F418003

General Info

Members Datasets Scaffolds Average Seq Length
349 214 698 244

Family's Representative Sequence

Representative Sequence 3300046681|Ga0495647_0004523|Ga0495647_0004523_243_1097
Length 284
Sequence LDGWRCGRALAKKYKTFHPCLMGSSRPTVVILCGGRGTRLRERTETVPKALVEIGGRPILWHVIGIYAAQGFERFLLATGYLGEMVEGFAASESWPGGIAVECVDTGLDTPTGGRIARLDERLEDGTFCATYADGVADVDLGALLDFHRVHDALASVTVVQPRLQWGVVELADDGRVEGFVEKPRSEHWINGGFFCFEPGALDYLDENSVLEHEPLERLAADGQLRGYKHKGFWDCMDTYKDAVELNDLWASARAPWPTFSADWSLDPLIAWSNDQSASPGECR

Samples

Sample ID Description Type Environment
1 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
92 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
95 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
100 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
117 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
149 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
210 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0.57
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0
Rhizoplane 9.46
Rhizosphere 83.38
Stem 0
Stem Tuber 0
Unclassified 0.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495647_0004523 3300046681 Bacteria 4525
2 JGI24740J21852_10015814 3300001979 Bacteria 2743
3 Ga0070683_100036000 3300005329 Bacteria 4528
4 Ga0070683_100117182 3300005329 Bacteria 2515
5 Ga0070677_10000008 3300005333 Bacteria 74027
6 Ga0070682_100000090 3300005337 Bacteria 82642
7 Ga0070691_10000044 3300005341 Bacteria 36029
8 Ga0070671_100101323 3300005355 Bacteria 2416
9 Ga0070659_100036169 3300005366 Bacteria 3848
10 Ga0070667_100155517 3300005367 Bacteria 2011
11 Ga0070703_10024980 3300005406 Bacteria 1769
12 Ga0070714_100161913 3300005435 Bacteria 2025
13 Ga0070714_100450166 3300005435 Bacteria 1223
14 Ga0070710_10000004 3300005437 Bacteria 270399
15 Ga0070710_10029915 3300005437 Bacteria 2926
16 Ga0070710_10329158 3300005437 Bacteria 1005
17 Ga0070711_100055054 3300005439 Bacteria 2747
18 Ga0068867_100005480 3300005459 Bacteria 8981
19 Ga0070685_10049549 3300005466 Bacteria 2423
20 Ga0070706_100078438 3300005467 Bacteria 3058
21 Ga0070679_100014554 3300005530 Bacteria 7558
22 Ga0070684_100177969 3300005535 Bacteria 1933
23 Ga0068853_100041279 3300005539 Bacteria 3940
24 Ga0070672_100296818 3300005543 Bacteria 1369
25 Ga0070665_100000135 3300005548 Bacteria 138925
26 Ga0070665_100080084 3300005548 Bacteria 3272
27 Ga0070704_100115774 3300005549 Bacteria 2049
28 Ga0068854_100059914 3300005578 Bacteria 2752
29 Ga0068856_100071931 3300005614 Bacteria 3424
30 Ga0068864_100000015 3300005618 Bacteria 303368
31 Ga0068866_10000008 3300005718 Bacteria 117658
32 Ga0068866_10002177 3300005718 Bacteria 8157
33 Ga0068861_100240266 3300005719 Bacteria 1540
34 Ga0068863_100000022 3300005841 Bacteria 188278
35 Ga0068863_100353574 3300005841 Bacteria 1431
36 Ga0068858_100004559 3300005842 Bacteria 13571
37 Ga0068858_100111574 3300005842 Bacteria 2554
38 Ga0068860_100022121 3300005843 Bacteria 6155
39 Ga0081455_10028717 3300005937 Bacteria 5078
40 Ga0081455_10320904 3300005937 Bacteria 1103
41 Ga0081538_10000229 3300005981 Bacteria 63078
42 Ga0081538_10000486 3300005981 Bacteria 44589
43 Ga0081538_10000959 3300005981 Bacteria 30827
44 Ga0081538_10008216 3300005981 Bacteria 8901
45 Ga0081538_10012402 3300005981 Bacteria 6831
46 Ga0081538_10026788 3300005981 Bacteria 4019
47 Ga0081538_10049948 3300005981 Bacteria 2532
48 Ga0081538_10055018 3300005981 Bacteria 2347
49 Ga0070717_10000019 3300006028 Bacteria 178051
50 Ga0075364_10169732 3300006051 Bacteria 1474
51 Ga0075432_10012026 3300006058 Bacteria 2941
52 Ga0075428_100086766 3300006844 Bacteria 3414
53 Ga0075428_100200644 3300006844 Bacteria 2156
54 Ga0075430_100065688 3300006846 Bacteria 3047
55 Ga0075430_100082696 3300006846 Bacteria 2690
56 Ga0075431_100002534 3300006847 Bacteria 17618
57 Ga0075431_100434162 3300006847 Bacteria 1311
58 Ga0075433_10406826 3300006852 Bacteria 1200
59 Ga0075434_100204106 3300006871 Bacteria 1997
60 Ga0075429_100016642 3300006880 Bacteria 6369
61 Ga0105240_10322050 3300009093 Bacteria 1762
62 Ga0105240_10511954 3300009093 Bacteria 1333
63 Ga0111539_10077221 3300009094 Bacteria 3920
64 Ga0111539_10397543 3300009094 Bacteria 1605
65 Ga0105245_10000415 3300009098 Bacteria 39764
66 Ga0105245_10001311 3300009098 Bacteria 22474
67 Ga0105245_11195609 3300009098 Bacteria 808
68 Ga0105247_10001706 3300009101 Bacteria 15492
69 Ga0114129_10018007 3300009147 Bacteria 10059
70 Ga0114129_10022570 3300009147 Bacteria 8927
71 Ga0114129_10110402 3300009147 Bacteria 3796
72 Ga0114129_10654308 3300009147 Bacteria 1356
73 Ga0105243_10525672 3300009148 Bacteria 1126
74 Ga0105242_10000603 3300009176 Bacteria 28175
75 Ga0105242_10047166 3300009176 Bacteria 3498
76 Ga0105238_10000055 3300009551 Bacteria 139232
77 Ga0105249_10000143 3300009553 Bacteria 92539
78 Ga0105239_10268795 3300010375 Bacteria 1917
79 Ga0157370_10003254 3300013104 Bacteria 19142
80 Ga0157374_10000486 3300013296 Bacteria 35981
81 Ga0157372_10169577 3300013307 Bacteria 2525
82 Ga0157372_10807748 3300013307 Unclassified 1090
83 Ga0157372_11124295 3300013307 Bacteria 909
84 Ga0157375_10014036 3300013308 Bacteria 7145
85 Ga0157375_10111493 3300013308 Bacteria 2835
86 Ga0157375_10245858 3300013308 Bacteria 1949
87 Ga0157375_10399591 3300013308 Bacteria 1541
88 Ga0157375_10892865 3300013308 Bacteria 1033
89 Ga0163163_10290939 3300014325 Bacteria 1686
90 Ga0163163_10704932 3300014325 Bacteria 1073
91 Ga0157380_10002828 3300014326 Bacteria 11801
92 Ga0157379_10006763 3300014968 Bacteria 9911
93 Ga0163161_10000053 3300017792 Bacteria 117408
94 Ga0206353_10710222 3300020082 Bacteria 1036
95 Ga0213876_10006406 3300021384 Bacteria 6416
96 Ga0213876_10019239 3300021384 Bacteria 3606
97 Ga0213875_10034779 3300021388 Bacteria 2379
98 Ga0213875_10037865 3300021388 Bacteria 2272
99 Ga0224712_10134735 3300022467 Bacteria 1082
100 Ga0207653_10025530 3300025885 Bacteria 1890
101 Ga0207692_10000002 3300025898 Bacteria 453100
102 Ga0207692_10109030 3300025898 Bacteria 1533
103 Ga0207642_10000002 3300025899 Bacteria 658166
104 Ga0207642_10000080 3300025899 Bacteria 25169
105 Ga0207710_10000157 3300025900 Bacteria 72764
106 Ga0207695_10219730 3300025913 Bacteria 1808
107 Ga0207663_10041078 3300025916 Bacteria 2816
108 Ga0207652_10001733 3300025921 Bacteria 19037
109 Ga0207652_10723977 3300025921 Bacteria 887
110 Ga0207694_10000063 3300025924 Bacteria 139700
111 Ga0207687_10000032 3300025927 Bacteria 143196
112 Ga0207687_10000460 3300025927 Bacteria 27723
113 Ga0207664_10067896 3300025929 Bacteria 2862
114 Ga0207690_10053568 3300025932 Bacteria 2708
115 Ga0207706_10000001 3300025933 Bacteria 423014
116 Ga0207686_10000097 3300025934 Bacteria 72219
117 Ga0207686_10136529 3300025934 Bacteria 1689
118 Ga0207686_10572137 3300025934 Bacteria 886
119 Ga0207669_10000017 3300025937 Bacteria 119878
120 Ga0207669_10000026 3300025937 Bacteria 92199
121 Ga0207661_10004460 3300025944 Bacteria 9836
122 Ga0207661_10101297 3300025944 Bacteria 2419
123 Ga0207712_10000058 3300025961 Bacteria 140948
124 Ga0207640_10071795 3300025981 Bacteria 2333
125 Ga0207703_10000287 3300026035 Bacteria 55757
126 Ga0207639_10005999 3300026041 Bacteria 8242
127 Ga0207708_10037657 3300026075 Bacteria 3684
128 Ga0207708_10330906 3300026075 Bacteria 1245
129 Ga0207702_10054454 3300026078 Bacteria 3390
130 Ga0207641_10000016 3300026088 Bacteria 307363
131 Ga0207641_10250058 3300026088 Bacteria 1655
132 Ga0207648_10015345 3300026089 Bacteria 7048
133 Ga0207676_10000018 3300026095 Bacteria 306375
134 Ga0207675_100063661 3300026118 Bacteria 3446
135 Ga0207675_100197006 3300026118 Bacteria 1934
136 Ga0207675_100646668 3300026118 Bacteria 1063
137 Ga0207683_10513839 3300026121 Bacteria 1107
138 Ga0268266_10000056 3300028379 Bacteria 289176
139 Ga0268266_10058937 3300028379 Bacteria 3307
140 Ga0268266_10677631 3300028379 Bacteria 993
141 Ga0265337_1000066 3300028556 Bacteria 48673
142 Ga0265326_10000019 3300028558 Bacteria 137370
143 Ga0265319_1000469 3300028563 Bacteria 28589
144 Ga0265322_10000011 3300028654 Bacteria 167597
145 Ga0265336_10002798 3300028666 Bacteria 7048
146 Ga0265338_10000244 3300028800 Bacteria 100528
147 Ga0265338_10158711 3300028800 Bacteria 1749
148 Ga0265324_10000283 3300029957 Bacteria 37587
149 Ga0265332_10116314 3300031238 Bacteria 1124
150 Ga0265328_10000737 3300031239 Bacteria 15188
151 Ga0265320_10000011 3300031240 Bacteria 249534
152 Ga0265325_10080624 3300031241 Bacteria 1618
153 Ga0265329_10004312 3300031242 Bacteria 5950
154 Ga0265339_10051838 3300031249 Bacteria 2237
155 Ga0265331_10000858 3300031250 Bacteria 24739
156 Ga0265331_10154688 3300031250 Bacteria 1040
157 Ga0265327_10000015 3300031251 Bacteria 496677
158 Ga0265327_10096961 3300031251 Bacteria 1429
159 Ga0307408_100402767 3300031548 Bacteria 1175
160 Ga0265313_10037260 3300031595 Bacteria 2434
161 Ga0265314_10000640 3300031711 Bacteria 42944
162 Ga0307405_10039203 3300031731 Bacteria 2861
163 Ga0307410_10073494 3300031852 Bacteria 2378
164 Ga0307410_10111216 3300031852 Bacteria 1982
165 Ga0307406_10031038 3300031901 Bacteria 3251
166 Ga0307407_10156851 3300031903 Bacteria 1485
167 Ga0307407_10407817 3300031903 Bacteria 977
168 Ga0307409_100006038 3300031995 Bacteria 7066
169 Ga0307409_100158198 3300031995 Bacteria 1978
170 Ga0307409_100212185 3300031995 Bacteria 1741
171 Ga0307409_100284229 3300031995 Bacteria 1531
172 Ga0307416_100086573 3300032002 Bacteria 2671
173 Ga0307416_100129729 3300032002 Bacteria 2267
174 Ga0307415_100390379 3300032126 Bacteria 1185
175 Ga0373960_0034283 3300035121 Bacteria 1435
176 Ga0316574_0159256 3300035398 Bacteria 1454
177 Ga0373931_0051488 3300035691 Bacteria 2193
178 Ga0373937_0093812 3300036401 Bacteria 2783
179 Ga0395898_0124015 3300037466 Bacteria 2475
180 Ga0395898_0135837 3300037466 Bacteria 2355
181 Ga0395898_0294326 3300037466 Bacteria 1549
182 Ga0395898_0822190 3300037466 Bacteria 869
183 Ga0395905_0575518 3300037471 Bacteria 1028
184 Ga0436364_0188717 3300037853 Bacteria 10257
185 Ga0436364_0986067 3300037853 Bacteria 2495
186 Ga0436364_1487859 3300037853 Bacteria 6007
187 Ga0436364_1506207 3300037853 Bacteria 1850
188 Ga0395901_0144870 3300038443 Bacteria 2497
189 Ga0395901_0293434 3300038443 Bacteria 1687
190 Ga0395901_0451318 3300038443 Bacteria 1315
191 Ga0395901_0458305 3300038443 Bacteria 1303
192 Ga0395901_0741607 3300038443 Bacteria 976
193 Ga0436365_0333914 3300039437 Bacteria 2704
194 Ga0436365_0555733 3300039437 Bacteria 8089
195 Ga0436365_0626783 3300039437 Bacteria 19138
196 Ga0436360_1183010 3300039438 Bacteria 2309
197 Ga0436363_0121634 3300039450 Bacteria 972
198 Ga0436363_0776109 3300039450 Bacteria 3547
199 Ga0436363_0873386 3300039450 Bacteria 930
200 Ga0436363_1015902 3300039450 Bacteria 1339
201 Ga0436363_1097204 3300039450 Bacteria 1222
202 Ga0436363_1714203 3300039450 Bacteria 4229
203 Ga0436362_0379975 3300039453 Bacteria 1289
204 Ga0451853_4068494 3300041512 Bacteria 1499
205 Ga0466966_0042305 3300044684 Bacteria 2925
206 Ga0466966_0096466 3300044684 Bacteria 1831
207 Ga0466963_0000017 3300044694 Bacteria 58283
208 Ga0466963_0028646 3300044694 Bacteria 3579
209 Ga0466963_0030187 3300044694 Bacteria 3496
210 Ga0466960_0136433 3300044901 Bacteria 1299
211 Ga0466958_0299734 3300045836 Bacteria 1032
212 Ga0466967_0031886 3300045976 Bacteria 4443
213 Ga0466967_0249157 3300045976 Bacteria 1696
214 Ga0495592_0000607 3300046454 Bacteria 25304
215 Ga0495592_0073999 3300046454 Bacteria 2475
216 Ga0495603_0000286 3300046455 Bacteria 26902
217 Ga0495603_0011493 3300046455 Bacteria 5358
218 Ga0495629_0000245 3300046459 Bacteria 47272
219 Ga0495629_0207877 3300046459 Bacteria 1352
220 Ga0495638_0027459 3300046460 Bacteria 3684
221 Ga0495641_0042388 3300046461 Bacteria 2109
222 Ga0495653_0005438 3300046463 Bacteria 10376
223 Ga0495653_0169316 3300046463 Bacteria 1509
224 Ga0495582_0000001 3300046473 Bacteria 252434
225 Ga0495662_0000001 3300046476 Bacteria 179185
226 Ga0495594_0000089 3300046499 Bacteria 41876
227 Ga0495608_0023011 3300046511 Bacteria 4272
228 Ga0495618_0000014 3300046514 Bacteria 163136
229 Ga0495618_0000486 3300046514 Bacteria 28336
230 Ga0495620_0072027 3300046515 Bacteria 1412
231 Ga0495628_0031056 3300046516 Bacteria 4321
232 Ga0495628_0074492 3300046516 Bacteria 2644
233 Ga0495630_0000298 3300046517 Bacteria 39988
234 Ga0495637_0177154 3300046520 Bacteria 792
235 Ga0495644_0001871 3300046523 Bacteria 8485
236 Ga0495652_0000037 3300046529 Bacteria 133232
237 Ga0495640_0043829 3300046533 Bacteria 3113
238 Ga0495587_0014521 3300046536 Bacteria 4938
239 Ga0495587_0038649 3300046536 Bacteria 2860
240 Ga0495587_0209192 3300046536 Bacteria 1102
241 Ga0495598_0005076 3300046537 Bacteria 2894
242 Ga0495621_0017300 3300046539 Bacteria 2328
243 Ga0495645_0000012 3300046543 Bacteria 209044
244 Ga0495645_0046873 3300046543 Bacteria 3150
245 Ga0495622_0000080 3300046557 Bacteria 85557
246 Ga0495634_0001744 3300046642 Bacteria 18826
247 Ga0495635_0000076 3300046663 Bacteria 61665
248 Ga0495657_0000007 3300046675 Bacteria 222471
249 Ga0495657_0024829 3300046675 Bacteria 4263
250 Ga0495599_0046673 3300046678 Bacteria 2716
251 Ga0495646_0151250 3300046680 Bacteria 1291
252 Ga0495647_0000001 3300046681 Bacteria 222371
253 Ga0495658_0000002 3300046683 Bacteria 309651
254 Ga0495669_0000113 3300046684 Bacteria 52780
255 Ga0495613_0000005 3300046689 Bacteria 222558
256 Ga0495624_0001010 3300046690 Bacteria 22278
257 Ga0495624_0164285 3300046690 Bacteria 1355
258 Ga0495670_0089123 3300046691 Bacteria 1578
259 Ga0495649_0002403 3300046694 Bacteria 13212
260 Ga0495604_0001251 3300047317 Bacteria 20805
261 Ga0495674_0000030 3300047319 Bacteria 115975
262 Ga0495676_0000827 3300047321 Bacteria 25944
263 Ga0495676_0002855 3300047321 Bacteria 15572
264 Ga0495676_0278233 3300047321 Bacteria 1134
265 Ga0495680_0000143 3300047322 Bacteria 71946
266 Ga0495680_0001430 3300047322 Bacteria 25733
267 Ga0495680_0100958 3300047322 Bacteria 2149
268 Ga0495684_0008590 3300047471 Bacteria 7905
269 Ga0495686_0185105 3300047472 Bacteria 1204
270 Ga0496100_0000001 3300048903 Bacteria 530179
271 Ga0496100_0000013 3300048903 Bacteria 177476
272 Ga0496100_0167195 3300048903 Bacteria 1581
273 Ga0496101_0000004 3300048904 Bacteria 331599
274 Ga0496101_0000035 3300048904 Bacteria 177237
275 Ga0496104_0000052 3300048907 Bacteria 137286
276 Ga0496104_0080316 3300048907 Bacteria 3109
277 Ga0496105_0000030 3300048908 Bacteria 137325
278 Ga0496105_0017537 3300048908 Bacteria 5743
279 Ga0496105_0027673 3300048908 Bacteria 4634
280 Ga0496106_0000076 3300048909 Bacteria 79088
281 Ga0496106_0000121 3300048909 Bacteria 59910
282 Ga0496106_0004512 3300048909 Bacteria 10312
283 Ga0496106_0496910 3300048909 Bacteria 980
284 Ga0496107_0000005 3300048910 Bacteria 281747
285 Ga0496107_0000020 3300048910 Bacteria 148990
286 Ga0496108_0000006 3300048911 Bacteria 469473
287 Ga0496109_0000009 3300048912 Bacteria 236561
288 Ga0496109_0027208 3300048912 Bacteria 5104
289 Ga0496109_0071319 3300048912 Bacteria 3189
290 Ga0496109_0244736 3300048912 Bacteria 1688
291 Ga0496109_0898680 3300048912 Unclassified 824
292 Ga0496111_0013051 3300048914 Bacteria 5641
293 Ga0496111_0026900 3300048914 Bacteria 4065
294 Ga0496112_0000025 3300048915 Bacteria 146197
295 Ga0496112_0002927 3300048915 Bacteria 13911
296 Ga0496112_0009927 3300048915 Bacteria 8611
297 Ga0496112_0148803 3300048915 Bacteria 2309
298 Ga0496112_0466628 3300048915 Bacteria 1200
299 Ga0496113_0007203 3300048916 Bacteria 7127
300 Ga0496113_0053767 3300048916 Bacteria 3011
301 Ga0496114_0034207 3300048917 Bacteria 4191
302 Ga0496114_0070615 3300048917 Bacteria 2934
303 Ga0496125_0056109 3300048928 Bacteria 3202
304 Ga0501038_0546036 3300049574 Bacteria 882
305 Ga0501042_0272506 3300049578 Bacteria 1222
306 Ga0501048_0136158 3300049582 Bacteria 1736
307 Ga0501048_0371124 3300049582 Bacteria 1021
308 Ga0501068_0163148 3300049584 Bacteria 1405
309 Ga0501069_0028167 3300049585 Bacteria 3080
310 Ga0501072_0127916 3300049588 Bacteria 2024
311 Ga0501072_0407595 3300049588 Bacteria 1078
312 Ga0501074_0023989 3300049590 Bacteria 4433
313 Ga0501075_0044891 3300049591 Bacteria 3315
314 Ga0501075_0144806 3300049591 Bacteria 1811
315 Ga0501076_0339317 3300049592 Unclassified 1233
316 Ga0501077_0264231 3300049593 Bacteria 1095
317 Ga0501080_0002828 3300049742 Bacteria 15258
318 Ga0501045_0127128 3300049824 Bacteria 1894
319 Ga0501045_0222573 3300049824 Bacteria 1405
320 nmdc:mga05p37_104196_c1 3300050507 Bacteria 3490
321 nmdc:mga05p37_26494_c1 3300050507 Bacteria 7051
322 nmdc:mga05p37_547170_c1 3300050507 Bacteria 1318
323 nmdc:mga05p37_87299_c1 3300050507 Bacteria 3844
324 nmdc:mga09592_724886_c1 3300050508 Bacteria 845
325 nmdc:mga09592_853239_c1 3300050508 Bacteria 768
326 nmdc:mga09592_9130_c1 3300050508 Bacteria 8064
327 nmdc:mga06r32_274139_c1 3300050510 Bacteria 1674
328 nmdc:mga06r32_918124_c1 3300050510 Bacteria 831
329 nmdc:mga08y16_648350_c1 3300050511 Bacteria 1060
330 nmdc:mga0a205_139142_c1 3300050515 Bacteria 2328
331 Ga0495601_0000060 3300053077 Bacteria 60600
332 Ga0495601_0006994 3300053077 Bacteria 6609
333 Ga0495601_0030105 3300053077 Bacteria 3370
334 Ga0495601_0036251 3300053077 Bacteria 3079
335 Ga0495601_0059708 3300053077 Bacteria 2419
336 Ga0495612_0000033 3300053078 Bacteria 77643
337 Ga0495612_0000210 3300053078 Bacteria 24800
338 Ga0495612_0003362 3300053078 Bacteria 6629
339 Ga0495612_0005082 3300053078 Bacteria 5449
340 Ga0495655_0000002 3300053083 Bacteria 312752
341 Ga0495655_0015240 3300053083 Bacteria 1630
342 Ga0495595_0000045 3300053084 Bacteria 63054
343 Ga0495619_0000155 3300053085 Bacteria 50682
344 Ga0500556_0001503 3300053104 Bacteria 9623
345 Ga0500628_000001 3300053129 Bacteria 564074
346 Ga0500616_0004607 3300053153 Bacteria 9739
347 Ga0500599_004210 3300053736 Bacteria 1777
348 Ga0501082_0200786 3300060353 Bacteria 1735
349 8007377584 8007375930 Bacteria 4080554
350 Ga0495647_0004523
351 JGI24740J21852_10015814
352 Ga0070683_100036000
353 Ga0070683_100117182
354 Ga0070677_10000008
355 Ga0070682_100000090
356 Ga0070691_10000044
357 Ga0070671_100101323
358 Ga0070659_100036169
359 Ga0070667_100155517
360 Ga0070703_10024980
361 Ga0070714_100161913
362 Ga0070714_100450166
363 Ga0070710_10000004
364 Ga0070710_10029915
365 Ga0070710_10329158
366 Ga0070711_100055054
367 Ga0068867_100005480
368 Ga0070685_10049549
369 Ga0070706_100078438
370 Ga0070679_100014554
371 Ga0070684_100177969
372 Ga0068853_100041279
373 Ga0070672_100296818
374 Ga0070665_100000135
375 Ga0070665_100080084
376 Ga0070704_100115774
377 Ga0068854_100059914
378 Ga0068856_100071931
379 Ga0068864_100000015
380 Ga0068866_10000008
381 Ga0068866_10002177
382 Ga0068861_100240266
383 Ga0068863_100000022
384 Ga0068863_100353574
385 Ga0068858_100004559
386 Ga0068858_100111574
387 Ga0068860_100022121
388 Ga0081455_10028717
389 Ga0081455_10320904
390 Ga0081538_10000229
391 Ga0081538_10000486
392 Ga0081538_10000959
393 Ga0081538_10008216
394 Ga0081538_10012402
395 Ga0081538_10026788
396 Ga0081538_10049948
397 Ga0081538_10055018
398 Ga0070717_10000019
399 Ga0075364_10169732
400 Ga0075432_10012026
401 Ga0075428_100086766
402 Ga0075428_100200644
403 Ga0075430_100065688
404 Ga0075430_100082696
405 Ga0075431_100002534
406 Ga0075431_100434162
407 Ga0075433_10406826
408 Ga0075434_100204106
409 Ga0075429_100016642
410 Ga0105240_10322050
411 Ga0105240_10511954
412 Ga0111539_10077221
413 Ga0111539_10397543
414 Ga0105245_10000415
415 Ga0105245_10001311
416 Ga0105245_11195609
417 Ga0105247_10001706
418 Ga0114129_10018007
419 Ga0114129_10022570
420 Ga0114129_10110402
421 Ga0114129_10654308
422 Ga0105243_10525672
423 Ga0105242_10000603
424 Ga0105242_10047166
425 Ga0105238_10000055
426 Ga0105249_10000143
427 Ga0105239_10268795
428 Ga0157370_10003254
429 Ga0157374_10000486
430 Ga0157372_10169577
431 Ga0157372_10807748
432 Ga0157372_11124295
433 Ga0157375_10014036
434 Ga0157375_10111493
435 Ga0157375_10245858
436 Ga0157375_10399591
437 Ga0157375_10892865
438 Ga0163163_10290939
439 Ga0163163_10704932
440 Ga0157380_10002828
441 Ga0157379_10006763
442 Ga0163161_10000053
443 Ga0206353_10710222
444 Ga0213876_10006406
445 Ga0213876_10019239
446 Ga0213875_10034779
447 Ga0213875_10037865
448 Ga0224712_10134735
449 Ga0207653_10025530
450 Ga0207692_10000002
451 Ga0207692_10109030
452 Ga0207642_10000002
453 Ga0207642_10000080
454 Ga0207710_10000157
455 Ga0207695_10219730
456 Ga0207663_10041078
457 Ga0207652_10001733
458 Ga0207652_10723977
459 Ga0207694_10000063
460 Ga0207687_10000032
461 Ga0207687_10000460
462 Ga0207664_10067896
463 Ga0207690_10053568
464 Ga0207706_10000001
465 Ga0207686_10000097
466 Ga0207686_10136529
467 Ga0207686_10572137
468 Ga0207669_10000017
469 Ga0207669_10000026
470 Ga0207661_10004460
471 Ga0207661_10101297
472 Ga0207712_10000058
473 Ga0207640_10071795
474 Ga0207703_10000287
475 Ga0207639_10005999
476 Ga0207708_10037657
477 Ga0207708_10330906
478 Ga0207702_10054454
479 Ga0207641_10000016
480 Ga0207641_10250058
481 Ga0207648_10015345
482 Ga0207676_10000018
483 Ga0207675_100063661
484 Ga0207675_100197006
485 Ga0207675_100646668
486 Ga0207683_10513839
487 Ga0268266_10000056
488 Ga0268266_10058937
489 Ga0268266_10677631
490 Ga0265337_1000066
491 Ga0265326_10000019
492 Ga0265319_1000469
493 Ga0265322_10000011
494 Ga0265336_10002798
495 Ga0265338_10000244
496 Ga0265338_10158711
497 Ga0265324_10000283
498 Ga0265332_10116314
499 Ga0265328_10000737
500 Ga0265320_10000011
501 Ga0265325_10080624
502 Ga0265329_10004312
503 Ga0265339_10051838
504 Ga0265331_10000858
505 Ga0265331_10154688
506 Ga0265327_10000015
507 Ga0265327_10096961
508 Ga0307408_100402767
509 Ga0265313_10037260
510 Ga0265314_10000640
511 Ga0307405_10039203
512 Ga0307410_10073494
513 Ga0307410_10111216
514 Ga0307406_10031038
515 Ga0307407_10156851
516 Ga0307407_10407817
517 Ga0307409_100006038
518 Ga0307409_100158198
519 Ga0307409_100212185
520 Ga0307409_100284229
521 Ga0307416_100086573
522 Ga0307416_100129729
523 Ga0307415_100390379
524 Ga0373960_0034283
525 Ga0316574_0159256
526 Ga0373931_0051488
527 Ga0373937_0093812
528 Ga0395898_0124015
529 Ga0395898_0135837
530 Ga0395898_0294326
531 Ga0395898_0822190
532 Ga0395905_0575518
533 Ga0436364_0188717
534 Ga0436364_0986067
535 Ga0436364_1487859
536 Ga0436364_1506207
537 Ga0395901_0144870
538 Ga0395901_0293434
539 Ga0395901_0451318
540 Ga0395901_0458305
541 Ga0395901_0741607
542 Ga0436365_0333914
543 Ga0436365_0555733
544 Ga0436365_0626783
545 Ga0436360_1183010
546 Ga0436363_0121634
547 Ga0436363_0776109
548 Ga0436363_0873386
549 Ga0436363_1015902
550 Ga0436363_1097204
551 Ga0436363_1714203
552 Ga0436362_0379975
553 Ga0451853_4068494
554 Ga0466966_0042305
555 Ga0466966_0096466
556 Ga0466963_0000017
557 Ga0466963_0028646
558 Ga0466963_0030187
559 Ga0466960_0136433
560 Ga0466958_0299734
561 Ga0466967_0031886
562 Ga0466967_0249157
563 Ga0495592_0000607
564 Ga0495592_0073999
565 Ga0495603_0000286
566 Ga0495603_0011493
567 Ga0495629_0000245
568 Ga0495629_0207877
569 Ga0495638_0027459
570 Ga0495641_0042388
571 Ga0495653_0005438
572 Ga0495653_0169316
573 Ga0495582_0000001
574 Ga0495662_0000001
575 Ga0495594_0000089
576 Ga0495608_0023011
577 Ga0495618_0000014
578 Ga0495618_0000486
579 Ga0495620_0072027
580 Ga0495628_0031056
581 Ga0495628_0074492
582 Ga0495630_0000298
583 Ga0495637_0177154
584 Ga0495644_0001871
585 Ga0495652_0000037
586 Ga0495640_0043829
587 Ga0495587_0014521
588 Ga0495587_0038649
589 Ga0495587_0209192
590 Ga0495598_0005076
591 Ga0495621_0017300
592 Ga0495645_0000012
593 Ga0495645_0046873
594 Ga0495622_0000080
595 Ga0495634_0001744
596 Ga0495635_0000076
597 Ga0495657_0000007
598 Ga0495657_0024829
599 Ga0495599_0046673
600 Ga0495646_0151250
601 Ga0495647_0000001
602 Ga0495658_0000002
603 Ga0495669_0000113
604 Ga0495613_0000005
605 Ga0495624_0001010
606 Ga0495624_0164285
607 Ga0495670_0089123
608 Ga0495649_0002403
609 Ga0495604_0001251
610 Ga0495674_0000030
611 Ga0495676_0000827
612 Ga0495676_0002855
613 Ga0495676_0278233
614 Ga0495680_0000143
615 Ga0495680_0001430
616 Ga0495680_0100958
617 Ga0495684_0008590
618 Ga0495686_0185105
619 Ga0496100_0000001
620 Ga0496100_0000013
621 Ga0496100_0167195
622 Ga0496101_0000004
623 Ga0496101_0000035
624 Ga0496104_0000052
625 Ga0496104_0080316
626 Ga0496105_0000030
627 Ga0496105_0017537
628 Ga0496105_0027673
629 Ga0496106_0000076
630 Ga0496106_0000121
631 Ga0496106_0004512
632 Ga0496106_0496910
633 Ga0496107_0000005
634 Ga0496107_0000020
635 Ga0496108_0000006
636 Ga0496109_0000009
637 Ga0496109_0027208
638 Ga0496109_0071319
639 Ga0496109_0244736
640 Ga0496109_0898680
641 Ga0496111_0013051
642 Ga0496111_0026900
643 Ga0496112_0000025
644 Ga0496112_0002927
645 Ga0496112_0009927
646 Ga0496112_0148803
647 Ga0496112_0466628
648 Ga0496113_0007203
649 Ga0496113_0053767
650 Ga0496114_0034207
651 Ga0496114_0070615
652 Ga0496125_0056109
653 Ga0501038_0546036
654 Ga0501042_0272506
655 Ga0501048_0136158
656 Ga0501048_0371124
657 Ga0501068_0163148
658 Ga0501069_0028167
659 Ga0501072_0127916
660 Ga0501072_0407595
661 Ga0501074_0023989
662 Ga0501075_0044891
663 Ga0501075_0144806
664 Ga0501076_0339317
665 Ga0501077_0264231
666 Ga0501080_0002828
667 Ga0501045_0127128
668 Ga0501045_0222573
669 nmdc:mga05p37_104196_c1
670 nmdc:mga05p37_26494_c1
671 nmdc:mga05p37_547170_c1
672 nmdc:mga05p37_87299_c1
673 nmdc:mga09592_724886_c1
674 nmdc:mga09592_853239_c1
675 nmdc:mga09592_9130_c1
676 nmdc:mga06r32_274139_c1
677 nmdc:mga06r32_918124_c1
678 nmdc:mga08y16_648350_c1
679 nmdc:mga0a205_139142_c1
680 Ga0495601_0000060
681 Ga0495601_0006994
682 Ga0495601_0030105
683 Ga0495601_0036251
684 Ga0495601_0059708
685 Ga0495612_0000033
686 Ga0495612_0000210
687 Ga0495612_0003362
688 Ga0495612_0005082
689 Ga0495655_0000002
690 Ga0495655_0015240
691 Ga0495595_0000045
692 Ga0495619_0000155
693 Ga0500556_0001503
694 Ga0500628_000001
695 Ga0500616_0004607
696 Ga0500599_004210
697 Ga0501082_0200786
698 8007377584

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12804

NTP_transf_3

MobA-like NTP transferase domain

29

118

0.88

PF00483

NTP_transferase

Nucleotidyl transferase

28

251

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.9108 2 236
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.8881 1 236
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.875 2 236
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.8568 1 236
4y7t-assembly1.cif.gz_A structural analysis of muru 0.8437 4 229
ID Description Score Start End Superfamily
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8881 1 236 3.90.550.10
af_A4I3X5_10_117_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8748 2 83 3.90.550.10
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8568 1 236 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8185 4 229 3.90.550.10
af_Q8ILP1_1_241_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.808 4 229 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7V8ZHU4-F1-model_v4 NTP transferase domain-containing protein 0.9862 1 236 GO:0009058
GO:0047343
AF-A0A2E1NCM4-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9855 4 233 GO:0009058
GO:0047343
AF-A0A840IEV4-F1-model_v4 Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) 0.983 2 233 GO:0009058
GO:0047343
AF-A0A7V8ZHU4-F1-model_v4 NTP transferase domain-containing protein 0.978 1 236 GO:0009058
GO:0047343
AF-A0A7Y5XVL5-F1-model_v4 NTP transferase domain-containing protein 0.9775 1 189 GO:0009058
GO:0047343

Map