F417995

General Info

Members Datasets Scaffolds Average Seq Length
349 174 698 164

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0102722|Ga0495648_0102722_536_1039
Length 167
Sequence MAGAGQHIVKVRAATLADIRIVGRWGAELVSLHHGFDPQRFIQAGPGTPAKYASFIESQLVLPDVIVLVAEDEMSLLGYVYAANEGNDYMSLRGPAGVIHDIFVDPARRGQGIGGALLERAIEELRGKGAGLFVLATAYRNEAAQRLFAAVGFRPTMIEMTQSPRGT

Samples

Sample ID Description Type Environment
1 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
123 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
171 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
172 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
173 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
174 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.3
Rhizosphere 90.83
Stem 0
Stem Tuber 0
Unclassified 16.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495648_0102722 3300046524 Bacteria 1574
2 JGI24740J21852_10027792 3300001979 Bacteria 1878
3 JGI24740J21852_10063507 3300001979 Unclassified 1011
4 JGI24739J22299_10008945 3300001989 Bacteria 3736
5 JGI24739J22299_10078742 3300001989 Bacteria 1015
6 JGI24737J22298_10003359 3300001990 Bacteria 5662
7 JGI24737J22298_10029811 3300001990 Bacteria 1709
8 JGI24737J22298_10063207 3300001990 Bacteria 1111
9 JGI24735J21928_10011141 3300002067 Bacteria 2855
10 JGI24735J21928_10014580 3300002067 Bacteria 2460
11 JGI24738J21930_10000961 3300002075 Bacteria 8268
12 JGI24738J21930_10029558 3300002075 Bacteria 1120
13 Ga0065715_10048475 3300005293 Bacteria 974
14 Ga0070658_10000130 3300005327 Bacteria 66295
15 Ga0070658_10009112 3300005327 Bacteria 7978
16 Ga0070658_10026100 3300005327 Bacteria 4686
17 Ga0070658_10078557 3300005327 Bacteria 2709
18 Ga0070658_10084843 3300005327 Bacteria 2604
19 Ga0070676_10298371 3300005328 Bacteria 1091
20 Ga0070676_10363821 3300005328 Bacteria 997
21 Ga0070683_100139123 3300005329 Bacteria 2300
22 Ga0070670_100011521 3300005331 Bacteria 7563
23 Ga0070670_100075022 3300005331 Bacteria 2906
24 Ga0070670_100484893 3300005331 Unclassified 1098
25 Ga0068869_100661743 3300005334 Unclassified 887
26 Ga0070666_10075855 3300005335 Bacteria 2293
27 Ga0070666_10095375 3300005335 Bacteria 2047
28 Ga0070680_100003312 3300005336 Bacteria 12018
29 Ga0070680_100006208 3300005336 Bacteria 9065
30 Ga0070682_100459840 3300005337 Bacteria 977
31 Ga0068868_100502215 3300005338 Bacteria 1062
32 Ga0068868_100522334 3300005338 Bacteria 1042
33 Ga0070660_100000391 3300005339 Bacteria 29107
34 Ga0070660_100066339 3300005339 Bacteria 2809
35 Ga0070660_100123376 3300005339 Bacteria 2068
36 Ga0070660_100141951 3300005339 Bacteria 1927
37 Ga0070660_100298041 3300005339 Unclassified 1321
38 Ga0070660_100580446 3300005339 Bacteria 936
39 Ga0070660_100606891 3300005339 Bacteria 915
40 Ga0070661_100000206 3300005344 Bacteria 48811
41 Ga0070661_100021844 3300005344 Bacteria 4577
42 Ga0070661_100080328 3300005344 Unclassified 2407
43 Ga0070661_100184859 3300005344 Bacteria 1587
44 Ga0070661_101139836 3300005344 Bacteria 651
45 Ga0070675_101356233 3300005354 Bacteria 656
46 Ga0070671_100011023 3300005355 Bacteria 7255
47 Ga0070671_100019594 3300005355 Bacteria 5509
48 Ga0070671_100032201 3300005355 Bacteria 4336
49 Ga0070671_100291720 3300005355 Unclassified 1388
50 Ga0070673_100137322 3300005364 Bacteria 2059
51 Ga0070673_100245815 3300005364 Bacteria 1557
52 Ga0070659_100000884 3300005366 Bacteria 21912
53 Ga0070659_100006353 3300005366 Bacteria 8535
54 Ga0070659_100037352 3300005366 Bacteria 3786
55 Ga0070659_100230680 3300005366 Bacteria 1530
56 Ga0070667_100035369 3300005367 Bacteria 4184
57 Ga0070713_100040965 3300005436 Bacteria 3770
58 Ga0070710_10225491 3300005437 Unclassified 1194
59 Ga0070710_10259795 3300005437 Unclassified 1119
60 Ga0070663_100006000 3300005455 Bacteria 7269
61 Ga0070663_100304143 3300005455 Bacteria 1277
62 Ga0070678_100021464 3300005456 Bacteria 4258
63 Ga0070662_100000107 3300005457 Bacteria 46051
64 Ga0070681_10016414 3300005458 Bacteria 7392
65 Ga0070681_10019474 3300005458 Bacteria 6793
66 Ga0070681_10262640 3300005458 Unclassified 1638
67 Ga0068867_100135132 3300005459 Bacteria 1921
68 Ga0070685_10534775 3300005466 Unclassified 834
69 Ga0070679_100334502 3300005530 Bacteria 1463
70 Ga0070679_100700010 3300005530 Bacteria 956
71 Ga0070684_100097050 3300005535 Bacteria 2628
72 Ga0068853_100000172 3300005539 Bacteria 45090
73 Ga0068853_100008708 3300005539 Bacteria 8162
74 Ga0068853_100036316 3300005539 Bacteria 4189
75 Ga0070672_100813831 3300005543 Unclassified 822
76 Ga0070696_100318155 3300005546 Bacteria 1197
77 Ga0070693_100000967 3300005547 Bacteria 12766
78 Ga0070693_100169012 3300005547 Unclassified 1399
79 Ga0070665_100005356 3300005548 Bacteria 13251
80 Ga0068855_100003916 3300005563 Bacteria 18174
81 Ga0068855_100010468 3300005563 Bacteria 11192
82 Ga0068855_100440460 3300005563 Unclassified 1423
83 Ga0070664_100000032 3300005564 Bacteria 88298
84 Ga0070664_100077460 3300005564 Bacteria 2858
85 Ga0070664_100101206 3300005564 Bacteria 2506
86 Ga0068857_100017295 3300005577 Bacteria 6318
87 Ga0068857_100334979 3300005577 Unclassified 1399
88 Ga0068854_100033369 3300005578 Bacteria 3589
89 Ga0068854_100074756 3300005578 Bacteria 2486
90 Ga0068856_100000364 3300005614 Bacteria 49715
91 Ga0068856_100031931 3300005614 Bacteria 5152
92 Ga0068856_100177115 3300005614 Unclassified 2145
93 Ga0068856_100379959 3300005614 Bacteria 1432
94 Ga0068856_101008761 3300005614 Bacteria 851
95 Ga0070702_100094262 3300005615 Bacteria 1822
96 Ga0068852_100000780 3300005616 Bacteria 20902
97 Ga0068852_100004552 3300005616 Bacteria 9816
98 Ga0068852_100084731 3300005616 Bacteria 2822
99 Ga0068852_100133607 3300005616 Bacteria 2288
100 Ga0068859_100066278 3300005617 Bacteria 3646
101 Ga0068859_100450870 3300005617 Bacteria 1383
102 Ga0068864_100005507 3300005618 Bacteria 10375
103 Ga0068864_100084452 3300005618 Bacteria 2790
104 Ga0068864_100461269 3300005618 Bacteria 1216
105 Ga0068866_10056465 3300005718 Bacteria 2019
106 Ga0068851_10029741 3300005834 Unclassified 2706
107 Ga0068851_10120173 3300005834 Bacteria 1411
108 Ga0068858_101877231 3300005842 Bacteria 592
109 Ga0068860_100341982 3300005843 Unclassified 1471
110 Ga0070717_10028934 3300006028 Bacteria 4441
111 Ga0070716_100045514 3300006173 Bacteria 2464
112 Ga0070712_100010413 3300006175 Bacteria 5866
113 Ga0068871_101104328 3300006358 Bacteria 742
114 Ga0068865_100026291 3300006881 Bacteria 3836
115 Ga0097620_100066278 3300006931 Bacteria 3646
116 Ga0097620_100450868 3300006931 Bacteria 1383
117 Ga0105245_10017352 3300009098 Bacteria 6280
118 Ga0105248_10000238 3300009177 Bacteria 63658
119 Ga0105248_10001772 3300009177 Bacteria 24028
120 Ga0105237_10106391 3300009545 Bacteria 2797
121 Ga0105238_10201680 3300009551 Bacteria 1965
122 Ga0105246_10298670 3300011119 Unclassified 1299
123 Ga0157373_10246642 3300013100 Unclassified 1263
124 Ga0157373_10248890 3300013100 Bacteria 1257
125 Ga0157371_10005248 3300013102 Bacteria 10999
126 Ga0157371_10040705 3300013102 Bacteria 3317
127 Ga0157370_10043581 3300013104 Bacteria 4316
128 Ga0157370_10254855 3300013104 Unclassified 1623
129 Ga0157369_10140761 3300013105 Bacteria 2553
130 Ga0157369_10230596 3300013105 Bacteria 1936
131 Ga0157369_10275254 3300013105 Unclassified 1754
132 Ga0157374_10053682 3300013296 Bacteria 3758
133 Ga0157375_10164964 3300013308 Bacteria 2359
134 Ga0163163_10000371 3300014325 Bacteria 43097
135 Ga0157379_10033120 3300014968 Bacteria 4608
136 Ga0157376_10116741 3300014969 Bacteria 2359
137 Ga0207656_10079141 3300025321 Unclassified 1474
138 Ga0207682_10173728 3300025893 Bacteria 981
139 Ga0207680_10022556 3300025903 Bacteria 3426
140 Ga0207647_10008620 3300025904 Bacteria 7294
141 Ga0207647_10011134 3300025904 Bacteria 6319
142 Ga0207699_10023448 3300025906 Bacteria 3359
143 Ga0207645_10012436 3300025907 Bacteria 5773
144 Ga0207705_10000200 3300025909 Bacteria 60434
145 Ga0207705_10004140 3300025909 Bacteria 10999
146 Ga0207705_10016629 3300025909 Bacteria 5269
147 Ga0207705_10028159 3300025909 Bacteria 4006
148 Ga0207705_10065289 3300025909 Unclassified 2631
149 Ga0207654_10042700 3300025911 Bacteria 2567
150 Ga0207707_10039243 3300025912 Bacteria 4140
151 Ga0207707_10079952 3300025912 Bacteria 2854
152 Ga0207707_10117667 3300025912 Bacteria 2323
153 Ga0207695_10379500 3300025913 Bacteria 1299
154 Ga0207671_10020093 3300025914 Bacteria 5093
155 Ga0207671_10263526 3300025914 Bacteria 1357
156 Ga0207693_10020143 3300025915 Bacteria 5306
157 Ga0207660_10012224 3300025917 Bacteria 5609
158 Ga0207657_10000468 3300025919 Bacteria 42779
159 Ga0207657_10003153 3300025919 Bacteria 17635
160 Ga0207657_10004240 3300025919 Bacteria 15196
161 Ga0207657_10039319 3300025919 Bacteria 4205
162 Ga0207657_10172464 3300025919 Bacteria 1752
163 Ga0207649_10000362 3300025920 Bacteria 34070
164 Ga0207649_10005750 3300025920 Bacteria 6714
165 Ga0207649_10183649 3300025920 Unclassified 1465
166 Ga0207649_10198092 3300025920 Bacteria 1417
167 Ga0207652_10029444 3300025921 Bacteria 4591
168 Ga0207652_10616343 3300025921 Bacteria 972
169 Ga0207681_10129483 3300025923 Bacteria 1864
170 Ga0207694_10006948 3300025924 Bacteria 8594
171 Ga0207694_10190028 3300025924 Unclassified 1668
172 Ga0207694_10835551 3300025924 Bacteria 778
173 Ga0207650_10057695 3300025925 Bacteria 2888
174 Ga0207650_10072909 3300025925 Bacteria 2585
175 Ga0207650_10457099 3300025925 Bacteria 1063
176 Ga0207659_10962529 3300025926 Unclassified 734
177 Ga0207700_10028162 3300025928 Bacteria 3946
178 Ga0207644_10002090 3300025931 Bacteria 12933
179 Ga0207644_10024790 3300025931 Bacteria 4120
180 Ga0207644_10122048 3300025931 Bacteria 1984
181 Ga0207644_10350589 3300025931 Bacteria 1198
182 Ga0207690_10000062 3300025932 Bacteria 96511
183 Ga0207690_10026604 3300025932 Bacteria 3644
184 Ga0207690_10186400 3300025932 Bacteria 1566
185 Ga0207690_10214537 3300025932 Bacteria 1469
186 Ga0207706_10000211 3300025933 Bacteria 63984
187 Ga0207706_10004449 3300025933 Bacteria 13166
188 Ga0207706_10923991 3300025933 Bacteria 736
189 Ga0207669_10029516 3300025937 Bacteria 3034
190 Ga0207704_10019876 3300025938 Bacteria 3539
191 Ga0207665_10046965 3300025939 Bacteria 2894
192 Ga0207691_10015370 3300025940 Bacteria 7283
193 Ga0207711_10001518 3300025941 Bacteria 21567
194 Ga0207711_10001908 3300025941 Bacteria 18939
195 Ga0207689_10624588 3300025942 Bacteria 907
196 Ga0207689_10629227 3300025942 Unclassified 904
197 Ga0207661_10115424 3300025944 Bacteria 2278
198 Ga0207661_10598356 3300025944 Bacteria 1012
199 Ga0207679_10000506 3300025945 Bacteria 26758
200 Ga0207679_10048390 3300025945 Bacteria 3095
201 Ga0207679_10275622 3300025945 Bacteria 1440
202 Ga0207679_10624806 3300025945 Unclassified 973
203 Ga0207667_10006933 3300025949 Bacteria 13694
204 Ga0207667_10033992 3300025949 Bacteria 5477
205 Ga0207667_10182339 3300025949 Bacteria 2156
206 Ga0207667_10850036 3300025949 Unclassified 907
207 Ga0207651_10186576 3300025960 Bacteria 1650
208 Ga0207640_10072020 3300025981 Bacteria 2330
209 Ga0207640_10519984 3300025981 Bacteria 994
210 Ga0207658_10041302 3300025986 Bacteria 3339
211 Ga0207658_10165988 3300025986 Bacteria 1814
212 Ga0207677_11642708 3300026023 Unclassified 595
213 Ga0207639_10000532 3300026041 Bacteria 26198
214 Ga0207639_10000990 3300026041 Bacteria 19349
215 Ga0207639_10135184 3300026041 Bacteria 2046
216 Ga0207639_10186040 3300026041 Bacteria 1771
217 Ga0207678_10004245 3300026067 Bacteria 12855
218 Ga0207678_10021992 3300026067 Bacteria 5590
219 Ga0207678_10236364 3300026067 Unclassified 1565
220 Ga0207702_10001280 3300026078 Bacteria 25252
221 Ga0207702_10372990 3300026078 Bacteria 1370
222 Ga0207702_10528115 3300026078 Unclassified 1152
223 Ga0207648_10000889 3300026089 Bacteria 33700
224 Ga0207676_10061178 3300026095 Bacteria 2981
225 Ga0207676_10183631 3300026095 Bacteria 1834
226 Ga0207676_10304439 3300026095 Bacteria 1456
227 Ga0207674_10010822 3300026116 Bacteria 10285
228 Ga0207674_10121138 3300026116 Bacteria 2584
229 Ga0207674_10550282 3300026116 Bacteria 1115
230 Ga0207675_100932222 3300026118 Bacteria 885
231 Ga0207683_10034550 3300026121 Bacteria 4394
232 Ga0207698_10000775 3300026142 Bacteria 18575
233 Ga0207698_10010944 3300026142 Bacteria 5860
234 Ga0207698_10110890 3300026142 Bacteria 2299
235 Ga0268266_10039465 3300028379 Bacteria 4022
236 Ga0268265_10070203 3300028380 Bacteria 2723
237 Ga0268264_10339277 3300028381 Unclassified 1427
238 Ga0307409_100523977 3300031995 Unclassified 1158
239 Ga0373959_0118990 3300034820 Bacteria 644
240 Ga0373952_0099335 3300035092 Unclassified 766
241 Ga0373954_0115725 3300035118 Bacteria 1299
242 Ga0373956_0290876 3300035119 Bacteria 778
243 Ga0373955_0017213 3300035172 Bacteria 3572
244 Ga0373961_0061271 3300035241 Unclassified 1142
245 Ga0373935_0045407 3300035692 Bacteria 2773
246 Ga0373933_0181243 3300035724 Bacteria 1343
247 Ga0373937_0135269 3300036401 Bacteria 2304
248 Ga0395899_0012482 3300037312 Bacteria 6508
249 Ga0395899_0049824 3300037312 Unclassified 3112
250 Ga0395899_0096601 3300037312 Bacteria 2136
251 Ga0395900_0008516 3300037418 Bacteria 10545
252 Ga0395900_0039261 3300037418 Unclassified 4877
253 Ga0395900_0056637 3300037418 Bacteria 4034
254 Ga0395900_0079083 3300037418 Bacteria 3378
255 Ga0395900_0193526 3300037418 Bacteria 2061
256 Ga0395900_0398293 3300037418 Bacteria 1341
257 Ga0395900_0791709 3300037418 Bacteria 876
258 Ga0395900_1205330 3300037418 Unclassified 672
259 Ga0395900_1261512 3300037418 Bacteria 653
260 Ga0395898_0061307 3300037466 Unclassified 3654
261 Ga0395898_0093511 3300037466 Bacteria 2889
262 Ga0395898_0208314 3300037466 Bacteria 1865
263 Ga0395898_0492095 3300037466 Unclassified 1167
264 Ga0395905_0004708 3300037471 Bacteria 14097
265 Ga0395905_0199193 3300037471 Bacteria 1878
266 Ga0395905_0215012 3300037471 Unclassified 1800
267 Ga0395905_0240008 3300037471 Bacteria 1693
268 Ga0395905_0290663 3300037471 Unclassified 1521
269 Ga0395905_0369210 3300037471 Bacteria 1328
270 Ga0395905_0398246 3300037471 Bacteria 1271
271 Ga0395905_0544752 3300037471 Bacteria 1061
272 Ga0395905_0589770 3300037471 Unclassified 1013
273 Ga0395905_0781607 3300037471 Unclassified 857
274 Ga0395901_0030623 3300038443 Bacteria 5544
275 Ga0395901_0131249 3300038443 Unclassified 2632
276 Ga0395901_0161600 3300038443 Bacteria 2352
277 Ga0395901_0252880 3300038443 Bacteria 1835
278 Ga0395901_0273228 3300038443 Bacteria 1757
279 Ga0395901_0361894 3300038443 Unclassified 1496
280 Ga0466965_0651707 3300044683 Unclassified 601
281 Ga0466961_0016718 3300044693 Bacteria 4718
282 Ga0466963_0005175 3300044694 Bacteria 7615
283 Ga0466963_0011096 3300044694 Bacteria 5479
284 Ga0466963_0013204 3300044694 Bacteria 5069
285 Ga0466963_0017121 3300044694 Bacteria 4514
286 Ga0466963_0057595 3300044694 Unclassified 2588
287 Ga0466963_0697584 3300044694 Bacteria 716
288 Ga0466964_0027307 3300044706 Unclassified 2241
289 Ga0466964_0192046 3300044706 Bacteria 975
290 Ga0466971_0026775 3300044719 Bacteria 2579
291 Ga0466971_0238399 3300044719 Bacteria 865
292 Ga0466970_0061713 3300044765 Bacteria 2009
293 Ga0466957_0001433 3300044842 Bacteria 12457
294 Ga0466957_0003522 3300044842 Bacteria 8615
295 Ga0466957_0065666 3300044842 Unclassified 2235
296 Ga0466959_0061640 3300045049 Bacteria 2727
297 Ga0466959_0403896 3300045049 Unclassified 928
298 Ga0466958_0019234 3300045836 Bacteria 3974
299 Ga0466958_0207650 3300045836 Bacteria 1247
300 Ga0466958_0228204 3300045836 Unclassified 1189
301 Ga0466967_0003642 3300045976 Bacteria 10129
302 Ga0466967_0013752 3300045976 Bacteria 6270
303 Ga0466967_0048533 3300045976 Bacteria 3707
304 Ga0466967_0059622 3300045976 Bacteria 3379
305 Ga0466967_0123824 3300045976 Unclassified 2392
306 Ga0466967_0256471 3300045976 Bacteria 1672
307 Ga0466967_0512548 3300045976 Bacteria 1178
308 Ga0466967_0683575 3300045976 Bacteria 1016
309 Ga0466967_0975734 3300045976 Bacteria 843
310 Ga0495621_0054560 3300046539 Bacteria 1437
311 Ga0495669_0020437 3300046684 Bacteria 2866
312 Ga0495602_0103778 3300048088 Bacteria 2326
313 Ga0496100_0111428 3300048903 Bacteria 1902
314 Ga0496101_0311027 3300048904 Bacteria 1235
315 Ga0496102_0180636 3300048905 Bacteria 1988
316 Ga0496103_0169322 3300048906 Bacteria 1402
317 Ga0496104_0026150 3300048907 Bacteria 5385
318 Ga0496105_0132343 3300048908 Unclassified 2056
319 Ga0496106_0125869 3300048909 Bacteria 2006
320 Ga0496106_0745765 3300048909 Bacteria 779
321 Ga0496107_0102720 3300048910 Bacteria 2096
322 Ga0496108_0339468 3300048911 Bacteria 1310
323 Ga0496109_0052852 3300048912 Bacteria 3704
324 Ga0496109_0265042 3300048912 Bacteria 1618
325 Ga0496110_0008265 3300048913 Bacteria 8368
326 Ga0496110_0031776 3300048913 Bacteria 4557
327 Ga0496111_0035600 3300048914 Bacteria 3559
328 Ga0496111_0051086 3300048914 Bacteria 2984
329 Ga0496112_0045434 3300048915 Bacteria 4305
330 Ga0496112_0090688 3300048915 Bacteria 3025
331 Ga0496112_1187651 3300048915 Unclassified 680
332 Ga0496113_0015623 3300048916 Bacteria 5226
333 Ga0496113_0541950 3300048916 Unclassified 933
334 Ga0496116_0308784 3300048919 Unclassified 748
335 Ga0496122_0099045 3300048925 Bacteria 1956
336 Ga0496123_0004066 3300048926 Bacteria 15753
337 Ga0496123_0023495 3300048926 Bacteria 4717
338 Ga0496124_0003359 3300048927 Bacteria 19669
339 Ga0496124_0008319 3300048927 Bacteria 10859
340 Ga0496125_0284459 3300048928 Bacteria 1022
341 Ga0496126_0937682 3300048929 Bacteria 654
342 Ga0501067_0302971 3300049583 Unclassified 890
343 Ga0466962_0029172 3300061719 Bacteria 2641
344 Ga0466962_0037133 3300061719 Bacteria 2332
345 Ga0466962_0249486 3300061719 Bacteria 872
346 2600226699 2599185359 Bacteria 4772316
347 2819712328 2818991466 Bacteria 4748179
348 2928526841 2928526807 Bacteria 4760224
349 2928969608 2928968154 Bacteria 4633371
350 Ga0495648_0102722
351 JGI24740J21852_10027792
352 JGI24740J21852_10063507
353 JGI24739J22299_10008945
354 JGI24739J22299_10078742
355 JGI24737J22298_10003359
356 JGI24737J22298_10029811
357 JGI24737J22298_10063207
358 JGI24735J21928_10011141
359 JGI24735J21928_10014580
360 JGI24738J21930_10000961
361 JGI24738J21930_10029558
362 Ga0065715_10048475
363 Ga0070658_10000130
364 Ga0070658_10009112
365 Ga0070658_10026100
366 Ga0070658_10078557
367 Ga0070658_10084843
368 Ga0070676_10298371
369 Ga0070676_10363821
370 Ga0070683_100139123
371 Ga0070670_100011521
372 Ga0070670_100075022
373 Ga0070670_100484893
374 Ga0068869_100661743
375 Ga0070666_10075855
376 Ga0070666_10095375
377 Ga0070680_100003312
378 Ga0070680_100006208
379 Ga0070682_100459840
380 Ga0068868_100502215
381 Ga0068868_100522334
382 Ga0070660_100000391
383 Ga0070660_100066339
384 Ga0070660_100123376
385 Ga0070660_100141951
386 Ga0070660_100298041
387 Ga0070660_100580446
388 Ga0070660_100606891
389 Ga0070661_100000206
390 Ga0070661_100021844
391 Ga0070661_100080328
392 Ga0070661_100184859
393 Ga0070661_101139836
394 Ga0070675_101356233
395 Ga0070671_100011023
396 Ga0070671_100019594
397 Ga0070671_100032201
398 Ga0070671_100291720
399 Ga0070673_100137322
400 Ga0070673_100245815
401 Ga0070659_100000884
402 Ga0070659_100006353
403 Ga0070659_100037352
404 Ga0070659_100230680
405 Ga0070667_100035369
406 Ga0070713_100040965
407 Ga0070710_10225491
408 Ga0070710_10259795
409 Ga0070663_100006000
410 Ga0070663_100304143
411 Ga0070678_100021464
412 Ga0070662_100000107
413 Ga0070681_10016414
414 Ga0070681_10019474
415 Ga0070681_10262640
416 Ga0068867_100135132
417 Ga0070685_10534775
418 Ga0070679_100334502
419 Ga0070679_100700010
420 Ga0070684_100097050
421 Ga0068853_100000172
422 Ga0068853_100008708
423 Ga0068853_100036316
424 Ga0070672_100813831
425 Ga0070696_100318155
426 Ga0070693_100000967
427 Ga0070693_100169012
428 Ga0070665_100005356
429 Ga0068855_100003916
430 Ga0068855_100010468
431 Ga0068855_100440460
432 Ga0070664_100000032
433 Ga0070664_100077460
434 Ga0070664_100101206
435 Ga0068857_100017295
436 Ga0068857_100334979
437 Ga0068854_100033369
438 Ga0068854_100074756
439 Ga0068856_100000364
440 Ga0068856_100031931
441 Ga0068856_100177115
442 Ga0068856_100379959
443 Ga0068856_101008761
444 Ga0070702_100094262
445 Ga0068852_100000780
446 Ga0068852_100004552
447 Ga0068852_100084731
448 Ga0068852_100133607
449 Ga0068859_100066278
450 Ga0068859_100450870
451 Ga0068864_100005507
452 Ga0068864_100084452
453 Ga0068864_100461269
454 Ga0068866_10056465
455 Ga0068851_10029741
456 Ga0068851_10120173
457 Ga0068858_101877231
458 Ga0068860_100341982
459 Ga0070717_10028934
460 Ga0070716_100045514
461 Ga0070712_100010413
462 Ga0068871_101104328
463 Ga0068865_100026291
464 Ga0097620_100066278
465 Ga0097620_100450868
466 Ga0105245_10017352
467 Ga0105248_10000238
468 Ga0105248_10001772
469 Ga0105237_10106391
470 Ga0105238_10201680
471 Ga0105246_10298670
472 Ga0157373_10246642
473 Ga0157373_10248890
474 Ga0157371_10005248
475 Ga0157371_10040705
476 Ga0157370_10043581
477 Ga0157370_10254855
478 Ga0157369_10140761
479 Ga0157369_10230596
480 Ga0157369_10275254
481 Ga0157374_10053682
482 Ga0157375_10164964
483 Ga0163163_10000371
484 Ga0157379_10033120
485 Ga0157376_10116741
486 Ga0207656_10079141
487 Ga0207682_10173728
488 Ga0207680_10022556
489 Ga0207647_10008620
490 Ga0207647_10011134
491 Ga0207699_10023448
492 Ga0207645_10012436
493 Ga0207705_10000200
494 Ga0207705_10004140
495 Ga0207705_10016629
496 Ga0207705_10028159
497 Ga0207705_10065289
498 Ga0207654_10042700
499 Ga0207707_10039243
500 Ga0207707_10079952
501 Ga0207707_10117667
502 Ga0207695_10379500
503 Ga0207671_10020093
504 Ga0207671_10263526
505 Ga0207693_10020143
506 Ga0207660_10012224
507 Ga0207657_10000468
508 Ga0207657_10003153
509 Ga0207657_10004240
510 Ga0207657_10039319
511 Ga0207657_10172464
512 Ga0207649_10000362
513 Ga0207649_10005750
514 Ga0207649_10183649
515 Ga0207649_10198092
516 Ga0207652_10029444
517 Ga0207652_10616343
518 Ga0207681_10129483
519 Ga0207694_10006948
520 Ga0207694_10190028
521 Ga0207694_10835551
522 Ga0207650_10057695
523 Ga0207650_10072909
524 Ga0207650_10457099
525 Ga0207659_10962529
526 Ga0207700_10028162
527 Ga0207644_10002090
528 Ga0207644_10024790
529 Ga0207644_10122048
530 Ga0207644_10350589
531 Ga0207690_10000062
532 Ga0207690_10026604
533 Ga0207690_10186400
534 Ga0207690_10214537
535 Ga0207706_10000211
536 Ga0207706_10004449
537 Ga0207706_10923991
538 Ga0207669_10029516
539 Ga0207704_10019876
540 Ga0207665_10046965
541 Ga0207691_10015370
542 Ga0207711_10001518
543 Ga0207711_10001908
544 Ga0207689_10624588
545 Ga0207689_10629227
546 Ga0207661_10115424
547 Ga0207661_10598356
548 Ga0207679_10000506
549 Ga0207679_10048390
550 Ga0207679_10275622
551 Ga0207679_10624806
552 Ga0207667_10006933
553 Ga0207667_10033992
554 Ga0207667_10182339
555 Ga0207667_10850036
556 Ga0207651_10186576
557 Ga0207640_10072020
558 Ga0207640_10519984
559 Ga0207658_10041302
560 Ga0207658_10165988
561 Ga0207677_11642708
562 Ga0207639_10000532
563 Ga0207639_10000990
564 Ga0207639_10135184
565 Ga0207639_10186040
566 Ga0207678_10004245
567 Ga0207678_10021992
568 Ga0207678_10236364
569 Ga0207702_10001280
570 Ga0207702_10372990
571 Ga0207702_10528115
572 Ga0207648_10000889
573 Ga0207676_10061178
574 Ga0207676_10183631
575 Ga0207676_10304439
576 Ga0207674_10010822
577 Ga0207674_10121138
578 Ga0207674_10550282
579 Ga0207675_100932222
580 Ga0207683_10034550
581 Ga0207698_10000775
582 Ga0207698_10010944
583 Ga0207698_10110890
584 Ga0268266_10039465
585 Ga0268265_10070203
586 Ga0268264_10339277
587 Ga0307409_100523977
588 Ga0373959_0118990
589 Ga0373952_0099335
590 Ga0373954_0115725
591 Ga0373956_0290876
592 Ga0373955_0017213
593 Ga0373961_0061271
594 Ga0373935_0045407
595 Ga0373933_0181243
596 Ga0373937_0135269
597 Ga0395899_0012482
598 Ga0395899_0049824
599 Ga0395899_0096601
600 Ga0395900_0008516
601 Ga0395900_0039261
602 Ga0395900_0056637
603 Ga0395900_0079083
604 Ga0395900_0193526
605 Ga0395900_0398293
606 Ga0395900_0791709
607 Ga0395900_1205330
608 Ga0395900_1261512
609 Ga0395898_0061307
610 Ga0395898_0093511
611 Ga0395898_0208314
612 Ga0395898_0492095
613 Ga0395905_0004708
614 Ga0395905_0199193
615 Ga0395905_0215012
616 Ga0395905_0240008
617 Ga0395905_0290663
618 Ga0395905_0369210
619 Ga0395905_0398246
620 Ga0395905_0544752
621 Ga0395905_0589770
622 Ga0395905_0781607
623 Ga0395901_0030623
624 Ga0395901_0131249
625 Ga0395901_0161600
626 Ga0395901_0252880
627 Ga0395901_0273228
628 Ga0395901_0361894
629 Ga0466965_0651707
630 Ga0466961_0016718
631 Ga0466963_0005175
632 Ga0466963_0011096
633 Ga0466963_0013204
634 Ga0466963_0017121
635 Ga0466963_0057595
636 Ga0466963_0697584
637 Ga0466964_0027307
638 Ga0466964_0192046
639 Ga0466971_0026775
640 Ga0466971_0238399
641 Ga0466970_0061713
642 Ga0466957_0001433
643 Ga0466957_0003522
644 Ga0466957_0065666
645 Ga0466959_0061640
646 Ga0466959_0403896
647 Ga0466958_0019234
648 Ga0466958_0207650
649 Ga0466958_0228204
650 Ga0466967_0003642
651 Ga0466967_0013752
652 Ga0466967_0048533
653 Ga0466967_0059622
654 Ga0466967_0123824
655 Ga0466967_0256471
656 Ga0466967_0512548
657 Ga0466967_0683575
658 Ga0466967_0975734
659 Ga0495621_0054560
660 Ga0495669_0020437
661 Ga0495602_0103778
662 Ga0496100_0111428
663 Ga0496101_0311027
664 Ga0496102_0180636
665 Ga0496103_0169322
666 Ga0496104_0026150
667 Ga0496105_0132343
668 Ga0496106_0125869
669 Ga0496106_0745765
670 Ga0496107_0102720
671 Ga0496108_0339468
672 Ga0496109_0052852
673 Ga0496109_0265042
674 Ga0496110_0008265
675 Ga0496110_0031776
676 Ga0496111_0035600
677 Ga0496111_0051086
678 Ga0496112_0045434
679 Ga0496112_0090688
680 Ga0496112_1187651
681 Ga0496113_0015623
682 Ga0496113_0541950
683 Ga0496116_0308784
684 Ga0496122_0099045
685 Ga0496123_0004066
686 Ga0496123_0023495
687 Ga0496124_0003359
688 Ga0496124_0008319
689 Ga0496125_0284459
690 Ga0496126_0937682
691 Ga0501067_0302971
692 Ga0466962_0029172
693 Ga0466962_0037133
694 Ga0466962_0249486
695 2600226699
696 2819712328
697 2928526841
698 2928969608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

89

161

0.91

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

29

153

0.85

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

63

155

0.81

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

47

166

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fyn-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of cole harbour salt marsh: integron cassette protein hfx_cass3 0.8612 7 160
8a9n-assembly1.cif.gz_B structure of dpa polyamine acetyltransferase in complex with 1,3-dap 0.8506 5 152
8a9o-assembly1.cif.gz_B structure of the polyamine acetyltransferase dpa 0.8501 5 152
3pp9-assembly1.cif.gz_A-2 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8497 56 160
3pp9-assembly2.cif.gz_B 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8467 54 160
ID Description Score Start End Superfamily
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9262 111 160 3.40.630.30
af_A0A0R0LDP2_1_100_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8904 94 160 3.40.630.30
af_Q4DGZ6_132_293_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8776 69 160 3.40.630.30
af_P16691_3_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8633 4 152 3.40.630.30
af_Q5AMM9_17_172_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8605 69 160 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7Y5QWP4-F1-model_v4 GNAT family N-acetyltransferase 0.9539 3 95 GO:0016740
AF-A0A4Q5R6W4-F1-model_v4 GNAT family N-acetyltransferase 0.9515 19 109 GO:0016747
AF-A0A538SFI9-F1-model_v4 GNAT family N-acetyltransferase 0.951 3 127 GO:0016747
AF-A0A538SFI9-F1-model_v4 GNAT family N-acetyltransferase 0.9364 3 127 GO:0016747
AF-S3HSK1-F1-model_v4 Acetyltransferase 0.932 3 160 GO:0016747

Map