F417883
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 349 | 225 | 698 | 447 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_10043385|Ga0105243_100433852 |
| Length | 471 |
| Sequence | MPLLDLLPLAASESNLLAAREQMAFTLAFHIVLSCIGVALPATMLVANYVGLKKGDEAAMELARRWSKAIAVTFAVGAVTGTVLSFEFGLLWPEFMDRFGAAFGVAFXXEIAVYIYGWKRLSPWAHFWSGVPMVITGIGGAFSVVAANAWMNQPQGFTLNGAGEVVDVEPLKVLFNPATGYEVAHMILAAYMVVGFLVASIYAVGMLKGRRDRLHKLGLVIPLTIACIATPVQLFVGDTAARGVADHQPAKFAAMECIYETGDNQTEYLGGVCTGDGVKGAIGIPGLDSFLVGWSTDTRVTGLNDIPEDEQPPAKTLLHLSFDAMVGIGSALMGLAIWFGFVWWKRRDIPQTPWFLRAVSVSGGAAIVALWCGWIVTEVGRQPWIVQGYMRTSEAVTEAEGIWFTFALVLLLYTGLGTGAILVLRAMSRRWRDAGLDLEGDTPYAPPAPLSSTGRKPDYVSGNRPVDGGGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 113 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 114 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 115 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 116 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 117 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 119 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 120 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 121 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 122 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 123 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 125 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 126 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 128 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 129 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 130 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 131 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 132 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 133 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 134 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 179 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 180 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 181 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 182 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 183 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 184 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 187 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 188 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 189 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 190 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 191 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 192 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 193 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 194 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 195 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 196 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 197 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 198 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 199 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 200 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 223 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 224 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 225 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.15 |
| Nodule | 0 |
| Rhizoplane | 12.32 |
| Rhizosphere | 82.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105243_10043385 | 3300009148 | Bacteria | 3525 |
| 2 | JGI24740J21852_10006896 | 3300001979 | Bacteria | 4663 |
| 3 | JGI24748J21848_1001111 | 3300002074 | Bacteria | 2921 |
| 4 | JGI24034J26672_10000195 | 3300002239 | Bacteria | 8103 |
| 5 | JGI24742J22300_10002582 | 3300002244 | Bacteria | 2898 |
| 6 | JGI25404J52841_10000594 | 3300003659 | Bacteria | 5393 |
| 7 | Ga0070683_100000226 | 3300005329 | Bacteria | 38469 |
| 8 | Ga0070683_100005302 | 3300005329 | Bacteria | 10742 |
| 9 | Ga0070683_100092674 | 3300005329 | Bacteria | 2838 |
| 10 | Ga0070683_100103034 | 3300005329 | Bacteria | 2688 |
| 11 | Ga0070670_100058203 | 3300005331 | Bacteria | 3318 |
| 12 | Ga0070677_10000007 | 3300005333 | Bacteria | 74721 |
| 13 | Ga0070666_10005160 | 3300005335 | Bacteria | 7995 |
| 14 | Ga0070682_100000038 | 3300005337 | Bacteria | 145670 |
| 15 | Ga0070682_100000072 | 3300005337 | Bacteria | 93808 |
| 16 | Ga0068868_100000314 | 3300005338 | Bacteria | 32538 |
| 17 | Ga0068868_100030645 | 3300005338 | Bacteria | 4125 |
| 18 | Ga0070691_10000052 | 3300005341 | Bacteria | 32264 |
| 19 | Ga0070691_10007204 | 3300005341 | Bacteria | 5092 |
| 20 | Ga0070661_100000116 | 3300005344 | Bacteria | 66712 |
| 21 | Ga0070668_100096231 | 3300005347 | Bacteria | 2340 |
| 22 | Ga0070675_100000008 | 3300005354 | Bacteria | 250004 |
| 23 | Ga0070688_100000066 | 3300005365 | Bacteria | 52354 |
| 24 | Ga0070688_100003641 | 3300005365 | Bacteria | 7953 |
| 25 | Ga0070659_100012851 | 3300005366 | Bacteria | 6221 |
| 26 | Ga0070667_100042243 | 3300005367 | Bacteria | 3825 |
| 27 | Ga0070713_100000061 | 3300005436 | Bacteria | 68662 |
| 28 | Ga0070711_100050199 | 3300005439 | Bacteria | 2859 |
| 29 | Ga0070663_100009024 | 3300005455 | Bacteria | 6159 |
| 30 | Ga0070678_100022184 | 3300005456 | Bacteria | 4201 |
| 31 | Ga0070662_100000079 | 3300005457 | Bacteria | 53583 |
| 32 | Ga0070681_10031996 | 3300005458 | Bacteria | 5281 |
| 33 | Ga0068867_100000246 | 3300005459 | Bacteria | 35737 |
| 34 | Ga0068867_100071772 | 3300005459 | Bacteria | 2590 |
| 35 | Ga0070685_10000165 | 3300005466 | Bacteria | 43529 |
| 36 | Ga0070685_10000230 | 3300005466 | Bacteria | 36879 |
| 37 | Ga0070679_100000077 | 3300005530 | Bacteria | 74222 |
| 38 | Ga0070679_100002291 | 3300005530 | Bacteria | 17304 |
| 39 | Ga0070684_100059157 | 3300005535 | Bacteria | 3350 |
| 40 | Ga0070684_100090535 | 3300005535 | Bacteria | 2721 |
| 41 | Ga0070684_100123341 | 3300005535 | Bacteria | 2332 |
| 42 | Ga0068853_100001022 | 3300005539 | Bacteria | 19725 |
| 43 | Ga0070672_100000018 | 3300005543 | Bacteria | 70205 |
| 44 | Ga0070693_100065495 | 3300005547 | Bacteria | 2124 |
| 45 | Ga0070665_100000306 | 3300005548 | Bacteria | 76666 |
| 46 | Ga0070664_100052635 | 3300005564 | Bacteria | 3448 |
| 47 | Ga0068854_100000044 | 3300005578 | Bacteria | 91882 |
| 48 | Ga0068854_100034195 | 3300005578 | Bacteria | 3549 |
| 49 | Ga0068856_100000654 | 3300005614 | Bacteria | 37552 |
| 50 | Ga0068852_100000050 | 3300005616 | Bacteria | 84306 |
| 51 | Ga0068851_10000669 | 3300005834 | Bacteria | 14656 |
| 52 | Ga0068863_100000039 | 3300005841 | Bacteria | 161450 |
| 53 | Ga0068863_100008208 | 3300005841 | Bacteria | 10204 |
| 54 | Ga0068858_100000178 | 3300005842 | Bacteria | 67760 |
| 55 | Ga0068858_100000454 | 3300005842 | Bacteria | 42918 |
| 56 | Ga0068860_100021006 | 3300005843 | Bacteria | 6326 |
| 57 | Ga0081455_10006555 | 3300005937 | Bacteria | 12458 |
| 58 | Ga0081455_10019025 | 3300005937 | Bacteria | 6513 |
| 59 | Ga0081455_10022633 | 3300005937 | Bacteria | 5868 |
| 60 | Ga0081455_10065660 | 3300005937 | Bacteria | 3034 |
| 61 | Ga0081455_10100003 | 3300005937 | Bacteria | 2331 |
| 62 | Ga0081540_1000044 | 3300005983 | Bacteria | 134269 |
| 63 | Ga0081540_1006546 | 3300005983 | Bacteria | 8462 |
| 64 | Ga0081539_10007734 | 3300005985 | Bacteria | 9635 |
| 65 | Ga0070715_10000003 | 3300006163 | Bacteria | 345282 |
| 66 | Ga0070712_100001770 | 3300006175 | Bacteria | 13223 |
| 67 | Ga0068871_100103800 | 3300006358 | Bacteria | 2384 |
| 68 | Ga0075433_10001949 | 3300006852 | Bacteria | 15514 |
| 69 | Ga0075433_10076863 | 3300006852 | Bacteria | 2941 |
| 70 | Ga0075434_100211647 | 3300006871 | Bacteria | 1959 |
| 71 | Ga0068865_100000019 | 3300006881 | Bacteria | 105996 |
| 72 | Ga0075436_100042536 | 3300006914 | Bacteria | 3133 |
| 73 | Ga0105240_10242940 | 3300009093 | Bacteria | 2086 |
| 74 | Ga0111539_10058744 | 3300009094 | Bacteria | 4562 |
| 75 | Ga0111539_10067223 | 3300009094 | Bacteria | 4232 |
| 76 | Ga0105245_10000012 | 3300009098 | Bacteria | 267151 |
| 77 | Ga0105245_10000049 | 3300009098 | Bacteria | 128277 |
| 78 | Ga0105245_10000508 | 3300009098 | Bacteria | 35724 |
| 79 | Ga0105247_10000109 | 3300009101 | Bacteria | 84490 |
| 80 | Ga0105247_10045489 | 3300009101 | Bacteria | 2693 |
| 81 | Ga0105242_10013472 | 3300009176 | Bacteria | 6322 |
| 82 | Ga0105248_10000126 | 3300009177 | Bacteria | 88461 |
| 83 | Ga0105237_10194933 | 3300009545 | Bacteria | 2025 |
| 84 | Ga0105238_10000014 | 3300009551 | Bacteria | 241954 |
| 85 | Ga0105249_10000039 | 3300009553 | Bacteria | 196325 |
| 86 | Ga0105249_10082410 | 3300009553 | Bacteria | 2993 |
| 87 | Ga0105239_10342223 | 3300010375 | Bacteria | 1688 |
| 88 | Ga0157371_10004303 | 3300013102 | Bacteria | 12492 |
| 89 | Ga0157370_10020919 | 3300013104 | Bacteria | 6527 |
| 90 | Ga0157369_10000135 | 3300013105 | Bacteria | 105364 |
| 91 | Ga0157374_10147305 | 3300013296 | Bacteria | 2287 |
| 92 | Ga0157378_10000598 | 3300013297 | Bacteria | 33812 |
| 93 | Ga0157378_10017219 | 3300013297 | Bacteria | 6337 |
| 94 | Ga0157378_10067081 | 3300013297 | Bacteria | 3214 |
| 95 | Ga0157372_10001053 | 3300013307 | Bacteria | 30139 |
| 96 | Ga0157375_10003759 | 3300013308 | Bacteria | 13161 |
| 97 | Ga0157375_10206077 | 3300013308 | Bacteria | 2123 |
| 98 | Ga0163163_10193105 | 3300014325 | Bacteria | 2084 |
| 99 | Ga0157380_10000009 | 3300014326 | Bacteria | 142155 |
| 100 | Ga0157380_10000277 | 3300014326 | Bacteria | 30723 |
| 101 | Ga0157376_10086175 | 3300014969 | Bacteria | 2707 |
| 102 | Ga0163161_10000013 | 3300017792 | Bacteria | 258747 |
| 103 | Ga0207656_10003169 | 3300025321 | Bacteria | 5623 |
| 104 | Ga0207682_10000007 | 3300025893 | Bacteria | 88967 |
| 105 | Ga0207692_10051550 | 3300025898 | Bacteria | 2087 |
| 106 | Ga0207710_10000408 | 3300025900 | Bacteria | 28571 |
| 107 | Ga0207680_10001305 | 3300025903 | Bacteria | 11789 |
| 108 | Ga0207680_10004991 | 3300025903 | Bacteria | 6321 |
| 109 | Ga0207685_10000003 | 3300025905 | Bacteria | 344527 |
| 110 | Ga0207707_10013686 | 3300025912 | Bacteria | 7075 |
| 111 | Ga0207671_10064865 | 3300025914 | Bacteria | 2715 |
| 112 | Ga0207693_10006644 | 3300025915 | Bacteria | 9556 |
| 113 | Ga0207663_10003362 | 3300025916 | Bacteria | 7817 |
| 114 | Ga0207649_10000005 | 3300025920 | Bacteria | 356179 |
| 115 | Ga0207652_10000138 | 3300025921 | Bacteria | 77564 |
| 116 | Ga0207652_10001427 | 3300025921 | Bacteria | 21179 |
| 117 | Ga0207694_10000008 | 3300025924 | Bacteria | 484902 |
| 118 | Ga0207659_10000014 | 3300025926 | Bacteria | 168481 |
| 119 | Ga0207687_10000011 | 3300025927 | Bacteria | 388349 |
| 120 | Ga0207687_10000012 | 3300025927 | Bacteria | 370729 |
| 121 | Ga0207687_10000750 | 3300025927 | Bacteria | 21930 |
| 122 | Ga0207700_10000016 | 3300025928 | Bacteria | 202434 |
| 123 | Ga0207690_10007936 | 3300025932 | Bacteria | 6301 |
| 124 | Ga0207706_10000302 | 3300025933 | Bacteria | 53541 |
| 125 | Ga0207686_10000029 | 3300025934 | Bacteria | 160239 |
| 126 | Ga0207709_10007236 | 3300025935 | Bacteria | 6189 |
| 127 | Ga0207704_10000009 | 3300025938 | Bacteria | 198266 |
| 128 | Ga0207691_10000121 | 3300025940 | Bacteria | 70558 |
| 129 | Ga0207711_10000024 | 3300025941 | Bacteria | 293596 |
| 130 | Ga0207689_10035656 | 3300025942 | Bacteria | 4131 |
| 131 | Ga0207661_10000068 | 3300025944 | Bacteria | 70953 |
| 132 | Ga0207661_10003655 | 3300025944 | Bacteria | 10716 |
| 133 | Ga0207661_10018762 | 3300025944 | Bacteria | 5145 |
| 134 | Ga0207661_10063490 | 3300025944 | Bacteria | 2991 |
| 135 | Ga0207679_10005625 | 3300025945 | Bacteria | 7862 |
| 136 | Ga0207712_10000003 | 3300025961 | Bacteria | 615314 |
| 137 | Ga0207668_10022699 | 3300025972 | Bacteria | 4022 |
| 138 | Ga0207640_10000517 | 3300025981 | Bacteria | 23263 |
| 139 | Ga0207640_10004533 | 3300025981 | Bacteria | 7541 |
| 140 | Ga0207677_10000218 | 3300026023 | Bacteria | 45820 |
| 141 | Ga0207677_10018817 | 3300026023 | Bacteria | 4155 |
| 142 | Ga0207703_10000381 | 3300026035 | Bacteria | 47426 |
| 143 | Ga0207703_10000451 | 3300026035 | Bacteria | 43264 |
| 144 | Ga0207639_10002102 | 3300026041 | Bacteria | 13411 |
| 145 | Ga0207678_10000872 | 3300026067 | Bacteria | 27690 |
| 146 | Ga0207678_10028413 | 3300026067 | Bacteria | 4883 |
| 147 | Ga0207702_10000099 | 3300026078 | Bacteria | 100461 |
| 148 | Ga0207702_10001991 | 3300026078 | Bacteria | 19831 |
| 149 | Ga0207641_10000065 | 3300026088 | Bacteria | 156066 |
| 150 | Ga0207641_10001058 | 3300026088 | Bacteria | 27805 |
| 151 | Ga0207648_10000783 | 3300026089 | Bacteria | 35821 |
| 152 | Ga0207698_10000009 | 3300026142 | Bacteria | 281300 |
| 153 | Ga0268266_10000023 | 3300028379 | Bacteria | 501899 |
| 154 | Ga0268266_10000342 | 3300028379 | Bacteria | 72894 |
| 155 | Ga0268264_10010113 | 3300028381 | Bacteria | 7807 |
| 156 | Ga0265337_1000074 | 3300028556 | Bacteria | 46897 |
| 157 | Ga0265326_10000035 | 3300028558 | Bacteria | 89561 |
| 158 | Ga0265326_10020417 | 3300028558 | Bacteria | 1899 |
| 159 | Ga0265319_1000091 | 3300028563 | Bacteria | 70394 |
| 160 | Ga0265322_10000009 | 3300028654 | Bacteria | 170768 |
| 161 | Ga0265336_10005968 | 3300028666 | Bacteria | 4441 |
| 162 | Ga0265338_10000752 | 3300028800 | Bacteria | 55238 |
| 163 | Ga0265324_10000168 | 3300029957 | Bacteria | 50622 |
| 164 | Ga0265324_10019055 | 3300029957 | Bacteria | 2474 |
| 165 | Ga0307511_10091834 | 3300030521 | Bacteria | 2052 |
| 166 | Ga0265328_10004875 | 3300031239 | Bacteria | 5780 |
| 167 | Ga0265320_10000024 | 3300031240 | Bacteria | 170768 |
| 168 | Ga0265325_10008658 | 3300031241 | Bacteria | 5991 |
| 169 | Ga0265331_10017484 | 3300031250 | Bacteria | 3737 |
| 170 | Ga0265327_10000227 | 3300031251 | Bacteria | 114777 |
| 171 | Ga0265316_10099498 | 3300031344 | Bacteria | 2211 |
| 172 | Ga0265314_10000647 | 3300031711 | Bacteria | 42707 |
| 173 | Ga0395898_0055248 | 3300037466 | Bacteria | 3873 |
| 174 | Ga0395905_0150631 | 3300037471 | Bacteria | 2189 |
| 175 | Ga0451853_3365981 | 3300041512 | Bacteria | 5530 |
| 176 | Ga0466963_0000025 | 3300044694 | Bacteria | 51171 |
| 177 | Ga0466957_0006020 | 3300044842 | Bacteria | 6843 |
| 178 | Ga0466958_0027822 | 3300045836 | Bacteria | 3347 |
| 179 | Ga0466967_0000005 | 3300045976 | Bacteria | 149543 |
| 180 | Ga0466967_0258234 | 3300045976 | Bacteria | 1666 |
| 181 | Ga0495592_0002025 | 3300046454 | Bacteria | 14286 |
| 182 | Ga0495603_0000054 | 3300046455 | Bacteria | 49027 |
| 183 | Ga0495603_0000431 | 3300046455 | Bacteria | 23265 |
| 184 | Ga0495629_0000377 | 3300046459 | Bacteria | 37247 |
| 185 | Ga0495629_0050162 | 3300046459 | Bacteria | 2923 |
| 186 | Ga0495629_0067237 | 3300046459 | Bacteria | 2501 |
| 187 | Ga0495629_0092221 | 3300046459 | Bacteria | 2114 |
| 188 | Ga0495638_0030271 | 3300046460 | Bacteria | 3486 |
| 189 | Ga0495641_0000095 | 3300046461 | Bacteria | 60441 |
| 190 | Ga0495641_0020286 | 3300046461 | Bacteria | 3374 |
| 191 | Ga0495653_0040546 | 3300046463 | Bacteria | 3639 |
| 192 | Ga0495653_0044927 | 3300046463 | Bacteria | 3427 |
| 193 | Ga0495653_0103711 | 3300046463 | Bacteria | 2056 |
| 194 | Ga0495582_0000082 | 3300046473 | Bacteria | 48118 |
| 195 | Ga0495662_0005370 | 3300046476 | Bacteria | 6416 |
| 196 | Ga0495594_0000191 | 3300046499 | Bacteria | 29900 |
| 197 | Ga0495606_0000294 | 3300046507 | Bacteria | 85998 |
| 198 | Ga0495608_0000010 | 3300046511 | Bacteria | 258660 |
| 199 | Ga0495608_0004501 | 3300046511 | Bacteria | 9955 |
| 200 | Ga0495618_0000097 | 3300046514 | Bacteria | 63474 |
| 201 | Ga0495620_0000158 | 3300046515 | Bacteria | 54704 |
| 202 | Ga0495628_0000048 | 3300046516 | Bacteria | 96944 |
| 203 | Ga0495630_0000011 | 3300046517 | Bacteria | 232063 |
| 204 | Ga0495630_0000082 | 3300046517 | Bacteria | 75280 |
| 205 | Ga0495644_0004418 | 3300046523 | Bacteria | 5522 |
| 206 | Ga0495652_0000003 | 3300046529 | Bacteria | 597094 |
| 207 | Ga0495652_0022568 | 3300046529 | Bacteria | 5584 |
| 208 | Ga0495640_0020617 | 3300046533 | Bacteria | 4849 |
| 209 | Ga0495586_0000234 | 3300046535 | Bacteria | 36813 |
| 210 | Ga0495645_0043864 | 3300046543 | Bacteria | 3262 |
| 211 | Ga0495622_0000925 | 3300046557 | Bacteria | 15862 |
| 212 | Ga0495667_0000053 | 3300046559 | Bacteria | 105370 |
| 213 | Ga0495634_0000616 | 3300046642 | Bacteria | 34537 |
| 214 | Ga0495634_0002295 | 3300046642 | Bacteria | 15998 |
| 215 | Ga0495634_0022292 | 3300046642 | Bacteria | 4463 |
| 216 | Ga0495625_0001012 | 3300046660 | Bacteria | 37072 |
| 217 | Ga0495625_0164347 | 3300046660 | Bacteria | 1485 |
| 218 | Ga0495635_0000006 | 3300046663 | Bacteria | 301820 |
| 219 | Ga0495635_0058527 | 3300046663 | Bacteria | 2651 |
| 220 | Ga0495588_0000218 | 3300046674 | Bacteria | 54328 |
| 221 | Ga0495657_0000005 | 3300046675 | Bacteria | 254860 |
| 222 | Ga0495599_0006526 | 3300046678 | Bacteria | 7038 |
| 223 | Ga0495647_0000010 | 3300046681 | Bacteria | 94696 |
| 224 | Ga0495647_0000170 | 3300046681 | Bacteria | 17220 |
| 225 | Ga0495658_0000070 | 3300046683 | Bacteria | 52450 |
| 226 | Ga0495658_0047988 | 3300046683 | Bacteria | 2407 |
| 227 | Ga0495613_0000092 | 3300046689 | Bacteria | 86976 |
| 228 | Ga0495613_0000131 | 3300046689 | Bacteria | 74262 |
| 229 | Ga0495613_0029857 | 3300046689 | Bacteria | 4052 |
| 230 | Ga0495624_0000049 | 3300046690 | Bacteria | 75485 |
| 231 | Ga0495624_0000778 | 3300046690 | Bacteria | 25141 |
| 232 | Ga0495624_0003321 | 3300046690 | Bacteria | 11977 |
| 233 | Ga0495670_0002998 | 3300046691 | Bacteria | 8330 |
| 234 | Ga0495649_0002888 | 3300046694 | Bacteria | 11909 |
| 235 | Ga0495600_0001501 | 3300046809 | Bacteria | 12943 |
| 236 | Ga0495604_0000038 | 3300047317 | Bacteria | 123703 |
| 237 | Ga0495604_0000078 | 3300047317 | Bacteria | 83632 |
| 238 | Ga0495674_0000063 | 3300047319 | Bacteria | 71737 |
| 239 | Ga0495676_0000187 | 3300047321 | Bacteria | 49042 |
| 240 | Ga0495676_0004369 | 3300047321 | Bacteria | 12917 |
| 241 | Ga0495676_0005731 | 3300047321 | Bacteria | 11388 |
| 242 | Ga0495680_0000364 | 3300047322 | Bacteria | 50773 |
| 243 | Ga0495680_0007408 | 3300047322 | Bacteria | 10065 |
| 244 | Ga0495680_0010323 | 3300047322 | Bacteria | 8334 |
| 245 | Ga0495675_0000004 | 3300047444 | Bacteria | 211049 |
| 246 | Ga0495675_0087778 | 3300047444 | Bacteria | 1954 |
| 247 | Ga0495686_0081365 | 3300047472 | Bacteria | 1978 |
| 248 | Ga0495602_0000009 | 3300048088 | Bacteria | 258991 |
| 249 | Ga0495602_0002886 | 3300048088 | Bacteria | 17610 |
| 250 | Ga0495602_0072696 | 3300048088 | Bacteria | 2931 |
| 251 | Ga0496100_0000004 | 3300048903 | Bacteria | 321778 |
| 252 | Ga0496100_0000032 | 3300048903 | Bacteria | 99877 |
| 253 | Ga0496101_0000007 | 3300048904 | Bacteria | 321778 |
| 254 | Ga0496101_0000012 | 3300048904 | Bacteria | 268127 |
| 255 | Ga0496102_0000132 | 3300048905 | Bacteria | 103176 |
| 256 | Ga0496102_0027834 | 3300048905 | Bacteria | 5048 |
| 257 | Ga0496103_0000077 | 3300048906 | Bacteria | 112223 |
| 258 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 259 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 260 | Ga0496104_0011565 | 3300048907 | Bacteria | 7907 |
| 261 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 262 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 263 | Ga0496105_0000070 | 3300048908 | Bacteria | 80117 |
| 264 | Ga0496105_0021297 | 3300048908 | Bacteria | 5246 |
| 265 | Ga0496106_0000004 | 3300048909 | Bacteria | 279896 |
| 266 | Ga0496106_0000092 | 3300048909 | Bacteria | 70312 |
| 267 | Ga0496106_0000130 | 3300048909 | Bacteria | 57887 |
| 268 | Ga0496107_0000001 | 3300048910 | Bacteria | 321778 |
| 269 | Ga0496107_0000031 | 3300048910 | Bacteria | 100522 |
| 270 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 271 | Ga0496108_0000012 | 3300048911 | Bacteria | 258433 |
| 272 | Ga0496108_0000202 | 3300048911 | Bacteria | 55115 |
| 273 | Ga0496108_0006913 | 3300048911 | Bacteria | 9184 |
| 274 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 275 | Ga0496109_0000076 | 3300048912 | Bacteria | 104273 |
| 276 | Ga0496109_0000106 | 3300048912 | Bacteria | 86550 |
| 277 | Ga0496109_0000131 | 3300048912 | Bacteria | 76860 |
| 278 | Ga0496110_0001428 | 3300048913 | Bacteria | 17262 |
| 279 | Ga0496110_0010737 | 3300048913 | Bacteria | 7461 |
| 280 | Ga0496110_0016913 | 3300048913 | Bacteria | 6096 |
| 281 | Ga0496110_0291047 | 3300048913 | Bacteria | 1487 |
| 282 | Ga0496111_0000001 | 3300048914 | Bacteria | 194837 |
| 283 | Ga0496111_0016627 | 3300048914 | Bacteria | 5073 |
| 284 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 285 | Ga0496112_0002876 | 3300048915 | Bacteria | 14003 |
| 286 | Ga0496113_0000033 | 3300048916 | Bacteria | 59422 |
| 287 | Ga0496113_0017926 | 3300048916 | Bacteria | 4923 |
| 288 | Ga0496113_0172792 | 3300048916 | Bacteria | 1712 |
| 289 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 290 | Ga0496114_0031882 | 3300048917 | Bacteria | 4335 |
| 291 | Ga0496115_0000071 | 3300048918 | Bacteria | 91922 |
| 292 | Ga0496115_0000183 | 3300048918 | Bacteria | 58406 |
| 293 | Ga0496115_0003229 | 3300048918 | Bacteria | 11702 |
| 294 | Ga0496116_0000557 | 3300048919 | Bacteria | 49954 |
| 295 | Ga0496117_0014892 | 3300048920 | Bacteria | 6670 |
| 296 | Ga0496118_0005961 | 3300048921 | Bacteria | 13607 |
| 297 | Ga0496119_0003916 | 3300048922 | Bacteria | 15119 |
| 298 | Ga0496119_0023101 | 3300048922 | Bacteria | 4425 |
| 299 | Ga0496119_0026522 | 3300048922 | Bacteria | 4015 |
| 300 | Ga0496120_0002060 | 3300048923 | Bacteria | 21705 |
| 301 | Ga0496120_0016515 | 3300048923 | Bacteria | 4825 |
| 302 | Ga0496121_0063925 | 3300048924 | Bacteria | 3003 |
| 303 | Ga0496125_0084922 | 3300048928 | Bacteria | 2401 |
| 304 | Ga0496126_0076581 | 3300048929 | Bacteria | 2968 |
| 305 | Ga0501034_0116374 | 3300049571 | Bacteria | 2661 |
| 306 | Ga0501034_0134535 | 3300049571 | Bacteria | 2453 |
| 307 | Ga0501034_0277379 | 3300049571 | Bacteria | 1616 |
| 308 | Ga0501039_0132487 | 3300049575 | Bacteria | 1956 |
| 309 | Ga0501042_0054441 | 3300049578 | Bacteria | 2854 |
| 310 | Ga0501047_0010126 | 3300049581 | Bacteria | 8913 |
| 311 | Ga0501070_0109044 | 3300049586 | Bacteria | 2287 |
| 312 | Ga0501070_0159458 | 3300049586 | Bacteria | 1860 |
| 313 | Ga0501071_0123616 | 3300049587 | Bacteria | 1919 |
| 314 | Ga0501072_0060450 | 3300049588 | Bacteria | 2988 |
| 315 | Ga0501074_0024002 | 3300049590 | Bacteria | 4432 |
| 316 | Ga0501074_0057229 | 3300049590 | Bacteria | 2808 |
| 317 | Ga0501075_0053316 | 3300049591 | Bacteria | 3042 |
| 318 | Ga0501079_0008902 | 3300049741 | Bacteria | 7601 |
| 319 | Ga0501080_0103884 | 3300049742 | Bacteria | 2635 |
| 320 | Ga0501083_0039494 | 3300049744 | Bacteria | 3205 |
| 321 | Ga0501083_0049513 | 3300049744 | Bacteria | 2831 |
| 322 | Ga0501083_0119451 | 3300049744 | Bacteria | 1729 |
| 323 | Ga0501035_0206275 | 3300049822 | Bacteria | 1683 |
| 324 | nmdc:mga06r32_18081_c1 | 3300050510 | Bacteria | 6446 |
| 325 | nmdc:mga08y16_97672_c1 | 3300050511 | Bacteria | 3059 |
| 326 | nmdc:mga0n895_166799_c1 | 3300050512 | Bacteria | 2234 |
| 327 | nmdc:mga0a205_1636_c1 | 3300050515 | Bacteria | 19228 |
| 328 | nmdc:mga0a205_53417_c1 | 3300050515 | Bacteria | 3900 |
| 329 | Ga0495601_0000042 | 3300053077 | Bacteria | 77373 |
| 330 | Ga0495601_0000209 | 3300053077 | Bacteria | 31307 |
| 331 | Ga0495601_0008029 | 3300053077 | Bacteria | 6219 |
| 332 | Ga0495601_0011900 | 3300053077 | Bacteria | 5215 |
| 333 | Ga0495601_0149061 | 3300053077 | Bacteria | 1527 |
| 334 | Ga0495612_0004325 | 3300053078 | Bacteria | 5891 |
| 335 | Ga0495612_0008891 | 3300053078 | Bacteria | 4070 |
| 336 | Ga0495655_0000009 | 3300053083 | Bacteria | 150662 |
| 337 | Ga0495655_0001940 | 3300053083 | Bacteria | 3225 |
| 338 | Ga0495595_0000005 | 3300053084 | Bacteria | 258660 |
| 339 | Ga0495595_0000362 | 3300053084 | Bacteria | 17220 |
| 340 | Ga0495619_0000040 | 3300053085 | Bacteria | 118238 |
| 341 | Ga0495619_0000060 | 3300053085 | Bacteria | 89377 |
| 342 | Ga0495619_0000126 | 3300053085 | Bacteria | 56169 |
| 343 | Ga0495619_0000744 | 3300053085 | Bacteria | 21210 |
| 344 | Ga0495619_0001967 | 3300053085 | Bacteria | 13702 |
| 345 | Ga0495619_0005900 | 3300053085 | Bacteria | 7761 |
| 346 | Ga0500566_0004741 | 3300053094 | Bacteria | 8102 |
| 347 | Ga0500641_0010470 | 3300053096 | Bacteria | 3352 |
| 348 | Ga0500595_018561 | 3300053119 | Bacteria | 2541 |
| 349 | Ga0500628_000078 | 3300053129 | Bacteria | 24490 |
| 350 | Ga0105243_10043385 | |||
| 351 | JGI24740J21852_10006896 | |||
| 352 | JGI24748J21848_1001111 | |||
| 353 | JGI24034J26672_10000195 | |||
| 354 | JGI24742J22300_10002582 | |||
| 355 | JGI25404J52841_10000594 | |||
| 356 | Ga0070683_100000226 | |||
| 357 | Ga0070683_100005302 | |||
| 358 | Ga0070683_100092674 | |||
| 359 | Ga0070683_100103034 | |||
| 360 | Ga0070670_100058203 | |||
| 361 | Ga0070677_10000007 | |||
| 362 | Ga0070666_10005160 | |||
| 363 | Ga0070682_100000038 | |||
| 364 | Ga0070682_100000072 | |||
| 365 | Ga0068868_100000314 | |||
| 366 | Ga0068868_100030645 | |||
| 367 | Ga0070691_10000052 | |||
| 368 | Ga0070691_10007204 | |||
| 369 | Ga0070661_100000116 | |||
| 370 | Ga0070668_100096231 | |||
| 371 | Ga0070675_100000008 | |||
| 372 | Ga0070688_100000066 | |||
| 373 | Ga0070688_100003641 | |||
| 374 | Ga0070659_100012851 | |||
| 375 | Ga0070667_100042243 | |||
| 376 | Ga0070713_100000061 | |||
| 377 | Ga0070711_100050199 | |||
| 378 | Ga0070663_100009024 | |||
| 379 | Ga0070678_100022184 | |||
| 380 | Ga0070662_100000079 | |||
| 381 | Ga0070681_10031996 | |||
| 382 | Ga0068867_100000246 | |||
| 383 | Ga0068867_100071772 | |||
| 384 | Ga0070685_10000165 | |||
| 385 | Ga0070685_10000230 | |||
| 386 | Ga0070679_100000077 | |||
| 387 | Ga0070679_100002291 | |||
| 388 | Ga0070684_100059157 | |||
| 389 | Ga0070684_100090535 | |||
| 390 | Ga0070684_100123341 | |||
| 391 | Ga0068853_100001022 | |||
| 392 | Ga0070672_100000018 | |||
| 393 | Ga0070693_100065495 | |||
| 394 | Ga0070665_100000306 | |||
| 395 | Ga0070664_100052635 | |||
| 396 | Ga0068854_100000044 | |||
| 397 | Ga0068854_100034195 | |||
| 398 | Ga0068856_100000654 | |||
| 399 | Ga0068852_100000050 | |||
| 400 | Ga0068851_10000669 | |||
| 401 | Ga0068863_100000039 | |||
| 402 | Ga0068863_100008208 | |||
| 403 | Ga0068858_100000178 | |||
| 404 | Ga0068858_100000454 | |||
| 405 | Ga0068860_100021006 | |||
| 406 | Ga0081455_10006555 | |||
| 407 | Ga0081455_10019025 | |||
| 408 | Ga0081455_10022633 | |||
| 409 | Ga0081455_10065660 | |||
| 410 | Ga0081455_10100003 | |||
| 411 | Ga0081540_1000044 | |||
| 412 | Ga0081540_1006546 | |||
| 413 | Ga0081539_10007734 | |||
| 414 | Ga0070715_10000003 | |||
| 415 | Ga0070712_100001770 | |||
| 416 | Ga0068871_100103800 | |||
| 417 | Ga0075433_10001949 | |||
| 418 | Ga0075433_10076863 | |||
| 419 | Ga0075434_100211647 | |||
| 420 | Ga0068865_100000019 | |||
| 421 | Ga0075436_100042536 | |||
| 422 | Ga0105240_10242940 | |||
| 423 | Ga0111539_10058744 | |||
| 424 | Ga0111539_10067223 | |||
| 425 | Ga0105245_10000012 | |||
| 426 | Ga0105245_10000049 | |||
| 427 | Ga0105245_10000508 | |||
| 428 | Ga0105247_10000109 | |||
| 429 | Ga0105247_10045489 | |||
| 430 | Ga0105242_10013472 | |||
| 431 | Ga0105248_10000126 | |||
| 432 | Ga0105237_10194933 | |||
| 433 | Ga0105238_10000014 | |||
| 434 | Ga0105249_10000039 | |||
| 435 | Ga0105249_10082410 | |||
| 436 | Ga0105239_10342223 | |||
| 437 | Ga0157371_10004303 | |||
| 438 | Ga0157370_10020919 | |||
| 439 | Ga0157369_10000135 | |||
| 440 | Ga0157374_10147305 | |||
| 441 | Ga0157378_10000598 | |||
| 442 | Ga0157378_10017219 | |||
| 443 | Ga0157378_10067081 | |||
| 444 | Ga0157372_10001053 | |||
| 445 | Ga0157375_10003759 | |||
| 446 | Ga0157375_10206077 | |||
| 447 | Ga0163163_10193105 | |||
| 448 | Ga0157380_10000009 | |||
| 449 | Ga0157380_10000277 | |||
| 450 | Ga0157376_10086175 | |||
| 451 | Ga0163161_10000013 | |||
| 452 | Ga0207656_10003169 | |||
| 453 | Ga0207682_10000007 | |||
| 454 | Ga0207692_10051550 | |||
| 455 | Ga0207710_10000408 | |||
| 456 | Ga0207680_10001305 | |||
| 457 | Ga0207680_10004991 | |||
| 458 | Ga0207685_10000003 | |||
| 459 | Ga0207707_10013686 | |||
| 460 | Ga0207671_10064865 | |||
| 461 | Ga0207693_10006644 | |||
| 462 | Ga0207663_10003362 | |||
| 463 | Ga0207649_10000005 | |||
| 464 | Ga0207652_10000138 | |||
| 465 | Ga0207652_10001427 | |||
| 466 | Ga0207694_10000008 | |||
| 467 | Ga0207659_10000014 | |||
| 468 | Ga0207687_10000011 | |||
| 469 | Ga0207687_10000012 | |||
| 470 | Ga0207687_10000750 | |||
| 471 | Ga0207700_10000016 | |||
| 472 | Ga0207690_10007936 | |||
| 473 | Ga0207706_10000302 | |||
| 474 | Ga0207686_10000029 | |||
| 475 | Ga0207709_10007236 | |||
| 476 | Ga0207704_10000009 | |||
| 477 | Ga0207691_10000121 | |||
| 478 | Ga0207711_10000024 | |||
| 479 | Ga0207689_10035656 | |||
| 480 | Ga0207661_10000068 | |||
| 481 | Ga0207661_10003655 | |||
| 482 | Ga0207661_10018762 | |||
| 483 | Ga0207661_10063490 | |||
| 484 | Ga0207679_10005625 | |||
| 485 | Ga0207712_10000003 | |||
| 486 | Ga0207668_10022699 | |||
| 487 | Ga0207640_10000517 | |||
| 488 | Ga0207640_10004533 | |||
| 489 | Ga0207677_10000218 | |||
| 490 | Ga0207677_10018817 | |||
| 491 | Ga0207703_10000381 | |||
| 492 | Ga0207703_10000451 | |||
| 493 | Ga0207639_10002102 | |||
| 494 | Ga0207678_10000872 | |||
| 495 | Ga0207678_10028413 | |||
| 496 | Ga0207702_10000099 | |||
| 497 | Ga0207702_10001991 | |||
| 498 | Ga0207641_10000065 | |||
| 499 | Ga0207641_10001058 | |||
| 500 | Ga0207648_10000783 | |||
| 501 | Ga0207698_10000009 | |||
| 502 | Ga0268266_10000023 | |||
| 503 | Ga0268266_10000342 | |||
| 504 | Ga0268264_10010113 | |||
| 505 | Ga0265337_1000074 | |||
| 506 | Ga0265326_10000035 | |||
| 507 | Ga0265326_10020417 | |||
| 508 | Ga0265319_1000091 | |||
| 509 | Ga0265322_10000009 | |||
| 510 | Ga0265336_10005968 | |||
| 511 | Ga0265338_10000752 | |||
| 512 | Ga0265324_10000168 | |||
| 513 | Ga0265324_10019055 | |||
| 514 | Ga0307511_10091834 | |||
| 515 | Ga0265328_10004875 | |||
| 516 | Ga0265320_10000024 | |||
| 517 | Ga0265325_10008658 | |||
| 518 | Ga0265331_10017484 | |||
| 519 | Ga0265327_10000227 | |||
| 520 | Ga0265316_10099498 | |||
| 521 | Ga0265314_10000647 | |||
| 522 | Ga0395898_0055248 | |||
| 523 | Ga0395905_0150631 | |||
| 524 | Ga0451853_3365981 | |||
| 525 | Ga0466963_0000025 | |||
| 526 | Ga0466957_0006020 | |||
| 527 | Ga0466958_0027822 | |||
| 528 | Ga0466967_0000005 | |||
| 529 | Ga0466967_0258234 | |||
| 530 | Ga0495592_0002025 | |||
| 531 | Ga0495603_0000054 | |||
| 532 | Ga0495603_0000431 | |||
| 533 | Ga0495629_0000377 | |||
| 534 | Ga0495629_0050162 | |||
| 535 | Ga0495629_0067237 | |||
| 536 | Ga0495629_0092221 | |||
| 537 | Ga0495638_0030271 | |||
| 538 | Ga0495641_0000095 | |||
| 539 | Ga0495641_0020286 | |||
| 540 | Ga0495653_0040546 | |||
| 541 | Ga0495653_0044927 | |||
| 542 | Ga0495653_0103711 | |||
| 543 | Ga0495582_0000082 | |||
| 544 | Ga0495662_0005370 | |||
| 545 | Ga0495594_0000191 | |||
| 546 | Ga0495606_0000294 | |||
| 547 | Ga0495608_0000010 | |||
| 548 | Ga0495608_0004501 | |||
| 549 | Ga0495618_0000097 | |||
| 550 | Ga0495620_0000158 | |||
| 551 | Ga0495628_0000048 | |||
| 552 | Ga0495630_0000011 | |||
| 553 | Ga0495630_0000082 | |||
| 554 | Ga0495644_0004418 | |||
| 555 | Ga0495652_0000003 | |||
| 556 | Ga0495652_0022568 | |||
| 557 | Ga0495640_0020617 | |||
| 558 | Ga0495586_0000234 | |||
| 559 | Ga0495645_0043864 | |||
| 560 | Ga0495622_0000925 | |||
| 561 | Ga0495667_0000053 | |||
| 562 | Ga0495634_0000616 | |||
| 563 | Ga0495634_0002295 | |||
| 564 | Ga0495634_0022292 | |||
| 565 | Ga0495625_0001012 | |||
| 566 | Ga0495625_0164347 | |||
| 567 | Ga0495635_0000006 | |||
| 568 | Ga0495635_0058527 | |||
| 569 | Ga0495588_0000218 | |||
| 570 | Ga0495657_0000005 | |||
| 571 | Ga0495599_0006526 | |||
| 572 | Ga0495647_0000010 | |||
| 573 | Ga0495647_0000170 | |||
| 574 | Ga0495658_0000070 | |||
| 575 | Ga0495658_0047988 | |||
| 576 | Ga0495613_0000092 | |||
| 577 | Ga0495613_0000131 | |||
| 578 | Ga0495613_0029857 | |||
| 579 | Ga0495624_0000049 | |||
| 580 | Ga0495624_0000778 | |||
| 581 | Ga0495624_0003321 | |||
| 582 | Ga0495670_0002998 | |||
| 583 | Ga0495649_0002888 | |||
| 584 | Ga0495600_0001501 | |||
| 585 | Ga0495604_0000038 | |||
| 586 | Ga0495604_0000078 | |||
| 587 | Ga0495674_0000063 | |||
| 588 | Ga0495676_0000187 | |||
| 589 | Ga0495676_0004369 | |||
| 590 | Ga0495676_0005731 | |||
| 591 | Ga0495680_0000364 | |||
| 592 | Ga0495680_0007408 | |||
| 593 | Ga0495680_0010323 | |||
| 594 | Ga0495675_0000004 | |||
| 595 | Ga0495675_0087778 | |||
| 596 | Ga0495686_0081365 | |||
| 597 | Ga0495602_0000009 | |||
| 598 | Ga0495602_0002886 | |||
| 599 | Ga0495602_0072696 | |||
| 600 | Ga0496100_0000004 | |||
| 601 | Ga0496100_0000032 | |||
| 602 | Ga0496101_0000007 | |||
| 603 | Ga0496101_0000012 | |||
| 604 | Ga0496102_0000132 | |||
| 605 | Ga0496102_0027834 | |||
| 606 | Ga0496103_0000077 | |||
| 607 | Ga0496104_0000002 | |||
| 608 | Ga0496104_0000003 | |||
| 609 | Ga0496104_0011565 | |||
| 610 | Ga0496105_0000001 | |||
| 611 | Ga0496105_0000003 | |||
| 612 | Ga0496105_0000070 | |||
| 613 | Ga0496105_0021297 | |||
| 614 | Ga0496106_0000004 | |||
| 615 | Ga0496106_0000092 | |||
| 616 | Ga0496106_0000130 | |||
| 617 | Ga0496107_0000001 | |||
| 618 | Ga0496107_0000031 | |||
| 619 | Ga0496108_0000002 | |||
| 620 | Ga0496108_0000012 | |||
| 621 | Ga0496108_0000202 | |||
| 622 | Ga0496108_0006913 | |||
| 623 | Ga0496109_0000001 | |||
| 624 | Ga0496109_0000076 | |||
| 625 | Ga0496109_0000106 | |||
| 626 | Ga0496109_0000131 | |||
| 627 | Ga0496110_0001428 | |||
| 628 | Ga0496110_0010737 | |||
| 629 | Ga0496110_0016913 | |||
| 630 | Ga0496110_0291047 | |||
| 631 | Ga0496111_0000001 | |||
| 632 | Ga0496111_0016627 | |||
| 633 | Ga0496112_0000002 | |||
| 634 | Ga0496112_0002876 | |||
| 635 | Ga0496113_0000033 | |||
| 636 | Ga0496113_0017926 | |||
| 637 | Ga0496113_0172792 | |||
| 638 | Ga0496114_0000003 | |||
| 639 | Ga0496114_0031882 | |||
| 640 | Ga0496115_0000071 | |||
| 641 | Ga0496115_0000183 | |||
| 642 | Ga0496115_0003229 | |||
| 643 | Ga0496116_0000557 | |||
| 644 | Ga0496117_0014892 | |||
| 645 | Ga0496118_0005961 | |||
| 646 | Ga0496119_0003916 | |||
| 647 | Ga0496119_0023101 | |||
| 648 | Ga0496119_0026522 | |||
| 649 | Ga0496120_0002060 | |||
| 650 | Ga0496120_0016515 | |||
| 651 | Ga0496121_0063925 | |||
| 652 | Ga0496125_0084922 | |||
| 653 | Ga0496126_0076581 | |||
| 654 | Ga0501034_0116374 | |||
| 655 | Ga0501034_0134535 | |||
| 656 | Ga0501034_0277379 | |||
| 657 | Ga0501039_0132487 | |||
| 658 | Ga0501042_0054441 | |||
| 659 | Ga0501047_0010126 | |||
| 660 | Ga0501070_0109044 | |||
| 661 | Ga0501070_0159458 | |||
| 662 | Ga0501071_0123616 | |||
| 663 | Ga0501072_0060450 | |||
| 664 | Ga0501074_0024002 | |||
| 665 | Ga0501074_0057229 | |||
| 666 | Ga0501075_0053316 | |||
| 667 | Ga0501079_0008902 | |||
| 668 | Ga0501080_0103884 | |||
| 669 | Ga0501083_0039494 | |||
| 670 | Ga0501083_0049513 | |||
| 671 | Ga0501083_0119451 | |||
| 672 | Ga0501035_0206275 | |||
| 673 | nmdc:mga06r32_18081_c1 | |||
| 674 | nmdc:mga08y16_97672_c1 | |||
| 675 | nmdc:mga0n895_166799_c1 | |||
| 676 | nmdc:mga0a205_1636_c1 | |||
| 677 | nmdc:mga0a205_53417_c1 | |||
| 678 | Ga0495601_0000042 | |||
| 679 | Ga0495601_0000209 | |||
| 680 | Ga0495601_0008029 | |||
| 681 | Ga0495601_0011900 | |||
| 682 | Ga0495601_0149061 | |||
| 683 | Ga0495612_0004325 | |||
| 684 | Ga0495612_0008891 | |||
| 685 | Ga0495655_0000009 | |||
| 686 | Ga0495655_0001940 | |||
| 687 | Ga0495595_0000005 | |||
| 688 | Ga0495595_0000362 | |||
| 689 | Ga0495619_0000040 | |||
| 690 | Ga0495619_0000060 | |||
| 691 | Ga0495619_0000126 | |||
| 692 | Ga0495619_0000744 | |||
| 693 | Ga0495619_0001967 | |||
| 694 | Ga0495619_0005900 | |||
| 695 | Ga0500566_0004741 | |||
| 696 | Ga0500641_0010470 | |||
| 697 | Ga0500595_018561 | |||
| 698 | Ga0500628_000078 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ir6-assembly1.cif.gz_A | the structure of bd oxidase from geobacillus thermodenitrificans | 0.8343 | 15 | 424 |
| 7ose-assembly1.cif.gz_D | cytochrome bd-ii type oxidase with bound aurachin d | 0.8127 | 15 | 423 |
| 7nkz-assembly1.cif.gz_A | cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution | 0.8028 | 15 | 419 |
| 5ir6-assembly1.cif.gz_A | the structure of bd oxidase from geobacillus thermodenitrificans | 0.793 | 15 | 424 |
| 7ose-assembly1.cif.gz_D | cytochrome bd-ii type oxidase with bound aurachin d | 0.7488 | 15 | 423 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5jdlA01 | Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region | 0.5323 | 175 | 244 | 6.10.280.80 |
| af_A0A1D6MBU0_33_185_1.20.120.520 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like | 0.5099 | 185 | 390 | 1.20.120.520 |
| 5jdlA01 | Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region | 0.4949 | 175 | 244 | 6.10.280.80 |
| af_A4I2W7_8_252_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.4843 | 119 | 376 | 1.20.1070.10 |
| af_F5GU36_11_158_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.474 | 141 | 248 | 1.20.140.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A853ALQ1-F1-model_v4 | Cytochrome bd-type quinol oxidase subunit 1 | 0.9455 | 121 | 322 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069 |
| AF-A0A853ALQ1-F1-model_v4 | Cytochrome bd-type quinol oxidase subunit 1 | 0.9366 | 121 | 322 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069 |
| AF-T0ZCW9-F1-model_v4 | Cytochrome d ubiquinol oxidase, subunit I | 0.9337 | 114 | 295 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069 |
| AF-A0A1Q7E7T8-F1-model_v4 | Cytochrome ubiquinol oxidase subunit I | 0.9291 | 135 | 329 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069 |
| AF-A0A3P8IZF2-F1-model_v4 | Cytochrome bd-II oxidase subunit 1 (EC 1.10.3.-) | 0.9204 | 166 | 363 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069 |