F417981

General Info

Members Datasets Scaffolds Average Seq Length
349 213 699 502

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0001965|Ga0466959_0001965_1260_3065
Length 553
Sequence MPSSGPSVRPIKLTIAALGGQGGGVLAGWLVGIAESEGYVAQTTSVPGVAQRTGATIYYLEFFPQALAAQARRDPIMALMPASGDVDCVLASELAEAARAIQRGLVTRDRTTLIASSHRSYAISERSAMGDGTADERQLLELVRTQAKRTVLLDMEAVAEQHHSVISSVMLGALGGSGVLPFRKAAFEAAIKKGGIAVSTNLAAFEDAYQRAERGGGLQPPAVDAVSAGAAXXXVGNLREVPERARSPALQPLLDRVRQVPGPVRKVVFEGVRRAIDYQDPEYATLYLDRVERIAAVDGRVRFAGREVGQSVRRASDAVGVSAAYGPWALTEATARSLALWMTFEDTIRVADLKTRPARFGRVREEIRAEPGQLFGITEFMKPRVQEIAGTLPVGIGGWVLRSARVSRWLSRWTGGRQIRTGTVSGFVLLHTLGGLRRWRRKTLRYQEENARIEQWLGRIENLAGTNYGLAVELARAQRLVKGYGETHERGWRNFSALLERIDDLAPRPDGAGIFARLHAAALADEEGKALARELAEISSVAVVKAALERARA

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
206 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
207 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
211 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
212 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
213 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.57
Metatranscriptomes 0.57
Isolates 0.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0
Rhizoplane 4.3
Rhizosphere 87.68
Stem 0
Stem Tuber 0
Unclassified 2.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0001965 3300045049 Bacteria 12967
2 rootH1_10034882 3300003316 Bacteria 7746
3 rootH1_10034882 3300003323 Bacteria 3545
4 Ga0070676_10004627 3300005328 Bacteria 7263
5 Ga0070676_10064059 3300005328 Bacteria 2191
6 Ga0070690_100022690 3300005330 Bacteria 3842
7 Ga0070670_100004816 3300005331 Bacteria 11336
8 Ga0068869_100001151 3300005334 Bacteria 15448
9 Ga0068869_100002683 3300005334 Bacteria 10761
10 Ga0070666_10055590 3300005335 Bacteria 2672
11 Ga0070680_100004029 3300005336 Bacteria 10995
12 Ga0070682_100001614 3300005337 Bacteria 12556
13 Ga0068868_100019564 3300005338 Bacteria 5074
14 Ga0070691_10005595 3300005341 Bacteria 5720
15 Ga0070661_100004694 3300005344 Bacteria 9409
16 Ga0070692_10002049 3300005345 Bacteria 7667
17 Ga0070668_100111705 3300005347 Bacteria 2176
18 Ga0070669_100047700 3300005353 Bacteria 3125
19 Ga0070673_100008745 3300005364 Bacteria 6759
20 Ga0070659_100001390 3300005366 Bacteria 17461
21 Ga0070703_10004189 3300005406 Bacteria 4059
22 Ga0070709_10001655 3300005434 Bacteria 12082
23 Ga0070714_100049467 3300005435 Bacteria 3578
24 Ga0070713_100013279 3300005436 Bacteria 6075
25 Ga0070713_100061182 3300005436 Bacteria 3150
26 Ga0070713_100075191 3300005436 Bacteria 2864
27 Ga0070711_100008361 3300005439 Bacteria 6338
28 Ga0070711_100028784 3300005439 Bacteria 3659
29 Ga0070711_100038273 3300005439 Bacteria 3224
30 Ga0070705_100001186 3300005440 Bacteria 14205
31 Ga0070700_100024405 3300005441 Bacteria 3550
32 Ga0070700_100071987 3300005441 Bacteria 2208
33 Ga0070694_100000441 3300005444 Bacteria 22636
34 Ga0070708_100041389 3300005445 Bacteria 4039
35 Ga0070708_100278994 3300005445 Bacteria 1573
36 Ga0070663_100010033 3300005455 Bacteria 5889
37 Ga0070678_100003159 3300005456 Bacteria 9123
38 Ga0070662_100011376 3300005457 Bacteria 5874
39 Ga0070681_10005057 3300005458 Bacteria 12717
40 Ga0070681_10163105 3300005458 Bacteria 2152
41 Ga0068867_100120419 3300005459 Bacteria 2028
42 Ga0070706_100012720 3300005467 Bacteria 7786
43 Ga0070706_100038469 3300005467 Bacteria 4414
44 Ga0070707_100105072 3300005468 Bacteria 2738
45 Ga0070707_100106764 3300005468 Bacteria 2715
46 Ga0070698_100003437 3300005471 Bacteria 17412
47 Ga0070698_100005218 3300005471 Bacteria 14207
48 Ga0070699_100002495 3300005518 Bacteria 16526
49 Ga0070699_100008335 3300005518 Bacteria 8984
50 Ga0070684_100004733 3300005535 Bacteria 10395
51 Ga0070697_100002024 3300005536 Bacteria 15517
52 Ga0070697_100007024 3300005536 Bacteria 8752
53 Ga0070697_100022905 3300005536 Bacteria 4966
54 Ga0068853_100001362 3300005539 Bacteria 17619
55 Ga0070672_100026050 3300005543 Bacteria 4346
56 Ga0070695_100005164 3300005545 Bacteria 7700
57 Ga0070696_100008864 3300005546 Bacteria 6728
58 Ga0070696_100011067 3300005546 Bacteria 6038
59 Ga0070665_100002471 3300005548 Bacteria 20382
60 Ga0070665_100018817 3300005548 Bacteria 6924
61 Ga0070665_100043168 3300005548 Bacteria 4532
62 Ga0070665_100120488 3300005548 Bacteria 2625
63 Ga0070704_100002230 3300005549 Bacteria 10805
64 Ga0070704_100062156 3300005549 Bacteria 2675
65 Ga0068855_100002281 3300005563 Bacteria 23694
66 Ga0068855_100004690 3300005563 Bacteria 16707
67 Ga0068855_100030519 3300005563 Bacteria 6446
68 Ga0070664_100068347 3300005564 Bacteria 3037
69 Ga0068857_100048018 3300005577 Bacteria 3790
70 Ga0068854_100000353 3300005578 Bacteria 29520
71 Ga0068856_100005843 3300005614 Bacteria 12127
72 Ga0068864_100012160 3300005618 Bacteria 7114
73 Ga0068861_100012784 3300005719 Bacteria 5861
74 Ga0068861_100039174 3300005719 Bacteria 3535
75 Ga0068861_100136481 3300005719 Unclassified 1997
76 Ga0068870_10002800 3300005840 Bacteria 7335
77 Ga0068870_10026079 3300005840 Bacteria 2910
78 Ga0068863_100009629 3300005841 Bacteria 9425
79 Ga0068863_100014609 3300005841 Bacteria 7560
80 Ga0068863_100026598 3300005841 Bacteria 5518
81 Ga0068863_100029697 3300005841 Bacteria 5219
82 Ga0068858_100013477 3300005842 Bacteria 7714
83 Ga0068858_100084895 3300005842 Bacteria 2945
84 Ga0068860_100012755 3300005843 Bacteria 8263
85 Ga0068860_100041893 3300005843 Bacteria 4374
86 Ga0068862_100019358 3300005844 Bacteria 5681
87 Ga0068862_100032173 3300005844 Bacteria 4431
88 Ga0068862_100068406 3300005844 Bacteria 3063
89 Ga0068862_100094250 3300005844 Bacteria 2611
90 Ga0068862_100103575 3300005844 Bacteria 2492
91 Ga0081538_10009058 3300005981 Bacteria 8354
92 Ga0070715_10006812 3300006163 Bacteria 3901
93 Ga0070715_10012734 3300006163 Bacteria 3071
94 Ga0070715_10062864 3300006163 Bacteria 1635
95 Ga0070716_100004433 3300006173 Bacteria 6714
96 Ga0070716_100007161 3300006173 Bacteria 5482
97 Ga0070716_100050833 3300006173 Bacteria 2354
98 Ga0070712_100000702 3300006175 Bacteria 19748
99 Ga0070712_100018195 3300006175 Bacteria 4560
100 Ga0097621_100158616 3300006237 Unclassified 1943
101 Ga0075428_100008367 3300006844 Bacteria 11469
102 Ga0075428_100129853 3300006844 Bacteria 2741
103 Ga0075428_100169686 3300006844 Bacteria 2366
104 Ga0075431_100002099 3300006847 Bacteria 19047
105 Ga0075431_100007043 3300006847 Bacteria 11169
106 Ga0075431_100017886 3300006847 Bacteria 7210
107 Ga0075431_100046996 3300006847 Bacteria 4450
108 Ga0075431_100241419 3300006847 Bacteria 1838
109 Ga0075433_10010766 3300006852 Bacteria 7355
110 Ga0075433_10021442 3300006852 Bacteria 5417
111 Ga0075433_10045692 3300006852 Bacteria 3808
112 Ga0075434_100005054 3300006871 Bacteria 11979
113 Ga0075434_100022280 3300006871 Bacteria 6170
114 Ga0075434_100048174 3300006871 Bacteria 4229
115 Ga0075434_100069973 3300006871 Bacteria 3499
116 Ga0075434_100081464 3300006871 Bacteria 3234
117 Ga0068865_100020414 3300006881 Bacteria 4295
118 Ga0075436_100025960 3300006914 Bacteria 4034
119 Ga0075436_100033005 3300006914 Bacteria 3567
120 Ga0075435_100017324 3300007076 Bacteria 5451
121 Ga0075435_100072445 3300007076 Bacteria 2815
122 Ga0099794_10006488 3300007265 Bacteria 4742
123 Ga0105251_10007975 3300009011 Bacteria 6425
124 Ga0105240_10001523 3300009093 Bacteria 39413
125 Ga0105240_10002946 3300009093 Bacteria 26847
126 Ga0105240_10016293 3300009093 Bacteria 10068
127 Ga0105240_10098312 3300009093 Bacteria 3564
128 Ga0111539_10000370 3300009094 Bacteria 55548
129 Ga0111539_10048380 3300009094 Bacteria 5077
130 Ga0111539_10160713 3300009094 Bacteria 2627
131 Ga0114129_10100465 3300009147 Bacteria 4003
132 Ga0114129_10247094 3300009147 Bacteria 2397
133 Ga0114129_10297335 3300009147 Bacteria 2153
134 Ga0105243_10005287 3300009148 Bacteria 10094
135 Ga0105241_10000218 3300009174 Bacteria 43050
136 Ga0105241_10006876 3300009174 Bacteria 8370
137 Ga0105242_10006109 3300009176 Bacteria 9286
138 Ga0105242_10021044 3300009176 Bacteria 5117
139 Ga0105248_10001432 3300009177 Bacteria 26594
140 Ga0105248_10121257 3300009177 Bacteria 2949
141 Ga0105238_10087090 3300009551 Bacteria 3110
142 Ga0105239_10072021 3300010375 Bacteria 3798
143 Ga0157373_10001408 3300013100 Bacteria 18402
144 Ga0157369_10000598 3300013105 Bacteria 46913
145 Ga0157369_10027301 3300013105 Bacteria 6330
146 Ga0157372_10005389 3300013307 Bacteria 13601
147 Ga0157372_10348768 3300013307 Bacteria 1724
148 Ga0157375_10110159 3300013308 Unclassified 2850
149 Ga0157379_10094603 3300014968 Bacteria 2681
150 Ga0182007_10007605 3300015262 Bacteria 4522
151 Ga0163161_10005761 3300017792 Bacteria 8587
152 Ga0206356_10796433 3300020070 Bacteria 2637
153 Ga0207713_1027624 3300025735 Bacteria 2574
154 Ga0207653_10001831 3300025885 Bacteria 6781
155 Ga0207688_10021890 3300025901 Bacteria 3496
156 Ga0207699_10002402 3300025906 Bacteria 8848
157 Ga0207645_10004510 3300025907 Bacteria 10289
158 Ga0207645_10006049 3300025907 Bacteria 8700
159 Ga0207645_10083101 3300025907 Bacteria 2053
160 Ga0207643_10000157 3300025908 Bacteria 46902
161 Ga0207643_10009807 3300025908 Bacteria 5143
162 Ga0207684_10001957 3300025910 Bacteria 21321
163 Ga0207684_10022352 3300025910 Bacteria 5398
164 Ga0207684_10069265 3300025910 Bacteria 2998
165 Ga0207654_10008457 3300025911 Bacteria 5204
166 Ga0207707_10000258 3300025912 Bacteria 57257
167 Ga0207707_10002863 3300025912 Bacteria 15408
168 Ga0207695_10007599 3300025913 Bacteria 13743
169 Ga0207695_10023766 3300025913 Bacteria 6916
170 Ga0207693_10001747 3300025915 Bacteria 19066
171 Ga0207663_10003605 3300025916 Bacteria 7601
172 Ga0207663_10009761 3300025916 Bacteria 5079
173 Ga0207660_10009632 3300025917 Bacteria 6254
174 Ga0207660_10012965 3300025917 Bacteria 5461
175 Ga0207660_10038887 3300025917 Bacteria 3323
176 Ga0207657_10000373 3300025919 Bacteria 47375
177 Ga0207649_10006640 3300025920 Bacteria 6287
178 Ga0207652_10001053 3300025921 Bacteria 25164
179 Ga0207646_10001458 3300025922 Bacteria 29273
180 Ga0207646_10038301 3300025922 Bacteria 4320
181 Ga0207687_10106513 3300025927 Bacteria 2073
182 Ga0207700_10146801 3300025928 Bacteria 1945
183 Ga0207690_10000948 3300025932 Bacteria 18575
184 Ga0207706_10001026 3300025933 Bacteria 28419
185 Ga0207706_10011866 3300025933 Bacteria 7933
186 Ga0207686_10125837 3300025934 Bacteria 1751
187 Ga0207709_10012459 3300025935 Bacteria 4684
188 Ga0207665_10002090 3300025939 Bacteria 13492
189 Ga0207665_10007980 3300025939 Bacteria 6988
190 Ga0207691_10039892 3300025940 Bacteria 4342
191 Ga0207711_10001069 3300025941 Bacteria 26180
192 Ga0207689_10006003 3300025942 Bacteria 10745
193 Ga0207689_10165190 3300025942 Unclassified 1824
194 Ga0207667_10008370 3300025949 Bacteria 12292
195 Ga0207667_10013888 3300025949 Bacteria 9201
196 Ga0207640_10001527 3300025981 Bacteria 12473
197 Ga0207677_10033123 3300026023 Bacteria 3330
198 Ga0207703_10002179 3300026035 Bacteria 17192
199 Ga0207639_10022871 3300026041 Bacteria 4508
200 Ga0207678_10025680 3300026067 Bacteria 5141
201 Ga0207708_10062911 3300026075 Bacteria 2835
202 Ga0207708_10113270 3300026075 Bacteria 2107
203 Ga0207702_10005719 3300026078 Bacteria 10838
204 Ga0207702_10134320 3300026078 Bacteria 2230
205 Ga0207641_10001475 3300026088 Bacteria 23087
206 Ga0207648_10003673 3300026089 Bacteria 16055
207 Ga0207674_10007447 3300026116 Bacteria 12759
208 Ga0207675_100004396 3300026118 Bacteria 13612
209 Ga0207675_100066509 3300026118 Bacteria 3369
210 Ga0207683_10023867 3300026121 Bacteria 5261
211 Ga0207698_10150944 3300026142 Bacteria 2016
212 Ga0209983_1000658 3300027665 Bacteria 7377
213 Ga0209971_1000194 3300027682 Bacteria 18158
214 Ga0209966_1001064 3300027695 Bacteria 5023
215 Ga0207428_10000409 3300027907 Bacteria 53318
216 Ga0207428_10086501 3300027907 Bacteria 2440
217 Ga0268266_10003012 3300028379 Bacteria 17304
218 Ga0268266_10004419 3300028379 Bacteria 13471
219 Ga0268266_10013720 3300028379 Bacteria 6978
220 Ga0268266_10043931 3300028379 Bacteria 3819
221 Ga0268266_10058973 3300028379 Bacteria 3306
222 Ga0268265_10062337 3300028380 Bacteria 2865
223 Ga0268264_10001910 3300028381 Bacteria 18824
224 Ga0268264_10216077 3300028381 Bacteria 1762
225 Ga0265334_10026442 3300028573 Bacteria 2343
226 Ga0265762_1002402 3300030760 Bacteria 3393
227 Ga0307513_10000037 3300031456 Bacteria 175364
228 Ga0307509_10003073 3300031507 Bacteria 25922
229 Ga0265342_10059868 3300031712 Bacteria 2248
230 Ga0307516_10000004 3300031730 Bacteria 367451
231 Ga0307411_10074921 3300032005 Bacteria 2309
232 Ga0307510_10000001 3300033180 Bacteria 1172244
233 Ga0307510_10009909 3300033180 Bacteria 11331
234 Ga0373926_0012027 3300035083 Bacteria 2921
235 Ga0373924_0037321 3300035410 Bacteria 1978
236 Ga0373927_0017959 3300035695 Bacteria 4653
237 Ga0373937_0045919 3300036401 Bacteria 3993
238 Ga0373925_0032993 3300037068 Bacteria 3814
239 Ga0395900_0142363 3300037418 Bacteria 2455
240 Ga0395898_0003564 3300037466 Bacteria 17354
241 Ga0395905_0030480 3300037471 Bacteria 5083
242 Ga0395905_0088363 3300037471 Bacteria 2905
243 Ga0436360_0539861 3300039438 Bacteria 4022
244 Ga0451577_0003242 3300042876 Bacteria 18293
245 Ga0451577_0014942 3300042876 Bacteria 7228
246 Ga0466969_0008053 3300044656 Bacteria 5597
247 Ga0466969_0023345 3300044656 Bacteria 3188
248 Ga0466969_0061094 3300044656 Bacteria 1831
249 Ga0453683_0007537 3300044673 Bacteria 7371
250 Ga0466966_0000043 3300044684 Bacteria 93998
251 Ga0466966_0080366 3300044684 Bacteria 2031
252 Ga0466961_0000072 3300044693 Bacteria 62185
253 Ga0466963_0010436 3300044694 Bacteria 5623
254 Ga0453684_0046189 3300044712 Bacteria 5796
255 Ga0466970_0050565 3300044765 Bacteria 2217
256 Ga0466960_0004445 3300044901 Bacteria 5482
257 Ga0466959_0001118 3300045049 Bacteria 16138
258 Ga0466959_0006435 3300045049 Bacteria 8133
259 Ga0466959_0008260 3300045049 Bacteria 7351
260 Ga0466959_0053051 3300045049 Unclassified 2966
261 Ga0451576_0022226 3300045051 Bacteria 6881
262 Ga0451576_0033398 3300045051 Bacteria 5469
263 Ga0451576_0038138 3300045051 Bacteria 5086
264 Ga0466958_0000657 3300045836 Bacteria 14936
265 Ga0495580_0000770 3300046472 Bacteria 27580
266 Ga0495580_0107668 3300046472 Unclassified 1935
267 Ga0495580_0131002 3300046472 Unclassified 1740
268 Ga0495630_0006149 3300046517 Bacteria 8514
269 Ga0495674_0133343 3300047319 Bacteria 2092
270 Ga0495602_0046871 3300048088 Bacteria 3900
271 Ga0496100_0039332 3300048903 Bacteria 3003
272 Ga0496102_0008624 3300048905 Bacteria 8748
273 Ga0496102_0022658 3300048905 Bacteria 5566
274 Ga0496102_0079782 3300048905 Bacteria 3014
275 Ga0496107_0002298 3300048910 Bacteria 12337
276 Ga0496107_0119634 3300048910 Bacteria 1940
277 Ga0496108_0014527 3300048911 Bacteria 6429
278 Ga0496110_0014626 3300048913 Bacteria 6520
279 Ga0496111_0031346 3300048914 Bacteria 3787
280 Ga0496111_0060845 3300048914 Bacteria 2737
281 Ga0496114_0033043 3300048917 Bacteria 4261
282 Ga0496114_0036896 3300048917 Bacteria 4040
283 Ga0496115_0008008 3300048918 Bacteria 7798
284 Ga0496115_0023876 3300048918 Bacteria 4748
285 Ga0496115_0038007 3300048918 Bacteria 3818
286 Ga0496116_0005327 3300048919 Bacteria 11986
287 Ga0496117_0000155 3300048920 Bacteria 146091
288 Ga0496118_0000066 3300048921 Bacteria 207678
289 Ga0496118_0038972 3300048921 Bacteria 3799
290 Ga0496119_0003448 3300048922 Bacteria 16422
291 Ga0496119_0021952 3300048922 Bacteria 4590
292 Ga0496120_0001432 3300048923 Bacteria 28778
293 Ga0496121_0087997 3300048924 Bacteria 2436
294 Ga0496121_0090913 3300048924 Bacteria 2385
295 Ga0496122_0003828 3300048925 Bacteria 19343
296 Ga0496124_0004523 3300048927 Bacteria 16196
297 Ga0496124_0045651 3300048927 Bacteria 3755
298 Ga0496125_0001878 3300048928 Bacteria 28857
299 Ga0496125_0002679 3300048928 Bacteria 22728
300 Ga0496125_0039417 3300048928 Bacteria 4068
301 Ga0496126_0125874 3300048929 Bacteria 2218
302 Ga0501034_0055748 3300049571 Bacteria 3977
303 Ga0501039_0042009 3300049575 Bacteria 3533
304 Ga0501046_0172853 3300049580 Bacteria 1620
305 Ga0501047_0074534 3300049581 Bacteria 3267
306 Ga0501067_0001767 3300049583 Bacteria 11877
307 Ga0501072_0005991 3300049588 Bacteria 9266
308 Ga0501073_0010417 3300049589 Bacteria 6818
309 Ga0501076_0011258 3300049592 Bacteria 6659
310 Ga0501076_0205178 3300049592 Bacteria 1610
311 Ga0501080_0186949 3300049742 Unclassified 1904
312 Ga0501081_0037687 3300049743 Bacteria 3300
313 Ga0501045_0048610 3300049824 Bacteria 3092
314 nmdc:mga05p37_254598_c1 3300050507 Bacteria 2104
315 nmdc:mga05p37_85742_c1 3300050507 Bacteria 3881
316 nmdc:mga05p37_95324_c2 3300050507 Bacteria 2409
317 nmdc:mga09592_159309_c1 3300050508 Bacteria 1949
318 nmdc:mga09592_58131_c1 3300050508 Bacteria 3270
319 nmdc:mga0qj67_17709_c1 3300050509 Bacteria 5421
320 nmdc:mga06r32_1229_c1 3300050510 Bacteria 23059
321 nmdc:mga06r32_18244_c1 3300050510 Bacteria 6422
322 nmdc:mga06r32_647_c1 3300050510 Bacteria 30393
323 nmdc:mga06r32_86576_c1 3300050510 Bacteria 3056
324 nmdc:mga08y16_38720_c1 3300050511 Bacteria 5004
325 nmdc:mga08y16_5056_c1 3300050511 Bacteria 13784
326 nmdc:mga0n895_124124_c1 3300050512 Bacteria 2604
327 nmdc:mga0n895_17987_c1 3300050512 Bacteria 6531
328 nmdc:mga0n895_5447_c1 3300050512 Bacteria 10639
329 nmdc:mga0n895_56645_c1 3300050512 Bacteria 3862
330 nmdc:mga0n895_66144_c1 3300050512 Bacteria 3579
331 nmdc:mga0rr50_142604_c1 3300050513 Bacteria 1929
332 nmdc:mga0rr50_20114_c1 3300050513 Bacteria 4523
333 nmdc:mga0rr50_53063_c1 3300050513 Bacteria 3015
334 nmdc:mga08x19_41470_c1 3300050514 Bacteria 2931
335 nmdc:mga08x19_5047_c1 3300050514 Bacteria 7809
336 nmdc:mga0a205_115170_c1 3300050515 Bacteria 2587
337 nmdc:mga0a205_14475_c1 3300050515 Bacteria 7358
338 nmdc:mga0a205_3955_c1 3300050515 Bacteria 13254
339 nmdc:mga0a205_67860_c1 3300050515 Bacteria 3445
340 Ga0500583_0000981 3300053092 Bacteria 8131
341 Ga0500583_0008592 3300053092 Bacteria 3675
342 Ga0500590_013834 3300053148 Bacteria 4150
343 Ga0500645_000158 3300053730 Bacteria 52467
344 Ga0500645_002562 3300053730 Bacteria 8006
345 Ga0501084_0034105 3300054114 Bacteria 4256
346 Ga0501082_0065225 3300060353 Bacteria 3136
347 Ga0466962_0003031 3300061719 Bacteria 8011
348 2600815063 2600255067 Bacteria 6795583
349 2881103710 2881101125 Bacteria 4590519
350 2939631901 2939631187 Bacteria 6118131
351 Ga0466959_0001965
352 rootH1_10034882
353 Ga0070676_10004627
354 Ga0070676_10064059
355 Ga0070690_100022690
356 Ga0070670_100004816
357 Ga0068869_100001151
358 Ga0068869_100002683
359 Ga0070666_10055590
360 Ga0070680_100004029
361 Ga0070682_100001614
362 Ga0068868_100019564
363 Ga0070691_10005595
364 Ga0070661_100004694
365 Ga0070692_10002049
366 Ga0070668_100111705
367 Ga0070669_100047700
368 Ga0070673_100008745
369 Ga0070659_100001390
370 Ga0070703_10004189
371 Ga0070709_10001655
372 Ga0070714_100049467
373 Ga0070713_100013279
374 Ga0070713_100061182
375 Ga0070713_100075191
376 Ga0070711_100008361
377 Ga0070711_100028784
378 Ga0070711_100038273
379 Ga0070705_100001186
380 Ga0070700_100024405
381 Ga0070700_100071987
382 Ga0070694_100000441
383 Ga0070708_100041389
384 Ga0070708_100278994
385 Ga0070663_100010033
386 Ga0070678_100003159
387 Ga0070662_100011376
388 Ga0070681_10005057
389 Ga0070681_10163105
390 Ga0068867_100120419
391 Ga0070706_100012720
392 Ga0070706_100038469
393 Ga0070707_100105072
394 Ga0070707_100106764
395 Ga0070698_100003437
396 Ga0070698_100005218
397 Ga0070699_100002495
398 Ga0070699_100008335
399 Ga0070684_100004733
400 Ga0070697_100002024
401 Ga0070697_100007024
402 Ga0070697_100022905
403 Ga0068853_100001362
404 Ga0070672_100026050
405 Ga0070695_100005164
406 Ga0070696_100008864
407 Ga0070696_100011067
408 Ga0070665_100002471
409 Ga0070665_100018817
410 Ga0070665_100043168
411 Ga0070665_100120488
412 Ga0070704_100002230
413 Ga0070704_100062156
414 Ga0068855_100002281
415 Ga0068855_100004690
416 Ga0068855_100030519
417 Ga0070664_100068347
418 Ga0068857_100048018
419 Ga0068854_100000353
420 Ga0068856_100005843
421 Ga0068864_100012160
422 Ga0068861_100012784
423 Ga0068861_100039174
424 Ga0068861_100136481
425 Ga0068870_10002800
426 Ga0068870_10026079
427 Ga0068863_100009629
428 Ga0068863_100014609
429 Ga0068863_100026598
430 Ga0068863_100029697
431 Ga0068858_100013477
432 Ga0068858_100084895
433 Ga0068860_100012755
434 Ga0068860_100041893
435 Ga0068862_100019358
436 Ga0068862_100032173
437 Ga0068862_100068406
438 Ga0068862_100094250
439 Ga0068862_100103575
440 Ga0081538_10009058
441 Ga0070715_10006812
442 Ga0070715_10012734
443 Ga0070715_10062864
444 Ga0070716_100004433
445 Ga0070716_100007161
446 Ga0070716_100050833
447 Ga0070712_100000702
448 Ga0070712_100018195
449 Ga0097621_100158616
450 Ga0075428_100008367
451 Ga0075428_100129853
452 Ga0075428_100169686
453 Ga0075431_100002099
454 Ga0075431_100007043
455 Ga0075431_100017886
456 Ga0075431_100046996
457 Ga0075431_100241419
458 Ga0075433_10010766
459 Ga0075433_10021442
460 Ga0075433_10045692
461 Ga0075434_100005054
462 Ga0075434_100022280
463 Ga0075434_100048174
464 Ga0075434_100069973
465 Ga0075434_100081464
466 Ga0068865_100020414
467 Ga0075436_100025960
468 Ga0075436_100033005
469 Ga0075435_100017324
470 Ga0075435_100072445
471 Ga0099794_10006488
472 Ga0105251_10007975
473 Ga0105240_10001523
474 Ga0105240_10002946
475 Ga0105240_10016293
476 Ga0105240_10098312
477 Ga0111539_10000370
478 Ga0111539_10048380
479 Ga0111539_10160713
480 Ga0114129_10100465
481 Ga0114129_10247094
482 Ga0114129_10297335
483 Ga0105243_10005287
484 Ga0105241_10000218
485 Ga0105241_10006876
486 Ga0105242_10006109
487 Ga0105242_10021044
488 Ga0105248_10001432
489 Ga0105248_10121257
490 Ga0105238_10087090
491 Ga0105239_10072021
492 Ga0157373_10001408
493 Ga0157369_10000598
494 Ga0157369_10027301
495 Ga0157372_10005389
496 Ga0157372_10348768
497 Ga0157375_10110159
498 Ga0157379_10094603
499 Ga0182007_10007605
500 Ga0163161_10005761
501 Ga0206356_10796433
502 Ga0207713_1027624
503 Ga0207653_10001831
504 Ga0207688_10021890
505 Ga0207699_10002402
506 Ga0207645_10004510
507 Ga0207645_10006049
508 Ga0207645_10083101
509 Ga0207643_10000157
510 Ga0207643_10009807
511 Ga0207684_10001957
512 Ga0207684_10022352
513 Ga0207684_10069265
514 Ga0207654_10008457
515 Ga0207707_10000258
516 Ga0207707_10002863
517 Ga0207695_10007599
518 Ga0207695_10023766
519 Ga0207693_10001747
520 Ga0207663_10003605
521 Ga0207663_10009761
522 Ga0207660_10009632
523 Ga0207660_10012965
524 Ga0207660_10038887
525 Ga0207657_10000373
526 Ga0207649_10006640
527 Ga0207652_10001053
528 Ga0207646_10001458
529 Ga0207646_10038301
530 Ga0207687_10106513
531 Ga0207700_10146801
532 Ga0207690_10000948
533 Ga0207706_10001026
534 Ga0207706_10011866
535 Ga0207686_10125837
536 Ga0207709_10012459
537 Ga0207665_10002090
538 Ga0207665_10007980
539 Ga0207691_10039892
540 Ga0207711_10001069
541 Ga0207689_10006003
542 Ga0207689_10165190
543 Ga0207667_10008370
544 Ga0207667_10013888
545 Ga0207640_10001527
546 Ga0207677_10033123
547 Ga0207703_10002179
548 Ga0207639_10022871
549 Ga0207678_10025680
550 Ga0207708_10062911
551 Ga0207708_10113270
552 Ga0207702_10005719
553 Ga0207702_10134320
554 Ga0207641_10001475
555 Ga0207648_10003673
556 Ga0207674_10007447
557 Ga0207675_100004396
558 Ga0207675_100066509
559 Ga0207683_10023867
560 Ga0207698_10150944
561 Ga0209983_1000658
562 Ga0209971_1000194
563 Ga0209966_1001064
564 Ga0207428_10000409
565 Ga0207428_10086501
566 Ga0268266_10003012
567 Ga0268266_10004419
568 Ga0268266_10013720
569 Ga0268266_10043931
570 Ga0268266_10058973
571 Ga0268265_10062337
572 Ga0268264_10001910
573 Ga0268264_10216077
574 Ga0265334_10026442
575 Ga0265762_1002402
576 Ga0307513_10000037
577 Ga0307509_10003073
578 Ga0265342_10059868
579 Ga0307516_10000004
580 Ga0307411_10074921
581 Ga0307510_10000001
582 Ga0307510_10009909
583 Ga0373926_0012027
584 Ga0373924_0037321
585 Ga0373927_0017959
586 Ga0373937_0045919
587 Ga0373925_0032993
588 Ga0395900_0142363
589 Ga0395898_0003564
590 Ga0395905_0030480
591 Ga0395905_0088363
592 Ga0436360_0539861
593 Ga0451577_0003242
594 Ga0451577_0014942
595 Ga0466969_0008053
596 Ga0466969_0023345
597 Ga0466969_0061094
598 Ga0453683_0007537
599 Ga0466966_0000043
600 Ga0466966_0080366
601 Ga0466961_0000072
602 Ga0466963_0010436
603 Ga0453684_0046189
604 Ga0466970_0050565
605 Ga0466960_0004445
606 Ga0466959_0001118
607 Ga0466959_0006435
608 Ga0466959_0008260
609 Ga0466959_0053051
610 Ga0451576_0022226
611 Ga0451576_0033398
612 Ga0451576_0038138
613 Ga0466958_0000657
614 Ga0495580_0000770
615 Ga0495580_0107668
616 Ga0495580_0131002
617 Ga0495630_0006149
618 Ga0495674_0133343
619 Ga0495602_0046871
620 Ga0496100_0039332
621 Ga0496102_0008624
622 Ga0496102_0022658
623 Ga0496102_0079782
624 Ga0496107_0002298
625 Ga0496107_0119634
626 Ga0496108_0014527
627 Ga0496110_0014626
628 Ga0496111_0031346
629 Ga0496111_0060845
630 Ga0496114_0033043
631 Ga0496114_0036896
632 Ga0496115_0008008
633 Ga0496115_0023876
634 Ga0496115_0038007
635 Ga0496116_0005327
636 Ga0496117_0000155
637 Ga0496118_0000066
638 Ga0496118_0038972
639 Ga0496119_0003448
640 Ga0496119_0021952
641 Ga0496120_0001432
642 Ga0496121_0087997
643 Ga0496121_0090913
644 Ga0496122_0003828
645 Ga0496124_0004523
646 Ga0496124_0045651
647 Ga0496125_0001878
648 Ga0496125_0002679
649 Ga0496125_0039417
650 Ga0496126_0125874
651 Ga0501034_0055748
652 Ga0501039_0042009
653 Ga0501046_0172853
654 Ga0501047_0074534
655 Ga0501067_0001767
656 Ga0501072_0005991
657 Ga0501073_0010417
658 Ga0501076_0011258
659 Ga0501076_0205178
660 Ga0501080_0186949
661 Ga0501081_0037687
662 Ga0501045_0048610
663 nmdc:mga05p37_254598_c1
664 nmdc:mga05p37_85742_c1
665 nmdc:mga05p37_95324_c2
666 nmdc:mga09592_159309_c1
667 nmdc:mga09592_58131_c1
668 nmdc:mga0qj67_17709_c1
669 nmdc:mga06r32_1229_c1
670 nmdc:mga06r32_18244_c1
671 nmdc:mga06r32_647_c1
672 nmdc:mga06r32_86576_c1
673 nmdc:mga08y16_38720_c1
674 nmdc:mga08y16_5056_c1
675 nmdc:mga0n895_124124_c1
676 nmdc:mga0n895_17987_c1
677 nmdc:mga0n895_5447_c1
678 nmdc:mga0n895_56645_c1
679 nmdc:mga0n895_66144_c1
680 nmdc:mga0rr50_142604_c1
681 nmdc:mga0rr50_20114_c1
682 nmdc:mga0rr50_53063_c1
683 nmdc:mga08x19_41470_c1
684 nmdc:mga08x19_5047_c1
685 nmdc:mga0a205_115170_c1
686 nmdc:mga0a205_14475_c1
687 nmdc:mga0a205_3955_c1
688 nmdc:mga0a205_67860_c1
689 Ga0500583_0000981
690 Ga0500583_0008592
691 Ga0500590_013834
692 Ga0500645_000158
693 Ga0500645_002562
694 Ga0501084_0034105
695 Ga0501082_0065225
696 Ga0466962_0003031
697 2600815063
698 2881103710
699 2939631901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20169

DUF6537

Family of unknown function (DUF6537)

264

501

0.92

PF01558

POR

Pyruvate ferredoxin/flavodoxin oxidoreductase

19

210

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g2e-assembly1.cif.gz_D structure of putative oorc subunit of 2-oxoglutarate:acceptor oxidoreductase from campylobacter jejuni 0.8163 5 211
3on3-assembly2.cif.gz_A the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca 0.8021 6 210
3g2e-assembly1.cif.gz_D structure of putative oorc subunit of 2-oxoglutarate:acceptor oxidoreductase from campylobacter jejuni 0.7962 5 211
3on3-assembly2.cif.gz_A the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca 0.7933 6 210
3on3-assembly3.cif.gz_B the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca 0.789 5 210
ID Description Score Start End Superfamily
af_Q2FZ05_1_182_3.40.920.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.7784 1 209 3.40.920.10
3on3A00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.7727 6 210 3.40.920.10
af_Q57717_1_177_3.40.920.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.7701 6 209 3.40.920.10
2raaA00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.7682 4 205 3.40.920.10
3g2eC00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.7657 5 211 3.40.920.10
ID Description Score Start End GO Terms
AF-A0A529LBX9-F1-model_v4 Pyruvate/ketoisovalerate oxidoreductase catalytic domain-containing protein 0.9535 2 108 GO:0016903
AF-A0A3C1Y224-F1-model_v4 Uncharacterized protein 0.948 1 71 GO:0016491
AF-A0A436S0D2-F1-model_v4 Pyruvate/ketoisovalerate oxidoreductase catalytic domain-containing protein 0.9475 3 198 GO:0016903
AF-A0A3N5EW21-F1-model_v4 Pyruvate/ketoisovalerate oxidoreductase catalytic domain-containing protein 0.9463 12 186 GO:0016903
AF-A0A2M8IYR1-F1-model_v4 Indolepyruvate oxidoreductase subunit B (EC 1.2.7.8) 0.9449 4 209 GO:0043805

Map