F418006

General Info

Members Datasets Scaffolds Average Seq Length
349 186 698 230

Family's Representative Sequence

Representative Sequence 3300046694|Ga0495649_0098462|Ga0495649_0098462_663_1352
Length 211
Sequence MDIKVIAFDADDTLWVNEPYFQNTEKKFCSLLEEFLPEQDLSRELLKIEIENLALYGYGIKGYILSMIETALKVTDNTITNEAIERIIGYGKELLNEPIELLDNVEEVLKALQGHYRIVVATKFHHIEIMSEKGEEDYLKLIRHLDILPEEFMMIGNSLKSDVIPVLNIGGHAIHVPYHTTWAHEHVETTLEHENFRHVERLEEVLGLILQ

Samples

Sample ID Description Type Environment
1 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
125 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
134 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
144 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
149 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
166 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
170 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
171 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
172 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
173 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
174 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
175 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
176 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
177 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
178 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
179 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
180 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
181 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
182 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
183 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
184 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
185 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
186 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.13
Metatranscriptomes 0
Isolates 2.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.16
Nodule 0
Rhizoplane 0.86
Rhizosphere 85.67
Stem 0
Stem Tuber 0
Unclassified 6.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495649_0098462 3300046694 Bacteria 1556
2 JGI24736J21556_1009937 3300001904 Bacteria 1561
3 JGI24740J21852_10029816 3300001979 Bacteria 1786
4 JGI24740J21852_10039468 3300001979 Bacteria 1440
5 JGI24737J22298_10000078 3300001990 Bacteria 28797
6 JGI24737J22298_10093237 3300001990 Bacteria 893
7 JGI24735J21928_10000050 3300002067 Bacteria 50872
8 JGI24735J21928_10019866 3300002067 Bacteria 2062
9 JGI25162J39368_1000062 3300002737 Bacteria 135587
10 JGI25162J39368_1000733 3300002737 Bacteria 22513
11 JGI25165J46597_1001666 3300003214 Bacteria 10117
12 rootH1_10018511 3300003316 Bacteria 4901
13 rootH2_10001274 3300003320 Bacteria 94480
14 rootL2_10047782 3300003322 Bacteria 3702
15 rootL2_10083044 3300003322 Bacteria 1956
16 rootH1_10005306 3300003323 Bacteria 8521
17 rootH1_10009847 3300003323 Bacteria 10778
18 rootH1_10244779 3300003323 Bacteria 3083
19 Ga0065714_10009821 3300005288 Bacteria 3291
20 Ga0070658_10001195 3300005327 Bacteria 22221
21 Ga0070658_10077338 3300005327 Bacteria 2729
22 Ga0070676_10000058 3300005328 Bacteria 36261
23 Ga0070676_10007742 3300005328 Bacteria 5768
24 Ga0070683_100308415 3300005329 Unclassified 1506
25 Ga0070683_100313696 3300005329 Bacteria 1492
26 Ga0070670_100138484 3300005331 Unclassified 2104
27 Ga0068869_100015199 3300005334 Bacteria 5157
28 Ga0068869_100074081 3300005334 Unclassified 2526
29 Ga0070666_10019429 3300005335 Bacteria 4385
30 Ga0070666_10204988 3300005335 Unclassified 1388
31 Ga0068868_100018320 3300005338 Bacteria 5233
32 Ga0070660_100295654 3300005339 Unclassified 1327
33 Ga0070668_100019749 3300005347 Bacteria 5074
34 Ga0070675_100045260 3300005354 Bacteria 3601
35 Ga0070675_100655815 3300005354 Bacteria 954
36 Ga0070671_100018776 3300005355 Bacteria 5620
37 Ga0070674_100142291 3300005356 Bacteria 1801
38 Ga0070673_100008345 3300005364 Bacteria 6881
39 Ga0070673_100036435 3300005364 Bacteria 3739
40 Ga0070673_100460208 3300005364 Bacteria 1145
41 Ga0070659_100031944 3300005366 Bacteria 4081
42 Ga0070667_100159338 3300005367 Bacteria 1987
43 Ga0070667_100180177 3300005367 Bacteria 1868
44 Ga0070678_100007159 3300005456 Bacteria 6597
45 Ga0070678_100052538 3300005456 Bacteria 2960
46 Ga0070662_100000055 3300005457 Bacteria 60567
47 Ga0070662_100037138 3300005457 Unclassified 3452
48 Ga0070662_100070270 3300005457 Bacteria 2579
49 Ga0068867_100027243 3300005459 Bacteria 4106
50 Ga0070685_10076676 3300005466 Bacteria 1994
51 Ga0068853_100007508 3300005539 Bacteria 8726
52 Ga0068853_100041576 3300005539 Bacteria 3927
53 Ga0068853_100097455 3300005539 Bacteria 2596
54 Ga0068853_100183017 3300005539 Bacteria 1901
55 Ga0070672_100004660 3300005543 Bacteria 8991
56 Ga0070665_100000034 3300005548 Bacteria 324289
57 Ga0070665_100011887 3300005548 Bacteria 8791
58 Ga0068855_100000122 3300005563 Bacteria 97622
59 Ga0068855_100001132 3300005563 Bacteria 33103
60 Ga0068855_100007517 3300005563 Bacteria 13191
61 Ga0068855_100016135 3300005563 Bacteria 8982
62 Ga0068855_100047210 3300005563 Bacteria 5088
63 Ga0068855_100127781 3300005563 Bacteria 2905
64 Ga0068855_100164631 3300005563 Bacteria 2515
65 Ga0068855_100940695 3300005563 Bacteria 911
66 Ga0070664_100169691 3300005564 Unclassified 1935
67 Ga0068857_100057018 3300005577 Bacteria 3467
68 Ga0068857_100116503 3300005577 Bacteria 2404
69 Ga0068857_101213941 3300005577 Bacteria 730
70 Ga0068854_100129572 3300005578 Bacteria 1925
71 Ga0068854_100245910 3300005578 Unclassified 1426
72 Ga0068856_100018522 3300005614 Bacteria 6748
73 Ga0068856_100056912 3300005614 Bacteria 3860
74 Ga0068852_100003135 3300005616 Bacteria 11516
75 Ga0068859_100290289 3300005617 Bacteria 1729
76 Ga0068866_10026258 3300005718 Bacteria 2748
77 Ga0068861_100005802 3300005719 Bacteria 8381
78 Ga0068861_100048778 3300005719 Bacteria 3203
79 Ga0068870_10010474 3300005840 Bacteria 4265
80 Ga0068870_10029664 3300005840 Bacteria 2757
81 Ga0068863_100029768 3300005841 Bacteria 5213
82 Ga0068858_100112683 3300005842 Bacteria 2540
83 Ga0075366_10000392 3300006195 Bacteria 20343
84 Ga0075366_10000653 3300006195 Bacteria 16326
85 Ga0075366_10003359 3300006195 Bacteria 8424
86 Ga0097621_100001503 3300006237 Bacteria 15966
87 Ga0097621_100052072 3300006237 Bacteria 3334
88 Ga0097621_100086734 3300006237 Unclassified 2613
89 Ga0097621_100145460 3300006237 Bacteria 2029
90 Ga0097621_100188718 3300006237 Bacteria 1784
91 Ga0075370_10076888 3300006353 Bacteria 1915
92 Ga0068871_100000099 3300006358 Bacteria 51278
93 Ga0068871_100004512 3300006358 Bacteria 9700
94 Ga0068871_100074709 3300006358 Bacteria 2797
95 Ga0068871_100095270 3300006358 Unclassified 2486
96 Ga0068871_100282266 3300006358 Bacteria 1453
97 Ga0068865_100000055 3300006881 Bacteria 62584
98 Ga0068865_100003508 3300006881 Bacteria 9402
99 Ga0068865_100185620 3300006881 Bacteria 1604
100 Ga0097620_100290291 3300006931 Bacteria 1729
101 Ga0105251_10036484 3300009011 Unclassified 2418
102 Ga0105240_10004347 3300009093 Bacteria 21631
103 Ga0105240_10018298 3300009093 Bacteria 9417
104 Ga0105240_10024342 3300009093 Bacteria 7984
105 Ga0105240_10094566 3300009093 Bacteria 3644
106 Ga0105245_10246931 3300009098 Bacteria 1733
107 Ga0105241_10017740 3300009174 Bacteria 5234
108 Ga0105241_10078973 3300009174 Bacteria 2572
109 Ga0105242_10012932 3300009176 Bacteria 6435
110 Ga0105248_10220495 3300009177 Unclassified 2135
111 Ga0105237_10001160 3300009545 Bacteria 35249
112 Ga0105237_10012114 3300009545 Bacteria 9102
113 Ga0105237_10013650 3300009545 Bacteria 8507
114 Ga0105237_10014787 3300009545 Bacteria 8144
115 Ga0105237_10115874 3300009545 Unclassified 2673
116 Ga0105238_10005104 3300009551 Bacteria 12980
117 Ga0105238_10035466 3300009551 Bacteria 5071
118 Ga0105249_10116291 3300009553 Bacteria 2535
119 Ga0105249_10692296 3300009553 Bacteria 1079
120 Ga0105239_10000002 3300010375 Bacteria 610298
121 Ga0105239_10000006 3300010375 Bacteria 442319
122 Ga0105239_10002817 3300010375 Bacteria 21748
123 Ga0105239_10003056 3300010375 Bacteria 20800
124 Ga0105239_10003325 3300010375 Bacteria 19787
125 Ga0105239_10095505 3300010375 Bacteria 3284
126 Ga0105239_10611722 3300010375 Bacteria 1243
127 Ga0105239_10667489 3300010375 Bacteria 1188
128 Ga0105246_10024473 3300011119 Bacteria 3924
129 Ga0157373_10000037 3300013100 Bacteria 121670
130 Ga0157373_10001486 3300013100 Bacteria 17867
131 Ga0157371_10000141 3300013102 Bacteria 104396
132 Ga0157371_10007182 3300013102 Bacteria 9048
133 Ga0157371_10304519 3300013102 Bacteria 1154
134 Ga0157370_10072690 3300013104 Bacteria 3245
135 Ga0157370_10341994 3300013104 Bacteria 1379
136 Ga0157370_10573573 3300013104 Bacteria 1034
137 Ga0157369_10070795 3300013105 Bacteria 3746
138 Ga0157374_10000051 3300013296 Bacteria 126876
139 Ga0157374_10012812 3300013296 Bacteria 7303
140 Ga0157374_10014360 3300013296 Bacteria 6931
141 Ga0157374_10017459 3300013296 Bacteria 6319
142 Ga0157374_10074279 3300013296 Unclassified 3210
143 Ga0157374_10263460 3300013296 Bacteria 1698
144 Ga0157378_10108928 3300013297 Bacteria 2537
145 Ga0157378_10285849 3300013297 Bacteria 1591
146 Ga0157378_10323263 3300013297 Bacteria 1499
147 Ga0163162_10000018 3300013306 Bacteria 226257
148 Ga0163162_10001999 3300013306 Bacteria 19184
149 Ga0163162_10014095 3300013306 Bacteria 7813
150 Ga0163162_10256901 3300013306 Bacteria 1879
151 Ga0157372_10000418 3300013307 Bacteria 46635
152 Ga0157372_10002874 3300013307 Bacteria 18616
153 Ga0157372_10005186 3300013307 Bacteria 13851
154 Ga0157372_10043718 3300013307 Bacteria 4961
155 Ga0157372_10057282 3300013307 Bacteria 4356
156 Ga0157372_10368162 3300013307 Bacteria 1674
157 Ga0157372_10660852 3300013307 Bacteria 1217
158 Ga0157375_10006776 3300013308 Bacteria 9979
159 Ga0157375_10493075 3300013308 Bacteria 1389
160 Ga0157377_10270202 3300014745 Bacteria 1110
161 Ga0157376_10011884 3300014969 Bacteria 6437
162 Ga0157376_10099623 3300014969 Bacteria 2536
163 Ga0157376_10293076 3300014969 Bacteria 1537
164 Ga0157376_10317251 3300014969 Bacteria 1481
165 Ga0163161_10068336 3300017792 Unclassified 2596
166 Ga0163161_10152414 3300017792 Bacteria 1758
167 Ga0213872_10075469 3300021361 Bacteria 1517
168 Ga0209563_109440 3300025230 Bacteria 1473
169 Ga0207427_100090 3300025231 Bacteria 133759
170 Ga0209437_100034 3300025233 Bacteria 494007
171 Ga0209437_100177 3300025233 Bacteria 135759
172 Ga0209026_1000316 3300025250 Bacteria 51844
173 Ga0209026_1001032 3300025250 Bacteria 13689
174 Ga0209233_1000038 3300025261 Bacteria 548972
175 Ga0209233_1001836 3300025261 Bacteria 8150
176 Ga0207656_10228124 3300025321 Unclassified 907
177 Ga0207710_10055340 3300025900 Bacteria 1788
178 Ga0207647_10000405 3300025904 Bacteria 35306
179 Ga0207647_10009160 3300025904 Bacteria 7042
180 Ga0207647_10094194 3300025904 Bacteria 1784
181 Ga0207645_10000046 3300025907 Bacteria 85043
182 Ga0207645_10000219 3300025907 Bacteria 47364
183 Ga0207643_10246289 3300025908 Bacteria 1100
184 Ga0207705_10000457 3300025909 Bacteria 35062
185 Ga0207654_10014229 3300025911 Bacteria 4108
186 Ga0207654_10119946 3300025911 Bacteria 1650
187 Ga0207654_10259230 3300025911 Bacteria 1168
188 Ga0207695_10034279 3300025913 Bacteria 5524
189 Ga0207695_10049377 3300025913 Bacteria 4436
190 Ga0207695_10076552 3300025913 Bacteria 3401
191 Ga0207695_10084167 3300025913 Bacteria 3211
192 Ga0207695_10093301 3300025913 Bacteria 3019
193 Ga0207671_10001003 3300025914 Bacteria 34695
194 Ga0207671_10008874 3300025914 Bacteria 8465
195 Ga0207671_10036864 3300025914 Bacteria 3626
196 Ga0207671_10045776 3300025914 Bacteria 3236
197 Ga0207671_10083798 3300025914 Bacteria 2394
198 Ga0207657_10091730 3300025919 Bacteria 2532
199 Ga0207657_10116623 3300025919 Bacteria 2200
200 Ga0207650_10171144 3300025925 Bacteria 1726
201 Ga0207659_10123758 3300025926 Bacteria 1985
202 Ga0207687_10323675 3300025927 Bacteria 1249
203 Ga0207644_10014000 3300025931 Bacteria 5362
204 Ga0207690_10011580 3300025932 Bacteria 5269
205 Ga0207690_10231988 3300025932 Bacteria 1417
206 Ga0207706_10000123 3300025933 Bacteria 83810
207 Ga0207706_10047879 3300025933 Unclassified 3782
208 Ga0207706_10089187 3300025933 Bacteria 2711
209 Ga0207686_10140555 3300025934 Bacteria 1668
210 Ga0207669_10017882 3300025937 Bacteria 3649
211 Ga0207704_10000058 3300025938 Bacteria 77010
212 Ga0207704_10005864 3300025938 Bacteria 5686
213 Ga0207704_10136433 3300025938 Bacteria 1709
214 Ga0207704_10255659 3300025938 Bacteria 1318
215 Ga0207691_10019389 3300025940 Bacteria 6437
216 Ga0207689_10001199 3300025942 Bacteria 24909
217 Ga0207689_10026945 3300025942 Bacteria 4811
218 Ga0207661_10005102 3300025944 Bacteria 9218
219 Ga0207661_10200104 3300025944 Unclassified 1756
220 Ga0207679_10155425 3300025945 Unclassified 1867
221 Ga0207667_10000020 3300025949 Bacteria 374770
222 Ga0207667_10000993 3300025949 Bacteria 36313
223 Ga0207667_10039885 3300025949 Bacteria 5001
224 Ga0207667_10258255 3300025949 Bacteria 1782
225 Ga0207651_10070119 3300025960 Bacteria 2478
226 Ga0207651_10246135 3300025960 Bacteria 1460
227 Ga0207712_10039961 3300025961 Bacteria 3217
228 Ga0207668_10074568 3300025972 Bacteria 2436
229 Ga0207668_10234414 3300025972 Bacteria 1481
230 Ga0207640_10158863 3300025981 Bacteria 1670
231 Ga0207640_10211469 3300025981 Unclassified 1478
232 Ga0207658_10187576 3300025986 Bacteria 1716
233 Ga0207703_10176179 3300026035 Unclassified 1884
234 Ga0207639_10014121 3300026041 Bacteria 5607
235 Ga0207639_10033863 3300026041 Bacteria 3772
236 Ga0207639_10090478 3300026041 Bacteria 2448
237 Ga0207639_10341645 3300026041 Bacteria 1335
238 Ga0207678_10201246 3300026067 Bacteria 1703
239 Ga0207702_10013672 3300026078 Bacteria 6742
240 Ga0207702_10094254 3300026078 Bacteria 2627
241 Ga0207702_10163569 3300026078 Bacteria 2034
242 Ga0207648_10002523 3300026089 Bacteria 19646
243 Ga0207648_10003611 3300026089 Bacteria 16173
244 Ga0207674_10315143 3300026116 Bacteria 1513
245 Ga0207675_100006970 3300026118 Bacteria 10691
246 Ga0207675_100026719 3300026118 Bacteria 5373
247 Ga0207683_10000730 3300026121 Bacteria 29877
248 Ga0207683_10078334 3300026121 Bacteria 2928
249 Ga0207698_10009189 3300026142 Bacteria 6287
250 Ga0207698_10020022 3300026142 Bacteria 4596
251 Ga0268266_10000111 3300028379 Bacteria 169743
252 Ga0268266_10300821 3300028379 Bacteria 1496
253 Ga0268264_11291980 3300028381 Unclassified 740
254 Ga0307517_10008073 3300028786 Bacteria 15174
255 Ga0307515_10000002 3300028794 Bacteria 1231751
256 Ga0307515_10000007 3300028794 Bacteria 719669
257 Ga0307515_10000794 3300028794 Bacteria 72827
258 Ga0307515_10002207 3300028794 Bacteria 42742
259 Ga0307514_10122891 3300031649 Bacteria 1806
260 Ga0307507_10000010 3300033179 Bacteria 265208
261 Ga0307510_10002664 3300033180 Bacteria 20420
262 Ga0395899_0000462 3300037312 Bacteria 46052
263 Ga0395899_0030919 3300037312 Bacteria 4026
264 Ga0395900_0000141 3300037418 Bacteria 121159
265 Ga0395900_0000155 3300037418 Bacteria 113606
266 Ga0395900_0007460 3300037418 Bacteria 11304
267 Ga0395898_0007157 3300037466 Bacteria 11847
268 Ga0395905_0000124 3300037471 Bacteria 126707
269 Ga0395905_0000496 3300037471 Bacteria 54071
270 Ga0395905_0162591 3300037471 Bacteria 2098
271 Ga0395901_0000138 3300038443 Bacteria 94944
272 Ga0395901_0010646 3300038443 Bacteria 9320
273 Ga0436361_1129343 3300039447 Bacteria 3795
274 Ga0439431_0005112 3300041997 Bacteria 2893
275 Ga0439448_0021382 3300042005 Bacteria 2006
276 Ga0451577_0325188 3300042876 Bacteria 1395
277 Ga0453683_0182398 3300044673 Bacteria 1331
278 Ga0453684_0101302 3300044712 Bacteria 3524
279 Ga0453684_0272190 3300044712 Bacteria 1935
280 Ga0451576_0007869 3300045051 Bacteria 12632
281 Ga0451576_0632284 3300045051 Bacteria 1125
282 Ga0495638_0136320 3300046460 Bacteria 1437
283 Ga0495651_0156898 3300046462 Bacteria 1635
284 Ga0495650_0000003 3300046471 Bacteria 900730
285 Ga0495650_0031979 3300046471 Bacteria 2359
286 Ga0495650_0065075 3300046471 Bacteria 1448
287 Ga0495650_0163163 3300046471 Bacteria 793
288 Ga0495585_0000079 3300046492 Bacteria 100159
289 Ga0495585_0000330 3300046492 Bacteria 46311
290 Ga0495596_0018227 3300046500 Bacteria 2896
291 Ga0495583_0135372 3300046506 Bacteria 1029
292 Ga0495606_0000163 3300046507 Bacteria 117268
293 Ga0495606_0007123 3300046507 Bacteria 10108
294 Ga0495606_0134317 3300046507 Unclassified 1467
295 Ga0495610_0001356 3300046512 Bacteria 21738
296 Ga0495616_0012051 3300046513 Bacteria 4921
297 Ga0495616_0086976 3300046513 Bacteria 1486
298 Ga0495631_0040003 3300046518 Bacteria 2078
299 Ga0495637_0045250 3300046520 Bacteria 1869
300 Ga0495644_0028992 3300046523 Bacteria 2093
301 Ga0495648_0007985 3300046524 Bacteria 8395
302 Ga0495633_0000044 3300046558 Bacteria 171185
303 Ga0495633_0014741 3300046558 Bacteria 4076
304 Ga0495668_0000044 3300046616 Bacteria 227585
305 Ga0495625_0000159 3300046660 Bacteria 104355
306 Ga0495625_0000900 3300046660 Bacteria 40074
307 Ga0495625_0001731 3300046660 Bacteria 25313
308 Ga0495625_0052513 3300046660 Bacteria 2918
309 Ga0495625_0063108 3300046660 Bacteria 2617
310 Ga0495625_0150792 3300046660 Bacteria 1563
311 Ga0495625_0178227 3300046660 Bacteria 1415
312 Ga0495625_0289326 3300046660 Bacteria 1052
313 Ga0495661_0004111 3300046665 Bacteria 10601
314 Ga0495661_0047570 3300046665 Bacteria 2611
315 Ga0495649_0000003 3300046694 Bacteria 880817
316 Ga0495676_0262039 3300047321 Bacteria 1176
317 Ga0495687_001658 3300047443 Bacteria 19993
318 Ga0495687_031205 3300047443 Bacteria 2446
319 Ga0495673_0049982 3300047469 Bacteria 1838
320 Ga0495686_0000372 3300047472 Bacteria 72285
321 Ga0496105_0315688 3300048908 Unclassified 1254
322 Ga0496110_0017209 3300048913 Bacteria 6045
323 Ga0496116_0010362 3300048919 Bacteria 7826
324 Ga0496117_0000289 3300048920 Bacteria 90202
325 Ga0496122_0006957 3300048925 Bacteria 12743
326 Ga0495678_108023 3300049459 Bacteria 953
327 Ga0495682_0019819 3300049460 Bacteria 2527
328 nmdc:mga0k408_151_c2 3300050493 Bacteria 30883
329 nmdc:mga0k408_1790_c1 3300050493 Bacteria 11512
330 nmdc:mga0k408_75_c2 3300050493 Bacteria 16345
331 nmdc:mga07m45_75778_c1 3300050496 Bacteria 1917
332 Ga0500644_0167057 3300053088 Bacteria 893
333 Ga0500608_003428 3300053122 Bacteria 5942
334 Ga0500618_000001 3300053125 Bacteria 538477
335 Ga0500568_0151545 3300053139 Bacteria 858
336 Ga0500622_0000175 3300053156 Bacteria 69363
337 Ga0500624_000623 3300053157 Bacteria 9484
338 Ga0500634_0026862 3300053161 Bacteria 3135
339 Ga0500611_000011 3300053727 Bacteria 141259
340 2599478038 2599185184 Bacteria 6430550
341 2722728490 2721755487 Bacteria 6357185
342 2852624134 2852623160 Bacteria 4376875
343 2884936946 2884933994 Bacteria 4535041
344 2904784600 2904780799 Bacteria 5840761
345 2919181193 2919177583 Bacteria 5641607
346 2919441008 2919437846 Bacteria 6199444
347 2928079999 2928078545 Bacteria 6534839
348 2928147544 2928147474 Bacteria 6512076
349 2932083636 2932082852 Bacteria 6563563
350 Ga0495649_0098462
351 JGI24736J21556_1009937
352 JGI24740J21852_10029816
353 JGI24740J21852_10039468
354 JGI24737J22298_10000078
355 JGI24737J22298_10093237
356 JGI24735J21928_10000050
357 JGI24735J21928_10019866
358 JGI25162J39368_1000062
359 JGI25162J39368_1000733
360 JGI25165J46597_1001666
361 rootH1_10018511
362 rootH2_10001274
363 rootL2_10047782
364 rootL2_10083044
365 rootH1_10005306
366 rootH1_10009847
367 rootH1_10244779
368 Ga0065714_10009821
369 Ga0070658_10001195
370 Ga0070658_10077338
371 Ga0070676_10000058
372 Ga0070676_10007742
373 Ga0070683_100308415
374 Ga0070683_100313696
375 Ga0070670_100138484
376 Ga0068869_100015199
377 Ga0068869_100074081
378 Ga0070666_10019429
379 Ga0070666_10204988
380 Ga0068868_100018320
381 Ga0070660_100295654
382 Ga0070668_100019749
383 Ga0070675_100045260
384 Ga0070675_100655815
385 Ga0070671_100018776
386 Ga0070674_100142291
387 Ga0070673_100008345
388 Ga0070673_100036435
389 Ga0070673_100460208
390 Ga0070659_100031944
391 Ga0070667_100159338
392 Ga0070667_100180177
393 Ga0070678_100007159
394 Ga0070678_100052538
395 Ga0070662_100000055
396 Ga0070662_100037138
397 Ga0070662_100070270
398 Ga0068867_100027243
399 Ga0070685_10076676
400 Ga0068853_100007508
401 Ga0068853_100041576
402 Ga0068853_100097455
403 Ga0068853_100183017
404 Ga0070672_100004660
405 Ga0070665_100000034
406 Ga0070665_100011887
407 Ga0068855_100000122
408 Ga0068855_100001132
409 Ga0068855_100007517
410 Ga0068855_100016135
411 Ga0068855_100047210
412 Ga0068855_100127781
413 Ga0068855_100164631
414 Ga0068855_100940695
415 Ga0070664_100169691
416 Ga0068857_100057018
417 Ga0068857_100116503
418 Ga0068857_101213941
419 Ga0068854_100129572
420 Ga0068854_100245910
421 Ga0068856_100018522
422 Ga0068856_100056912
423 Ga0068852_100003135
424 Ga0068859_100290289
425 Ga0068866_10026258
426 Ga0068861_100005802
427 Ga0068861_100048778
428 Ga0068870_10010474
429 Ga0068870_10029664
430 Ga0068863_100029768
431 Ga0068858_100112683
432 Ga0075366_10000392
433 Ga0075366_10000653
434 Ga0075366_10003359
435 Ga0097621_100001503
436 Ga0097621_100052072
437 Ga0097621_100086734
438 Ga0097621_100145460
439 Ga0097621_100188718
440 Ga0075370_10076888
441 Ga0068871_100000099
442 Ga0068871_100004512
443 Ga0068871_100074709
444 Ga0068871_100095270
445 Ga0068871_100282266
446 Ga0068865_100000055
447 Ga0068865_100003508
448 Ga0068865_100185620
449 Ga0097620_100290291
450 Ga0105251_10036484
451 Ga0105240_10004347
452 Ga0105240_10018298
453 Ga0105240_10024342
454 Ga0105240_10094566
455 Ga0105245_10246931
456 Ga0105241_10017740
457 Ga0105241_10078973
458 Ga0105242_10012932
459 Ga0105248_10220495
460 Ga0105237_10001160
461 Ga0105237_10012114
462 Ga0105237_10013650
463 Ga0105237_10014787
464 Ga0105237_10115874
465 Ga0105238_10005104
466 Ga0105238_10035466
467 Ga0105249_10116291
468 Ga0105249_10692296
469 Ga0105239_10000002
470 Ga0105239_10000006
471 Ga0105239_10002817
472 Ga0105239_10003056
473 Ga0105239_10003325
474 Ga0105239_10095505
475 Ga0105239_10611722
476 Ga0105239_10667489
477 Ga0105246_10024473
478 Ga0157373_10000037
479 Ga0157373_10001486
480 Ga0157371_10000141
481 Ga0157371_10007182
482 Ga0157371_10304519
483 Ga0157370_10072690
484 Ga0157370_10341994
485 Ga0157370_10573573
486 Ga0157369_10070795
487 Ga0157374_10000051
488 Ga0157374_10012812
489 Ga0157374_10014360
490 Ga0157374_10017459
491 Ga0157374_10074279
492 Ga0157374_10263460
493 Ga0157378_10108928
494 Ga0157378_10285849
495 Ga0157378_10323263
496 Ga0163162_10000018
497 Ga0163162_10001999
498 Ga0163162_10014095
499 Ga0163162_10256901
500 Ga0157372_10000418
501 Ga0157372_10002874
502 Ga0157372_10005186
503 Ga0157372_10043718
504 Ga0157372_10057282
505 Ga0157372_10368162
506 Ga0157372_10660852
507 Ga0157375_10006776
508 Ga0157375_10493075
509 Ga0157377_10270202
510 Ga0157376_10011884
511 Ga0157376_10099623
512 Ga0157376_10293076
513 Ga0157376_10317251
514 Ga0163161_10068336
515 Ga0163161_10152414
516 Ga0213872_10075469
517 Ga0209563_109440
518 Ga0207427_100090
519 Ga0209437_100034
520 Ga0209437_100177
521 Ga0209026_1000316
522 Ga0209026_1001032
523 Ga0209233_1000038
524 Ga0209233_1001836
525 Ga0207656_10228124
526 Ga0207710_10055340
527 Ga0207647_10000405
528 Ga0207647_10009160
529 Ga0207647_10094194
530 Ga0207645_10000046
531 Ga0207645_10000219
532 Ga0207643_10246289
533 Ga0207705_10000457
534 Ga0207654_10014229
535 Ga0207654_10119946
536 Ga0207654_10259230
537 Ga0207695_10034279
538 Ga0207695_10049377
539 Ga0207695_10076552
540 Ga0207695_10084167
541 Ga0207695_10093301
542 Ga0207671_10001003
543 Ga0207671_10008874
544 Ga0207671_10036864
545 Ga0207671_10045776
546 Ga0207671_10083798
547 Ga0207657_10091730
548 Ga0207657_10116623
549 Ga0207650_10171144
550 Ga0207659_10123758
551 Ga0207687_10323675
552 Ga0207644_10014000
553 Ga0207690_10011580
554 Ga0207690_10231988
555 Ga0207706_10000123
556 Ga0207706_10047879
557 Ga0207706_10089187
558 Ga0207686_10140555
559 Ga0207669_10017882
560 Ga0207704_10000058
561 Ga0207704_10005864
562 Ga0207704_10136433
563 Ga0207704_10255659
564 Ga0207691_10019389
565 Ga0207689_10001199
566 Ga0207689_10026945
567 Ga0207661_10005102
568 Ga0207661_10200104
569 Ga0207679_10155425
570 Ga0207667_10000020
571 Ga0207667_10000993
572 Ga0207667_10039885
573 Ga0207667_10258255
574 Ga0207651_10070119
575 Ga0207651_10246135
576 Ga0207712_10039961
577 Ga0207668_10074568
578 Ga0207668_10234414
579 Ga0207640_10158863
580 Ga0207640_10211469
581 Ga0207658_10187576
582 Ga0207703_10176179
583 Ga0207639_10014121
584 Ga0207639_10033863
585 Ga0207639_10090478
586 Ga0207639_10341645
587 Ga0207678_10201246
588 Ga0207702_10013672
589 Ga0207702_10094254
590 Ga0207702_10163569
591 Ga0207648_10002523
592 Ga0207648_10003611
593 Ga0207674_10315143
594 Ga0207675_100006970
595 Ga0207675_100026719
596 Ga0207683_10000730
597 Ga0207683_10078334
598 Ga0207698_10009189
599 Ga0207698_10020022
600 Ga0268266_10000111
601 Ga0268266_10300821
602 Ga0268264_11291980
603 Ga0307517_10008073
604 Ga0307515_10000002
605 Ga0307515_10000007
606 Ga0307515_10000794
607 Ga0307515_10002207
608 Ga0307514_10122891
609 Ga0307507_10000010
610 Ga0307510_10002664
611 Ga0395899_0000462
612 Ga0395899_0030919
613 Ga0395900_0000141
614 Ga0395900_0000155
615 Ga0395900_0007460
616 Ga0395898_0007157
617 Ga0395905_0000124
618 Ga0395905_0000496
619 Ga0395905_0162591
620 Ga0395901_0000138
621 Ga0395901_0010646
622 Ga0436361_1129343
623 Ga0439431_0005112
624 Ga0439448_0021382
625 Ga0451577_0325188
626 Ga0453683_0182398
627 Ga0453684_0101302
628 Ga0453684_0272190
629 Ga0451576_0007869
630 Ga0451576_0632284
631 Ga0495638_0136320
632 Ga0495651_0156898
633 Ga0495650_0000003
634 Ga0495650_0031979
635 Ga0495650_0065075
636 Ga0495650_0163163
637 Ga0495585_0000079
638 Ga0495585_0000330
639 Ga0495596_0018227
640 Ga0495583_0135372
641 Ga0495606_0000163
642 Ga0495606_0007123
643 Ga0495606_0134317
644 Ga0495610_0001356
645 Ga0495616_0012051
646 Ga0495616_0086976
647 Ga0495631_0040003
648 Ga0495637_0045250
649 Ga0495644_0028992
650 Ga0495648_0007985
651 Ga0495633_0000044
652 Ga0495633_0014741
653 Ga0495668_0000044
654 Ga0495625_0000159
655 Ga0495625_0000900
656 Ga0495625_0001731
657 Ga0495625_0052513
658 Ga0495625_0063108
659 Ga0495625_0150792
660 Ga0495625_0178227
661 Ga0495625_0289326
662 Ga0495661_0004111
663 Ga0495661_0047570
664 Ga0495649_0000003
665 Ga0495676_0262039
666 Ga0495687_001658
667 Ga0495687_031205
668 Ga0495673_0049982
669 Ga0495686_0000372
670 Ga0496105_0315688
671 Ga0496110_0017209
672 Ga0496116_0010362
673 Ga0496117_0000289
674 Ga0496122_0006957
675 Ga0495678_108023
676 Ga0495682_0019819
677 nmdc:mga0k408_151_c2
678 nmdc:mga0k408_1790_c1
679 nmdc:mga0k408_75_c2
680 nmdc:mga07m45_75778_c1
681 Ga0500644_0167057
682 Ga0500608_003428
683 Ga0500618_000001
684 Ga0500568_0151545
685 Ga0500622_0000175
686 Ga0500624_000623
687 Ga0500634_0026862
688 Ga0500611_000011
689 2599478038
690 2722728490
691 2852624134
692 2884936946
693 2904784600
694 2919181193
695 2919441008
696 2928079999
697 2928147544
698 2932083636

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

3

170

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ddh-assembly1.cif.gz_B the structure of a putative haloacid dehalogenase-like family hydrolase from bacteroides thetaiotaomicron vpi-5482 0.9533 3 225
2pke-assembly1.cif.gz_A crystal structure of haloacid delahogenase-like family hydrolase (np_639141.1) from xanthomonas campestris at 1.81 a resolution 0.9484 2 225
3ddh-assembly1.cif.gz_A the structure of a putative haloacid dehalogenase-like family hydrolase from bacteroides thetaiotaomicron vpi-5482 0.9381 3 225
3ddh-assembly1.cif.gz_B the structure of a putative haloacid dehalogenase-like family hydrolase from bacteroides thetaiotaomicron vpi-5482 0.9241 3 225
2pke-assembly1.cif.gz_B crystal structure of haloacid delahogenase-like family hydrolase (np_639141.1) from xanthomonas campestris at 1.81 a resolution 0.9188 3 225
ID Description Score Start End Superfamily
3ddhB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9581 19 97 1.10.150.240
3ddhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9354 3 225 3.40.50.1000
3ddhB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9348 19 97 1.10.150.240
2pkeB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.93 3 225 3.40.50.1000
af_Q9W4J7_113_224_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9085 102 193 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A7Y4VKY2-F1-model_v4 HAD hydrolase-like protein 0.9925 2 169 GO:0016787
AF-A0A2N2XIM3-F1-model_v4 deleted 0.9892 1 147
AF-A0A7Y3HRJ6-F1-model_v4 HAD hydrolase-like protein 0.9858 2 196 GO:0016787
AF-A0A7T4YGC6-F1-model_v4 HAD family hydrolase 0.9855 2 222 GO:0016787
AF-A0A7U4E8U0-F1-model_v4 Haloacid dehalogenase domain protein hydrolase 0.985 1 226 GO:0016787

Map