6326
57 Ga0081455_10006555 3300005937 Bacteria 12458
58 Ga0081455_10019025 3300005937 Bacteria 6513
59 Ga0081455_10022633 3300005937 Bacteria 5868
60 Ga0081455_10065660 3300005937 Bacteria 3034
61 Ga0081455_10100003 3300005937 Bacteria 2331
62 Ga0081540_1000044 3300005983 Bacteria 134269
63 Ga0081540_1006546 3300005983 Bacteria 8462
64 Ga0081539_10007734 3300005985 Bacteria 9635
65 Ga0070715_10000003 3300006163 Bacteria 345282
66 Ga0070712_100001770 3300006175 Bacteria 13223
67 Ga0068871_100103800 3300006358 Bacteria 2384
68 Ga0075433_10001949 3300006852 Bacteria 15514
69 Ga0075433_10076863 3300006852 Bacteria 2941
70 Ga0075434_100211647 3300006871 Bacteria 1959
71 Ga0068865_100000019 3300006881 Bacteria 105996
72 Ga0075436_100042536 3300006914 Bacteria 3133
73 Ga0105240_10242940 3300009093 Bacteria 2086
74 Ga0111539_10058744 3300009094 Bacteria 4562
75 Ga0111539_10067223 3300009094 Bacteria 4232
76 Ga0105245_10000012 3300009098 Bacteria 267151
77 Ga0105245_10000049 3300009098 Bacteria 128277
78 Ga0105245_10000508 3300009098 Bacteria 35724
79 Ga0105247_10000109 3300009101 Bacteria 84490
80 Ga0105247_10045489 3300009101 Bacteria 2693
81 Ga0105242_10013472 3300009176 Bacteria 6322
82 Ga0105248_10000126 3300009177 Bacteria 88461
83 Ga0105237_10194933 3300009545 Bacteria 2025
84 Ga0105238_10000014 3300009551 Bacteria 241954
85 Ga0105249_10000039 3300009553 Bacteria 196325
86 Ga0105249_10082410 3300009553 Bacteria 2993
87 Ga0105239_10342223 3300010375 Bacteria 1688
88 Ga0157371_10004303 3300013102 Bacteria 12492
89 Ga0157370_10020919 3300013104 Bacteria 6527
90 Ga0157369_10000135 3300013105 Bacteria 105364
91 Ga0157374_10147305 3300013296 Bacteria 2287
92 Ga0157378_10000598 3300013297 Bacteria 33812
93 Ga0157378_10017219 3300013297 Bacteria 6337
94 Ga0157378_10067081 3300013297 Bacteria 3214
95 Ga0157372_10001053 3300013307 Bacteria 30139
96 Ga0157375_10003759 3300013308 Bacteria 13161
97 Ga0157375_10206077 3300013308 Bacteria 2123
98 Ga0163163_10193105 3300014325 Bacteria 2084
99 Ga0157380_10000009 3300014326 Bacteria 142155
100 Ga0157380_10000277 3300014326 Bacteria 30723
101 Ga0157376_10086175 3300014969 Bacteria 2707
102 Ga0163161_10000013 3300017792 Bacteria 258747
103 Ga0207656_10003169 3300025321 Bacteria 5623
104 Ga0207682_10000007 3300025893 Bacteria 88967
105 Ga0207692_10051550 3300025898 Bacteria 2087
106 Ga0207710_10000408 3300025900 Bacteria 28571
107 Ga0207680_10001305 3300025903 Bacteria 11789
108 Ga0207680_10004991 3300025903 Bacteria 6321
109 Ga0207685_10000003 3300025905 Bacteria 344527
110 Ga0207707_10013686 3300025912 Bacteria 7075
111 Ga0207671_10064865 3300025914 Bacteria 2715
112 Ga0207693_10006644 3300025915 Bacteria 9556
113 Ga0207663_10003362 3300025916 Bacteria 7817
114 Ga0207649_10000005 3300025920 Bacteria 356179
115 Ga0207652_10000138 3300025921 Bacteria 77564
116 Ga0207652_10001427 3300025921 Bacteria 21179
117 Ga0207694_10000008 3300025924 Bacteria 484902
118 Ga0207659_10000014 3300025926 Bacteria 168481
119 Ga0207687_10000011 3300025927 Bacteria 388349
120 Ga0207687_10000012 3300025927 Bacteria 370729
121 Ga0207687_10000750 3300025927 Bacteria 21930
122 Ga0207700_10000016 3300025928 Bacteria 202434
123 Ga0207690_10007936 3300025932 Bacteria 6301
124 Ga0207706_10000302 3300025933 Bacteria 53541
125 Ga0207686_10000029 3300025934 Bacteria 160239
126 Ga0207709_10007236 3300025935 Bacteria 6189
127 Ga0207704_10000009 3300025938 Bacteria 198266
128 Ga0207691_10000121 3300025940 Bacteria 70558
129 Ga0207711_10000024 3300025941 Bacteria 293596
130 Ga0207689_10035656 3300025942 Bacteria 4131
131 Ga0207661_10000068 3300025944 Bacteria 70953
132 Ga0207661_10003655 3300025944 Bacteria 10716
133 Ga0207661_10018762 3300025944 Bacteria 5145
134 Ga0207661_10063490 3300025944 Bacteria 2991
135 Ga0207679_10005625 3300025945 Bacteria 7862
136 Ga0207712_10000003 3300025961 Bacteria 615314
137 Ga0207668_10022699 3300025972 Bacteria 4022
138 Ga0207640_10000517 3300025981 Bacteria 23263
139 Ga0207640_10004533 3300025981 Bacteria 7541
140 Ga0207677_10000218 3300026023 Bacteria 45820
141 Ga0207677_10018817 3300026023 Bacteria 4155
142 Ga0207703_10000381 3300026035 Bacteria 47426
143 Ga0207703_10000451 3300026035 Bacteria 43264
144 Ga0207639_10002102 3300026041 Bacteria 13411
145 Ga0207678_10000872 3300026067 Bacteria 27690
146 Ga0207678_10028413 3300026067 Bacteria 4883
147 Ga0207702_10000099 3300026078 Bacteria 100461
148 Ga0207702_10001991 3300026078 Bacteria 19831
149 Ga0207641_10000065 3300026088 Bacteria 156066
150 Ga0207641_10001058 3300026088 Bacteria 27805
151 Ga0207648_10000783 3300026089 Bacteria 35821
152 Ga0207698_10000009 3300026142 Bacteria 281300
153 Ga0268266_10000023 3300028379 Bacteria 501899
154 Ga0268266_10000342 3300028379 Bacteria 72894
155 Ga0268264_10010113 3300028381 Bacteria 7807
156 Ga0265337_1000074 3300028556 Bacteria 46897
157 Ga0265326_10000035 3300028558 Bacteria 89561
158 Ga0265326_10020417 3300028558 Bacteria 1899
159 Ga0265319_1000091 3300028563 Bacteria 70394
160 Ga0265322_10000009 3300028654 Bacteria 170768
161 Ga0265336_10005968 3300028666 Bacteria 4441
162 Ga0265338_10000752 3300028800 Bacteria 55238
163 Ga0265324_10000168 3300029957 Bacteria 50622
164 Ga0265324_10019055 3300029957 Bacteria 2474
165 Ga0307511_10091834 3300030521 Bacteria 2052
166 Ga0265328_10004875 3300031239 Bacteria 5780
167 Ga0265320_10000024 3300031240 Bacteria 170768
168 Ga0265325_10008658 3300031241 Bacteria 5991
169 Ga0265331_10017484 3300031250 Bacteria 3737
170 Ga0265327_10000227 3300031251 Bacteria 114777
171 Ga0265316_10099498 3300031344 Bacteria 2211
172 Ga0265314_10000647 3300031711 Bacteria 42707
173 Ga0395898_0055248 3300037466 Bacteria 3873
174 Ga0395905_0150631 3300037471 Bacteria 2189
175 Ga0451853_3365981 3300041512 Bacteria 5530
176 Ga0466963_0000025 3300044694 Bacteria 51171
177 Ga0466957_0006020 3300044842 Bacteria 6843
178 Ga0466958_0027822 3300045836 Bacteria 3347
179 Ga0466967_0000005 3300045976 Bacteria 149543
180 Ga0466967_0258234 3300045976 Bacteria 1666
181 Ga0495592_0002025 3300046454 Bacteria 14286
182 Ga0495603_0000054 3300046455 Bacteria 49027
183 Ga0495603_0000431 3300046455 Bacteria 23265
184 Ga0495629_0000377 3300046459 Bacteria 37247
185 Ga0495629_0050162 3300046459 Bacteria 2923
186 Ga0495629_0067237 3300046459 Bacteria 2501
187 Ga0495629_0092221 3300046459 Bacteria 2114
188 Ga0495638_0030271 3300046460 Bacteria 3486
189 Ga0495641_0000095 3300046461 Bacteria 60441
190 Ga0495641_0020286 3300046461 Bacteria 3374
191 Ga0495653_0040546 3300046463 Bacteria 3639
192 Ga0495653_0044927 3300046463 Bacteria 3427
193 Ga0495653_0103711 3300046463 Bacteria 2056
194 Ga0495582_0000082 3300046473 Bacteria 48118
195 Ga0495662_0005370 3300046476 Bacteria 6416
196 Ga0495594_0000191 3300046499 Bacteria 29900
197 Ga0495606_0000294 3300046507 Bacteria 85998
198 Ga0495608_0000010 3300046511 Bacteria 258660
199 Ga0495608_0004501 3300046511 Bacteria 9955
200 Ga0495618_0000097 3300046514 Bacteria 63474
201 Ga0495620_0000158 3300046515 Bacteria 54704
202 Ga0495628_0000048 3300046516 Bacteria 96944
203 Ga0495630_0000011 3300046517 Bacteria 232063
204 Ga0495630_0000082 3300046517 Bacteria 75280
205 Ga0495644_0004418 3300046523 Bacteria 5522
206 Ga0495652_0000003 3300046529 Bacteria 597094
207 Ga0495652_0022568 3300046529 Bacteria 5584
208 Ga0495640_0020617 3300046533 Bacteria 4849
209 Ga0495586_0000234 3300046535 Bacteria 36813
210 Ga0495645_0043864 3300046543 Bacteria 3262
211 Ga0495622_0000925 3300046557 Bacteria 15862
212 Ga0495667_0000053 3300046559 Bacteria 105370
213 Ga0495634_0000616 3300046642 Bacteria 34537
214 Ga0495634_0002295 3300046642 Bacteria 15998
215 Ga0495634_0022292 3300046642 Bacteria 4463
216 Ga0495625_0001012 3300046660 Bacteria 37072
217 Ga0495625_0164347 3300046660 Bacteria 1485
218 Ga0495635_0000006 3300046663 Bacteria 301820
219 Ga0495635_0058527 3300046663 Bacteria 2651
220 Ga0495588_0000218 3300046674 Bacteria 54328
221 Ga0495657_0000005 3300046675 Bacteria 254860
222 Ga0495599_0006526 3300046678 Bacteria 7038
223 Ga0495647_0000010 3300046681 Bacteria 94696
224 Ga0495647_0000170 3300046681 Bacteria 17220
225 Ga0495658_0000070 3300046683 Bacteria 52450
226 Ga0495658_0047988 3300046683 Bacteria 2407
227 Ga0495613_0000092 3300046689 Bacteria 86976
228 Ga0495613_0000131 3300046689 Bacteria 74262
229 Ga0495613_0029857 3300046689 Bacteria 4052
230 Ga0495624_0000049 3300046690 Bacteria 75485
231 Ga0495624_0000778 3300046690 Bacteria 25141
232 Ga0495624_0003321 3300046690 Bacteria 11977
233 Ga0495670_0002998 3300046691 Bacteria 8330
234 Ga0495649_0002888 3300046694 Bacteria 11909
235 Ga0495600_0001501 3300046809 Bacteria 12943
236 Ga0495604_0000038 3300047317 Bacteria 123703
237 Ga0495604_0000078 3300047317 Bacteria 83632
238 Ga0495674_0000063 3300047319 Bacteria 71737
239 Ga0495676_0000187 3300047321 Bacteria 49042
240 Ga0495676_0004369 3300047321 Bacteria 12917
241 Ga0495676_0005731 3300047321 Bacteria 11388
242 Ga0495680_0000364 3300047322 Bacteria 50773
243 Ga0495680_0007408 3300047322 Bacteria 10065
244 Ga0495680_0010323 3300047322 Bacteria 8334
245 Ga0495675_0000004 3300047444 Bacteria 211049
246 Ga0495675_0087778 3300047444 Bacteria 1954
247 Ga0495686_0081365 3300047472 Bacteria 1978
248 Ga0495602_0000009 3300048088 Bacteria 258991
249 Ga0495602_0002886 3300048088 Bacteria 17610
250 Ga0495602_0072696 3300048088 Bacteria 2931
251 Ga0496100_0000004 3300048903 Bacteria 321778
252 Ga0496100_0000032 3300048903 Bacteria 99877
253 Ga0496101_0000007 3300048904 Bacteria 321778
254 Ga0496101_0000012 3300048904 Bacteria 268127
255 Ga0496102_0000132 3300048905 Bacteria 103176
256 Ga0496102_0027834 3300048905 Bacteria 5048
257 Ga0496103_0000077 3300048906 Bacteria 112223
258 Ga0496104_0000002 3300048907 Bacteria 686017
259 Ga0496104_0000003 3300048907 Bacteria 669219
260 Ga0496104_0011565 3300048907 Bacteria 7907
261 Ga0496105_0000001 3300048908 Bacteria 1328178
262 Ga0496105_0000003 3300048908 Bacteria 713251
263 Ga0496105_0000070 3300048908 Bacteria 80117
264 Ga0496105_0021297 3300048908 Bacteria 5246
265 Ga0496106_0000004 3300048909 Bacteria 279896
266 Ga0496106_0000092 3300048909 Bacteria 70312
267 Ga0496106_0000130 3300048909 Bacteria 57887
268 Ga0496107_0000001 3300048910 Bacteria 321778
269 Ga0496107_0000031 3300048910 Bacteria 100522
270 Ga0496108_0000002 3300048911 Bacteria 700890
271 Ga0496108_0000012 3300048911 Bacteria 258433
272 Ga0496108_0000202 3300048911 Bacteria 55115
273 Ga0496108_0006913 3300048911 Bacteria 9184
274 Ga0496109_0000001 3300048912 Bacteria 700852
275 Ga0496109_0000076 3300048912 Bacteria 104273
276 Ga0496109_0000106 3300048912 Bacteria 86550
277 Ga0496109_0000131 3300048912 Bacteria 76860
278 Ga0496110_0001428 3300048913 Bacteria 17262
279 Ga0496110_0010737 3300048913 Bacteria 7461
280 Ga0496110_0016913 3300048913 Bacteria 6096
281 Ga0496110_0291047 3300048913 Bacteria 1487
282 Ga0496111_0000001 3300048914 Bacteria 194837
283 Ga0496111_0016627 3300048914 Bacteria 5073
284 Ga0496112_0000002 3300048915 Bacteria 782039
285 Ga0496112_0002876 3300048915 Bacteria 14003
286 Ga0496113_0000033 3300048916 Bacteria 59422
287 Ga0496113_0017926 3300048916 Bacteria 4923
288 Ga0496113_0172792 3300048916 Bacteria 1712
289 Ga0496114_0000003 3300048917 Bacteria 630981
290 Ga0496114_0031882 3300048917 Bacteria 4335
291 Ga0496115_0000071 3300048918 Bacteria 91922
292 Ga0496115_0000183 3300048918 Bacteria 58406
293 Ga0496115_0003229 3300048918 Bacteria 11702
294 Ga0496116_0000557 3300048919 Bacteria 49954
295 Ga0496117_0014892 3300048920 Bacteria 6670
296 Ga0496118_0005961 3300048921 Bacteria 13607
297 Ga0496119_0003916 3300048922 Bacteria 15119
298 Ga0496119_0023101 3300048922 Bacteria 4425
299 Ga0496119_0026522 3300048922 Bacteria 4015
300 Ga0496120_0002060 3300048923 Bacteria 21705
301 Ga0496120_0016515 3300048923 Bacteria 4825
302 Ga0496121_0063925 3300048924 Bacteria 3003
303 Ga0496125_0084922 3300048928 Bacteria 2401
304 Ga0496126_0076581 3300048929 Bacteria 2968
305 Ga0501034_0116374 3300049571 Bacteria 2661
306 Ga0501034_0134535 3300049571 Bacteria 2453
307 Ga0501034_0277379 3300049571 Bacteria 1616
308 Ga0501039_0132487 3300049575 Bacteria 1956
309 Ga0501042_0054441 3300049578 Bacteria 2854
310 Ga0501047_0010126 3300049581 Bacteria 8913
311 Ga0501070_0109044 3300049586 Bacteria 2287
312 Ga0501070_0159458 3300049586 Bacteria 1860
313 Ga0501071_0123616 3300049587 Bacteria 1919
314 Ga0501072_0060450 3300049588 Bacteria 2988
315 Ga0501074_0024002 3300049590 Bacteria 4432
316 Ga0501074_0057229 3300049590 Bacteria 2808
317 Ga0501075_0053316 3300049591 Bacteria 3042
318 Ga0501079_0008902 3300049741 Bacteria 7601
319 Ga0501080_0103884 3300049742 Bacteria 2635
320 Ga0501083_0039494 3300049744 Bacteria 3205
321 Ga0501083_0049513 3300049744 Bacteria 2831
322 Ga0501083_0119451 3300049744 Bacteria 1729
323 Ga0501035_0206275 3300049822 Bacteria 1683
324 nmdc:mga06r32_18081_c1 3300050510 Bacteria 6446
325 nmdc:mga08y16_97672_c1 3300050511 Bacteria 3059
326 nmdc:mga0n895_166799_c1 3300050512 Bacteria 2234
327 nmdc:mga0a205_1636_c1 3300050515 Bacteria 19228
328 nmdc:mga0a205_53417_c1 3300050515 Bacteria 3900
329 Ga0495601_0000042 3300053077 Bacteria 77373
330 Ga0495601_0000209 3300053077 Bacteria 31307
331 Ga0495601_0008029 3300053077 Bacteria 6219
332 Ga0495601_0011900 3300053077 Bacteria 5215
333 Ga0495601_0149061 3300053077 Bacteria 1527
334 Ga0495612_0004325 3300053078 Bacteria 5891
335 Ga0495612_0008891 3300053078 Bacteria 4070
336 Ga0495655_0000009 3300053083 Bacteria 150662
337 Ga0495655_0001940 3300053083 Bacteria 3225
338 Ga0495595_0000005 3300053084 Bacteria 258660
339 Ga0495595_0000362 3300053084 Bacteria 17220
340 Ga0495619_0000040 3300053085 Bacteria 118238
341 Ga0495619_0000060 3300053085 Bacteria 89377
342 Ga0495619_0000126 3300053085 Bacteria 56169
343 Ga0495619_0000744 3300053085 Bacteria 21210
344 Ga0495619_0001967 3300053085 Bacteria 13702
345 Ga0495619_0005900 3300053085 Bacteria 7761
346 Ga0500566_0004741 3300053094 Bacteria 8102
347 Ga0500641_0010470 3300053096 Bacteria 3352
348 Ga0500595_018561 3300053119 Bacteria 2541
349 Ga0500628_000078 3300053129 Bacteria 24490
350 Ga0105243_10043385
351 JGI24740J21852_10006896
352 JGI24748J21848_1001111
353 JGI24034J26672_10000195
354 JGI24742J22300_10002582
355 JGI25404J52841_10000594
356 Ga0070683_100000226
357 Ga0070683_100005302
358 Ga0070683_100092674
359 Ga0070683_100103034
360 Ga0070670_100058203
361 Ga0070677_10000007
362 Ga0070666_10005160
363 Ga0070682_100000038
364 Ga0070682_100000072
365 Ga0068868_100000314
366 Ga0068868_100030645
367 Ga0070691_10000052
368 Ga0070691_10007204
369 Ga0070661_100000116
370 Ga0070668_100096231
371 Ga0070675_100000008
372 Ga0070688_100000066
373 Ga0070688_100003641
374 Ga0070659_100012851
375 Ga0070667_100042243
376 Ga0070713_100000061
377 Ga0070711_100050199
378 Ga0070663_100009024
379 Ga0070678_100022184
380 Ga0070662_100000079
381 Ga0070681_10031996
382 Ga0068867_100000246
383 Ga0068867_100071772
384 Ga0070685_10000165
385 Ga0070685_10000230
386 Ga0070679_100000077
387 Ga0070679_100002291
388 Ga0070684_100059157
389 Ga0070684_100090535
390 Ga0070684_100123341
391 Ga0068853_100001022
392 Ga0070672_100000018
393 Ga0070693_100065495
394 Ga0070665_100000306
395 Ga0070664_100052635
396 Ga0068854_100000044
397 Ga0068854_100034195
398 Ga0068856_100000654
399 Ga0068852_100000050
400 Ga0068851_10000669
401 Ga0068863_100000039
402 Ga0068863_100008208
403 Ga0068858_100000178
404 Ga0068858_100000454
405 Ga0068860_100021006
406 Ga0081455_10006555
407 Ga0081455_10019025
408 Ga0081455_10022633
409 Ga0081455_10065660
410 Ga0081455_10100003
411 Ga0081540_1000044
412 Ga0081540_1006546
413 Ga0081539_10007734
414 Ga0070715_10000003
415 Ga0070712_100001770
416 Ga0068871_100103800
417 Ga0075433_10001949
418 Ga0075433_10076863
419 Ga0075434_100211647
420 Ga0068865_100000019
421 Ga0075436_100042536
422 Ga0105240_10242940
423 Ga0111539_10058744
424 Ga0111539_10067223
425 Ga0105245_10000012
426 Ga0105245_10000049
427 Ga0105245_10000508
428 Ga0105247_10000109
429 Ga0105247_10045489
430 Ga0105242_10013472
431 Ga0105248_10000126
432 Ga0105237_10194933
433 Ga0105238_10000014
434 Ga0105249_10000039
435 Ga0105249_10082410
436 Ga0105239_10342223
437 Ga0157371_10004303
438 Ga0157370_10020919
439 Ga0157369_10000135
440 Ga0157374_10147305
441 Ga0157378_10000598
442 Ga0157378_10017219
443 Ga0157378_10067081
444 Ga0157372_10001053
445 Ga0157375_10003759
446 Ga0157375_10206077
447 Ga0163163_10193105
448 Ga0157380_10000009
449 Ga0157380_10000277
450 Ga0157376_10086175
451 Ga0163161_10000013
452 Ga0207656_10003169
453 Ga0207682_10000007
454 Ga0207692_10051550
455 Ga0207710_10000408
456 Ga0207680_10001305
457 Ga0207680_10004991
458 Ga0207685_10000003
459 Ga0207707_10013686
460 Ga0207671_10064865
461 Ga0207693_10006644
462 Ga0207663_10003362
463 Ga0207649_10000005
464 Ga0207652_10000138
465 Ga0207652_10001427
466 Ga0207694_10000008
467 Ga0207659_10000014
468 Ga0207687_10000011
469 Ga0207687_10000012
470 Ga0207687_10000750
471 Ga0207700_10000016
472 Ga0207690_10007936
473 Ga0207706_10000302
474 Ga0207686_10000029
475 Ga0207709_10007236
476 Ga0207704_10000009
477 Ga0207691_10000121
478 Ga0207711_10000024
479 Ga0207689_10035656
480 Ga0207661_10000068
481 Ga0207661_10003655
482 Ga0207661_10018762
483 Ga0207661_10063490
484 Ga0207679_10005625
485 Ga0207712_10000003
486 Ga0207668_10022699
487 Ga0207640_10000517
488 Ga0207640_10004533
489 Ga0207677_10000218
490 Ga0207677_10018817
491 Ga0207703_10000381
492 Ga0207703_10000451
493 Ga0207639_10002102
494 Ga0207678_10000872
495 Ga0207678_10028413
496 Ga0207702_10000099
497 Ga0207702_10001991
498 Ga0207641_10000065
499 Ga0207641_10001058
500 Ga0207648_10000783
501 Ga0207698_10000009
502 Ga0268266_10000023
503 Ga0268266_10000342
504 Ga0268264_10010113
505 Ga0265337_1000074
506 Ga0265326_10000035
507 Ga0265326_10020417
508 Ga0265319_1000091
509 Ga0265322_10000009
510 Ga0265336_10005968
511 Ga0265338_10000752
512 Ga0265324_10000168
513 Ga0265324_10019055
514 Ga0307511_10091834
515 Ga0265328_10004875
516 Ga0265320_10000024
517 Ga0265325_10008658
518 Ga0265331_10017484
519 Ga0265327_10000227
520 Ga0265316_10099498
521 Ga0265314_10000647
522 Ga0395898_0055248
523 Ga0395905_0150631
524 Ga0451853_3365981
525 Ga0466963_0000025
526 Ga0466957_0006020
527 Ga0466958_0027822
528 Ga0466967_0000005
529 Ga0466967_0258234
530 Ga0495592_0002025
531 Ga0495603_0000054
532 Ga0495603_0000431
533 Ga0495629_0000377
534 Ga0495629_0050162
535 Ga0495629_0067237
536 Ga0495629_0092221
537 Ga0495638_0030271
538 Ga0495641_0000095
539 Ga0495641_0020286
540 Ga0495653_0040546
541 Ga0495653_0044927
542 Ga0495653_0103711
543 Ga0495582_0000082
544 Ga0495662_0005370
545 Ga0495594_0000191
546 Ga0495606_0000294
547 Ga0495608_0000010
548 Ga0495608_0004501
549 Ga0495618_0000097
550 Ga0495620_0000158
551 Ga0495628_0000048
552 Ga0495630_0000011
553 Ga0495630_0000082
554 Ga0495644_0004418
555 Ga0495652_0000003
556 Ga0495652_0022568
557 Ga0495640_0020617
558 Ga0495586_0000234
559 Ga0495645_0043864
560 Ga0495622_0000925
561 Ga0495667_0000053
562 Ga0495634_0000616
563 Ga0495634_0002295
564 Ga0495634_0022292
565 Ga0495625_0001012
566 Ga0495625_0164347
567 Ga0495635_0000006
568 Ga0495635_0058527
569 Ga0495588_0000218
570 Ga0495657_0000005
571 Ga0495599_0006526
572 Ga0495647_0000010
573 Ga0495647_0000170
574 Ga0495658_0000070
575 Ga0495658_0047988
576 Ga0495613_0000092
577 Ga0495613_0000131
578 Ga0495613_0029857
579 Ga0495624_0000049
580 Ga0495624_0000778
581 Ga0495624_0003321
582 Ga0495670_0002998
583 Ga0495649_0002888
584 Ga0495600_0001501
585 Ga0495604_0000038
586 Ga0495604_0000078
587 Ga0495674_0000063
588 Ga0495676_0000187
589 Ga0495676_0004369
590 Ga0495676_0005731
591 Ga0495680_0000364
592 Ga0495680_0007408
593 Ga0495680_0010323
594 Ga0495675_0000004
595 Ga0495675_0087778
596 Ga0495686_0081365
597 Ga0495602_0000009
598 Ga0495602_0002886
599 Ga0495602_0072696
600 Ga0496100_0000004
601 Ga0496100_0000032
602 Ga0496101_0000007
603 Ga0496101_0000012
604 Ga0496102_0000132
605 Ga0496102_0027834
606 Ga0496103_0000077
607 Ga0496104_0000002
608 Ga0496104_0000003
609 Ga0496104_0011565
610 Ga0496105_0000001
611 Ga0496105_0000003
612 Ga0496105_0000070
613 Ga0496105_0021297
614 Ga0496106_0000004
615 Ga0496106_0000092
616 Ga0496106_0000130
617 Ga0496107_0000001
618 Ga0496107_0000031
619 Ga0496108_0000002
620 Ga0496108_0000012
621 Ga0496108_0000202
622 Ga0496108_0006913
623 Ga0496109_0000001
624 Ga0496109_0000076
625 Ga0496109_0000106
626 Ga0496109_0000131
627 Ga0496110_0001428
628 Ga0496110_0010737
629 Ga0496110_0016913
630 Ga0496110_0291047
631 Ga0496111_0000001
632 Ga0496111_0016627
633 Ga0496112_0000002
634 Ga0496112_0002876
635 Ga0496113_0000033
636 Ga0496113_0017926
637 Ga0496113_0172792
638 Ga0496114_0000003
639 Ga0496114_0031882
640 Ga0496115_0000071
641 Ga0496115_0000183
642 Ga0496115_0003229
643 Ga0496116_0000557
644 Ga0496117_0014892
645 Ga0496118_0005961
646 Ga0496119_0003916
647 Ga0496119_0023101
648 Ga0496119_0026522
649 Ga0496120_0002060
650 Ga0496120_0016515
651 Ga0496121_0063925
652 Ga0496125_0084922
653 Ga0496126_0076581
654 Ga0501034_0116374
655 Ga0501034_0134535
656 Ga0501034_0277379
657 Ga0501039_0132487
658 Ga0501042_0054441
659 Ga0501047_0010126
660 Ga0501070_0109044
661 Ga0501070_0159458
662 Ga0501071_0123616
663 Ga0501072_0060450
664 Ga0501074_0024002
665 Ga0501074_0057229
666 Ga0501075_0053316
667 Ga0501079_0008902
668 Ga0501080_0103884
669 Ga0501083_0039494
670 Ga0501083_0049513
671 Ga0501083_0119451
672 Ga0501035_0206275
673 nmdc:mga06r32_18081_c1
674 nmdc:mga08y16_97672_c1
675 nmdc:mga0n895_166799_c1
676 nmdc:mga0a205_1636_c1
677 nmdc:mga0a205_53417_c1
678 Ga0495601_0000042
679 Ga0495601_0000209
680 Ga0495601_0008029
681 Ga0495601_0011900
682 Ga0495601_0149061
683 Ga0495612_0004325
684 Ga0495612_0008891
685 Ga0495655_0000009
686 Ga0495655_0001940
687 Ga0495595_0000005
688 Ga0495595_0000362
689 Ga0495619_0000040
690 Ga0495619_0000060
691 Ga0495619_0000126
692 Ga0495619_0000744
693 Ga0495619_0001967
694 Ga0495619_0005900
695 Ga0500566_0004741
696 Ga0500641_0010470
697 Ga0500595_018561
698 Ga0500628_000078

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01654

Cyt_bd_oxida_I

Cytochrome bd terminal oxidase subunit I

18

431

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ir6-assembly1.cif.gz_A the structure of bd oxidase from geobacillus thermodenitrificans 0.8343 15 424
7ose-assembly1.cif.gz_D cytochrome bd-ii type oxidase with bound aurachin d 0.8127 15 423
7nkz-assembly1.cif.gz_A cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.8028 15 419
5ir6-assembly1.cif.gz_A the structure of bd oxidase from geobacillus thermodenitrificans 0.793 15 424
7ose-assembly1.cif.gz_D cytochrome bd-ii type oxidase with bound aurachin d 0.7488 15 423
ID Description Score Start End Superfamily
5jdlA01 Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region 0.5323 175 244 6.10.280.80
af_A0A1D6MBU0_33_185_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.5099 185 390 1.20.120.520
5jdlA01 Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region 0.4949 175 244 6.10.280.80
af_A4I2W7_8_252_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4843 119 376 1.20.1070.10
af_F5GU36_11_158_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.474 141 248 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A853ALQ1-F1-model_v4 Cytochrome bd-type quinol oxidase subunit 1 0.9455 121 322 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A853ALQ1-F1-model_v4 Cytochrome bd-type quinol oxidase subunit 1 0.9366 121 322 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-T0ZCW9-F1-model_v4 Cytochrome d ubiquinol oxidase, subunit I 0.9337 114 295 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A1Q7E7T8-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.9291 135 329 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A3P8IZF2-F1-model_v4 Cytochrome bd-II oxidase subunit 1 (EC 1.10.3.-) 0.9204 166 363 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069

Map