F418012

General Info

Members Datasets Scaffolds Average Seq Length
349 215 349 206

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0098134|Ga0496100_0098134_251_952
Length 233
Sequence MDPAIALRGFILGFTIAASVGPISLLVIRRTLAEGRFYGFVSGLGVATADATYGAIAAFGLAAVTNVLVNARQVLGLAGGAFLLWLAWQTIRSRPTEAATVPSGRRGYVAAYLSILGLTLANPMTILSFGALFAGFGVTHGVTGDAVVIVLGVLLGSTTWWLVLTTAIGAMRLRVTPAWIGRINVASGVVIGVFAVLVIASAVVAGPSAGSAAQRGGGPEASRAAVTPRPGSG

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
107 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
108 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
109 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
128 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
197 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
198 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
201 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
202 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
203 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
204 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
205 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
206 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
209 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
210 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.17
Nodule 0
Rhizoplane 8.02
Rhizosphere 81.38
Stem 0
Stem Tuber 0
Unclassified 1.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000048 3300003215 Bacteria 141500
2 Ga0055531_10012321 3300003794 Bacteria 4034
3 Ga0070670_100294524 3300005331 Bacteria 1418
4 Ga0068869_100128790 3300005334 Bacteria 1943
5 Ga0068869_100728578 3300005334 Bacteria 847
6 Ga0070682_100424173 3300005337 Bacteria 1012
7 Ga0068868_100402354 3300005338 Unclassified 1182
8 Ga0070689_101009181 3300005340 Bacteria 741
9 Ga0070661_100138776 3300005344 Bacteria 1831
10 Ga0070692_10312930 3300005345 Bacteria 963
11 Ga0070692_10599365 3300005345 Bacteria 729
12 Ga0070668_100265891 3300005347 Bacteria 1428
13 Ga0070669_100085038 3300005353 Bacteria 2362
14 Ga0070675_100009207 3300005354 Bacteria 7671
15 Ga0070674_100050305 3300005356 Bacteria 2869
16 Ga0070674_100416089 3300005356 Bacteria 1102
17 Ga0070674_100752191 3300005356 Bacteria 838
18 Ga0070673_100183273 3300005364 Bacteria 1793
19 Ga0070688_100005106 3300005365 Bacteria 6882
20 Ga0070659_100218603 3300005366 Bacteria 1572
21 Ga0070701_10053073 3300005438 Bacteria 2109
22 Ga0070700_100003207 3300005441 Bacteria 8408
23 Ga0070700_100044824 3300005441 Bacteria 2726
24 Ga0070694_100128169 3300005444 Bacteria 1830
25 Ga0070708_100754247 3300005445 Bacteria 915
26 Ga0070663_100803816 3300005455 Bacteria 806
27 Ga0070662_100013088 3300005457 Bacteria 5515
28 Ga0070662_100450070 3300005457 Bacteria 1069
29 Ga0068867_100018122 3300005459 Bacteria 5003
30 Ga0070685_10003827 3300005466 Bacteria 7611
31 Ga0070706_100146656 3300005467 Bacteria 2204
32 Ga0070707_100077586 3300005468 Bacteria 3205
33 Ga0070698_100008251 3300005471 Bacteria 11261
34 Ga0070698_100234365 3300005471 Bacteria 1769
35 Ga0070699_100038377 3300005518 Bacteria 4147
36 Ga0070699_100369043 3300005518 Bacteria 1295
37 Ga0070699_100486622 3300005518 Bacteria 1120
38 Ga0070699_100842960 3300005518 Bacteria 839
39 Ga0070679_100146573 3300005530 Bacteria 2338
40 Ga0070697_100018222 3300005536 Bacteria 5534
41 Ga0070697_100450588 3300005536 Bacteria 1121
42 Ga0070686_100014321 3300005544 Bacteria 4569
43 Ga0070695_100304804 3300005545 Bacteria 1179
44 Ga0070696_100083218 3300005546 Bacteria 2269
45 Ga0070696_100274445 3300005546 Bacteria 1283
46 Ga0070664_100430428 3300005564 Bacteria 1209
47 Ga0070702_100174338 3300005615 Bacteria 1402
48 Ga0068852_100041831 3300005616 Bacteria 3876
49 Ga0068859_100004835 3300005617 Bacteria 13711
50 Ga0068864_100013049 3300005618 Bacteria 6881
51 Ga0068866_10046132 3300005718 Bacteria 2190
52 Ga0068861_100660206 3300005719 Bacteria 967
53 Ga0068861_101209513 3300005719 Bacteria 731
54 Ga0068870_10234209 3300005840 Bacteria 1130
55 Ga0068858_100023530 3300005842 Bacteria 5738
56 Ga0068858_100192712 3300005842 Bacteria 1926
57 Ga0068860_100132513 3300005843 Bacteria 2393
58 Ga0068862_100029096 3300005844 Bacteria 4653
59 Ga0068862_100070316 3300005844 Bacteria 3021
60 Ga0081539_10045352 3300005985 Bacteria 2529
61 Ga0075362_10084089 3300006177 Bacteria 1470
62 Ga0097621_100348693 3300006237 Unclassified 1316
63 Ga0075428_100124504 3300006844 Bacteria 2806
64 Ga0075433_10374270 3300006852 Bacteria 1258
65 Ga0075434_100058871 3300006871 Bacteria 3819
66 Ga0075434_100068003 3300006871 Bacteria 3549
67 Ga0068865_100124952 3300006881 Bacteria 1919
68 Ga0097620_100004835 3300006931 Bacteria 13711
69 Ga0075435_100245689 3300007076 Bacteria 1523
70 Ga0075435_100481426 3300007076 Bacteria 1072
71 Ga0111539_10049311 3300009094 Bacteria 5022
72 Ga0111539_10377162 3300009094 Unclassified 1651
73 Ga0105245_10017207 3300009098 Bacteria 6306
74 Ga0105245_10454518 3300009098 Bacteria 1290
75 Ga0105245_10538210 3300009098 Bacteria 1189
76 Ga0105245_11213753 3300009098 Bacteria 802
77 Ga0114129_10087068 3300009147 Bacteria 4332
78 Ga0114129_12050848 3300009147 Unclassified 691
79 Ga0105243_10009939 3300009148 Bacteria 7232
80 Ga0105243_10356717 3300009148 Bacteria 1344
81 Ga0105242_10093585 3300009176 Bacteria 2534
82 Ga0105248_10089583 3300009177 Bacteria 3463
83 Ga0105248_10421391 3300009177 Bacteria 1503
84 Ga0105237_10449952 3300009545 Bacteria 1294
85 Ga0105238_10043522 3300009551 Bacteria 4543
86 Ga0105249_10002179 3300009553 Bacteria 16968
87 Ga0105239_10013128 3300010375 Bacteria 9204
88 Ga0105239_10624687 3300010375 Unclassified 1230
89 Ga0105246_10150347 3300011119 Bacteria 1762
90 Ga0157378_10009038 3300013297 Bacteria 8672
91 Ga0157375_10002966 3300013308 Bacteria 14734
92 Ga0157375_10501906 3300013308 Bacteria 1377
93 Ga0163163_10053629 3300014325 Bacteria 3981
94 Ga0163163_10177399 3300014325 Bacteria 2177
95 Ga0157380_10028334 3300014326 Bacteria 4269
96 Ga0157380_10054320 3300014326 Bacteria 3178
97 Ga0157380_10120513 3300014326 Bacteria 2221
98 Ga0157377_10004215 3300014745 Bacteria 6582
99 Ga0157377_10298598 3300014745 Unclassified 1062
100 Ga0163161_10099873 3300017792 Bacteria 2159
101 Ga0209758_1000048 3300025297 Bacteria 358400
102 Ga0209050_1005599 3300025298 Bacteria 7798
103 Ga0207426_1067470 3300025302 Bacteria 1008
104 Ga0209051_1054023 3300025303 Bacteria 1315
105 Ga0209257_1000237 3300025304 Bacteria 128812
106 Ga0207643_10005851 3300025908 Bacteria 6568
107 Ga0207684_10015022 3300025910 Bacteria 6666
108 Ga0207660_10150508 3300025917 Unclassified 1787
109 Ga0207662_10000834 3300025918 Bacteria 14168
110 Ga0207652_10138876 3300025921 Bacteria 2172
111 Ga0207646_10089546 3300025922 Bacteria 2754
112 Ga0207681_10031911 3300025923 Bacteria 3444
113 Ga0207650_10021877 3300025925 Bacteria 4524
114 Ga0207659_10012956 3300025926 Bacteria 5326
115 Ga0207687_10177414 3300025927 Bacteria 1648
116 Ga0207706_10011128 3300025933 Bacteria 8199
117 Ga0207706_10437088 3300025933 Bacteria 1133
118 Ga0207706_10492591 3300025933 Bacteria 1058
119 Ga0207709_10267116 3300025935 Bacteria 1257
120 Ga0207709_10270546 3300025935 Bacteria 1250
121 Ga0207669_10015240 3300025937 Bacteria 3873
122 Ga0207669_10066074 3300025937 Bacteria 2247
123 Ga0207704_10069292 3300025938 Bacteria 2228
124 Ga0207704_10203156 3300025938 Bacteria 1452
125 Ga0207711_10335532 3300025941 Bacteria 1399
126 Ga0207711_10715098 3300025941 Bacteria 934
127 Ga0207689_10089364 3300025942 Bacteria 2530
128 Ga0207689_10219488 3300025942 Bacteria 1571
129 Ga0207712_10724294 3300025961 Bacteria 870
130 Ga0207668_10028759 3300025972 Bacteria 3638
131 Ga0207668_10537581 3300025972 Unclassified 1011
132 Ga0207640_10372628 3300025981 Bacteria 1154
133 Ga0207703_10065336 3300026035 Bacteria 2990
134 Ga0207678_10001990 3300026067 Bacteria 18614
135 Ga0207708_10006773 3300026075 Bacteria 8478
136 Ga0207648_10004430 3300026089 Bacteria 14410
137 Ga0207676_10214935 3300026095 Bacteria 1709
138 Ga0207676_10805577 3300026095 Unclassified 917
139 Ga0207674_10021647 3300026116 Bacteria 6922
140 Ga0207675_100223338 3300026118 Archaea 1815
141 Ga0207675_100231154 3300026118 Bacteria 1784
142 Ga0207675_100404505 3300026118 Bacteria 1346
143 Ga0207683_10775417 3300026121 Bacteria 890
144 Ga0268266_10389635 3300028379 Bacteria 1316
145 Ga0268266_10837411 3300028379 Bacteria 889
146 Ga0268265_10034341 3300028380 Bacteria 3695
147 Ga0268264_10265733 3300028381 Bacteria 1601
148 Ga0265326_10004480 3300028558 Bacteria 4473
149 Ga0265319_1008967 3300028563 Bacteria 4320
150 Ga0265319_1077606 3300028563 Bacteria 1057
151 Ga0265318_10003738 3300028577 Bacteria 7579
152 Ga0265318_10028101 3300028577 Unclassified 2203
153 Ga0265322_10015542 3300028654 Bacteria 2199
154 Ga0265322_10028749 3300028654 Bacteria 1588
155 Ga0265338_10038053 3300028800 Bacteria 4566
156 Ga0265324_10004219 3300029957 Bacteria 6575
157 Ga0265332_10004373 3300031238 Bacteria 6644
158 Ga0265332_10218924 3300031238 Bacteria 790
159 Ga0265325_10025961 3300031241 Bacteria 3178
160 Ga0265325_10081295 3300031241 Unclassified 1610
161 Ga0265329_10004685 3300031242 Bacteria 5638
162 Ga0265339_10058334 3300031249 Bacteria 2084
163 Ga0265316_10015520 3300031344 Bacteria 6656
164 Ga0307513_10155684 3300031456 Bacteria 2186
165 Ga0307513_10289828 3300031456 Bacteria 1409
166 Ga0265313_10087725 3300031595 Bacteria 1402
167 Ga0265313_10089620 3300031595 Bacteria 1383
168 Ga0307508_10181539 3300031616 Bacteria 1707
169 Ga0265314_10011504 3300031711 Bacteria 7298
170 Ga0265342_10020941 3300031712 Bacteria 4182
171 Ga0373931_0062139 3300035691 Bacteria 2016
172 Ga0373947_0233233 3300035725 Bacteria 1213
173 Ga0395905_0159317 3300037471 Unclassified 2122
174 Ga0451849_1493866 3300041505 Bacteria 1130
175 Ga0451853_2569526 3300041512 Bacteria 817
176 Ga0450910_016488 3300042147 Bacteria 1094
177 Ga0439446_0023213 3300042156 Bacteria 1763
178 Ga0466960_0659392 3300044901 Unclassified 625
179 Ga0495651_0007899 3300046462 Bacteria 8152
180 Ga0495582_0226303 3300046473 Bacteria 1071
181 Ga0495664_0212106 3300046477 Bacteria 1173
182 Ga0495584_0309035 3300046491 Bacteria 803
183 Ga0495608_0385386 3300046511 Unclassified 859
184 Ga0495630_0050861 3300046517 Bacteria 3101
185 Ga0495587_0203711 3300046536 Bacteria 1119
186 Ga0495656_0227805 3300046615 Bacteria 934
187 Ga0495634_0138624 3300046642 Bacteria 1546
188 Ga0495625_0211450 3300046660 Bacteria 1275
189 Ga0495635_0271385 3300046663 Bacteria 1141
190 Ga0495680_0203151 3300047322 Bacteria 1421
191 Ga0495602_0150888 3300048088 Unclassified 1827
192 Ga0495602_0558529 3300048088 Bacteria 792
193 Ga0496100_0098134 3300048903 Bacteria 2013
194 Ga0496101_0531461 3300048904 Bacteria 930
195 Ga0496102_0231947 3300048905 Bacteria 1740
196 Ga0496104_0418806 3300048907 Bacteria 1251
197 Ga0496104_0747973 3300048907 Bacteria 885
198 Ga0496105_0127474 3300048908 Bacteria 2098
199 Ga0496105_0260727 3300048908 Bacteria 1402
200 Ga0496106_0037718 3300048909 Bacteria 3616
201 Ga0496106_0196899 3300048909 Bacteria 1603
202 Ga0496107_0209929 3300048910 Bacteria 1448
203 Ga0496108_0013624 3300048911 Bacteria 6638
204 Ga0496108_0276603 3300048911 Bacteria 1462
205 Ga0496108_0455362 3300048911 Unclassified 1118
206 Ga0496109_0009855 3300048912 Bacteria 8155
207 Ga0496109_0012924 3300048912 Bacteria 7219
208 Ga0496109_0076065 3300048912 Bacteria 3087
209 Ga0496109_0388616 3300048912 Bacteria 1318
210 Ga0496109_0562673 3300048912 Bacteria 1075
211 Ga0496110_0001722 3300048913 Bacteria 16109
212 Ga0496110_0160163 3300048913 Bacteria 2040
213 Ga0496111_0017929 3300048914 Bacteria 4897
214 Ga0496111_0237501 3300048914 Bacteria 1353
215 Ga0496112_0373989 3300048915 Bacteria 1366
216 Ga0496112_0929300 3300048915 Bacteria 791
217 Ga0496113_0246143 3300048916 Unclassified 1427
218 Ga0496114_0023298 3300048917 Bacteria 5052
219 Ga0496114_0039094 3300048917 Bacteria 3926
220 Ga0496114_0171577 3300048917 Bacteria 1891
221 Ga0501031_0518125 3300049568 Bacteria 769
222 Ga0501032_0002982 3300049569 Bacteria 13147
223 Ga0501032_0118860 3300049569 Bacteria 1748
224 Ga0501032_0669153 3300049569 Bacteria 659
225 Ga0501033_0009223 3300049570 Bacteria 7596
226 Ga0501033_0750719 3300049570 Bacteria 662
227 Ga0501034_0004301 3300049571 Bacteria 15868
228 Ga0501034_0229517 3300049571 Bacteria 1806
229 Ga0501036_0039021 3300049572 Bacteria 4021
230 Ga0501036_0087962 3300049572 Bacteria 2626
231 Ga0501036_0700701 3300049572 Unclassified 837
232 Ga0501037_0000746 3300049573 Bacteria 24670
233 Ga0501037_0150927 3300049573 Bacteria 1661
234 Ga0501038_0001994 3300049574 Bacteria 18863
235 Ga0501038_0030867 3300049574 Bacteria 4738
236 Ga0501038_0241465 3300049574 Unclassified 1434
237 Ga0501038_0434746 3300049574 Bacteria 1011
238 Ga0501038_0450052 3300049574 Bacteria 990
239 Ga0501038_0612644 3300049574 Bacteria 823
240 Ga0501039_0013262 3300049575 Bacteria 6302
241 Ga0501039_0216820 3300049575 Bacteria 1505
242 Ga0501039_0247568 3300049575 Bacteria 1402
243 Ga0501040_0029670 3300049576 Bacteria 3694
244 Ga0501040_0039393 3300049576 Bacteria 3214
245 Ga0501041_0358620 3300049577 Bacteria 922
246 Ga0501041_0361509 3300049577 Bacteria 918
247 Ga0501043_0003818 3300049579 Bacteria 12393
248 Ga0501043_0351450 3300049579 Bacteria 1120
249 Ga0501046_0019455 3300049580 Bacteria 5633
250 Ga0501046_0153655 3300049580 Bacteria 1735
251 Ga0501047_0014963 3300049581 Bacteria 7382
252 Ga0501047_0289290 3300049581 Bacteria 1482
253 Ga0501047_0442211 3300049581 Bacteria 1130
254 Ga0501048_0013781 3300049582 Bacteria 5998
255 Ga0501068_0007540 3300049584 Bacteria 6021
256 Ga0501068_0083365 3300049584 Bacteria 1965
257 Ga0501069_0001518 3300049585 Bacteria 11494
258 Ga0501070_0010948 3300049586 Bacteria 7657
259 Ga0501070_0017357 3300049586 Bacteria 6042
260 Ga0501071_0133762 3300049587 Bacteria 1844
261 Ga0501071_0377146 3300049587 Bacteria 1081
262 Ga0501072_0015788 3300049588 Bacteria 5790
263 Ga0501072_0020363 3300049588 Bacteria 5139
264 Ga0501072_0102145 3300049588 Bacteria 2279
265 Ga0501072_0124155 3300049588 Bacteria 2057
266 Ga0501073_0005008 3300049589 Bacteria 9937
267 Ga0501073_0097625 3300049589 Bacteria 2040
268 Ga0501073_0200988 3300049589 Bacteria 1378
269 Ga0501074_0009909 3300049590 Bacteria 6923
270 Ga0501074_0220287 3300049590 Unclassified 1351
271 Ga0501074_0316268 3300049590 Bacteria 1109
272 Ga0501075_0032063 3300049591 Bacteria 3903
273 Ga0501075_0072055 3300049591 Bacteria 2612
274 Ga0501075_0080104 3300049591 Bacteria 2472
275 Ga0501075_0586641 3300049591 Bacteria 850
276 Ga0501075_0588591 3300049591 Bacteria 849
277 Ga0501076_0193795 3300049592 Unclassified 1659
278 Ga0501076_0224301 3300049592 Unclassified 1536
279 Ga0501076_0344185 3300049592 Bacteria 1224
280 Ga0501077_0090839 3300049593 Bacteria 1935
281 Ga0501079_0029210 3300049741 Bacteria 4232
282 Ga0501079_0186885 3300049741 Bacteria 1617
283 Ga0501079_0285221 3300049741 Unclassified 1291
284 Ga0501079_0446992 3300049741 Bacteria 1015
285 Ga0501079_0474867 3300049741 Bacteria 983
286 Ga0501080_0037364 3300049742 Bacteria 4535
287 Ga0501080_0064400 3300049742 Bacteria 3410
288 Ga0501080_0304849 3300049742 Bacteria 1444
289 Ga0501080_0530727 3300049742 Bacteria 1049
290 Ga0501080_1240826 3300049742 Unclassified 640
291 Ga0501081_0033968 3300049743 Bacteria 3468
292 Ga0501081_0113101 3300049743 Bacteria 1928
293 Ga0501081_0349136 3300049743 Bacteria 1090
294 Ga0501083_0002333 3300049744 Bacteria 12981
295 Ga0501083_0131524 3300049744 Bacteria 1641
296 Ga0501083_0259041 3300049744 Bacteria 1132
297 Ga0501035_0013483 3300049822 Bacteria 7544
298 Ga0501035_0564729 3300049822 Bacteria 931
299 Ga0501044_0015227 3300049823 Bacteria 8283
300 Ga0501044_0024868 3300049823 Bacteria 6352
301 Ga0501044_0145396 3300049823 Bacteria 2357
302 Ga0501044_0220478 3300049823 Bacteria 1847
303 Ga0501045_0191010 3300049824 Unclassified 1526
304 nmdc:mga05p37_1325723_c1 3300050507 Bacteria 731
305 nmdc:mga08y16_350921_c1 3300050511 Unclassified 1515
306 nmdc:mga0n895_137750_c1 3300050512 Bacteria 2468
307 nmdc:mga0n895_41791_c1 3300050512 Bacteria 4458
308 nmdc:mga0rr50_828379_c1 3300050513 Bacteria 789
309 nmdc:mga08x19_168755_c1 3300050514 Bacteria 1489
310 nmdc:mga0a205_309992_c1 3300050515 Bacteria 1450
311 Ga0495612_0163108 3300053078 Bacteria 974
312 Ga0495595_0027950 3300053084 Bacteria 2516
313 Ga0495595_0028717 3300053084 Bacteria 2486
314 Ga0500578_0022971 3300053086 Bacteria 4006
315 Ga0500644_0011981 3300053088 Bacteria 2385
316 Ga0500583_0111834 3300053092 Bacteria 1346
317 Ga0500583_0354567 3300053092 Bacteria 710
318 Ga0500651_0007723 3300053093 Bacteria 6292
319 Ga0500566_0033799 3300053094 Bacteria 2978
320 Ga0500641_0008123 3300053096 Bacteria 3738
321 Ga0500641_0120530 3300053096 Bacteria 1131
322 Ga0500555_011419 3300053103 Bacteria 2551
323 Ga0500569_039474 3300053109 Bacteria 1375
324 Ga0500594_0041225 3300053118 Bacteria 1264
325 Ga0500595_001295 3300053119 Bacteria 13600
326 Ga0500642_0007462 3300053130 Bacteria 3677
327 Ga0500642_0024834 3300053130 Unclassified 2426
328 Ga0500642_0084758 3300053130 Bacteria 1460
329 Ga0500568_0003100 3300053139 Bacteria 9479
330 Ga0500577_0006962 3300053142 Bacteria 3147
331 Ga0500588_0001607 3300053146 Bacteria 4355
332 Ga0500588_0003599 3300053146 Bacteria 3283
333 Ga0500604_0001319 3300053151 Bacteria 6908
334 Ga0500604_0004451 3300053151 Bacteria 3719
335 Ga0500616_0001080 3300053153 Bacteria 28464
336 Ga0500609_001663 3300053731 Bacteria 3249
337 Ga0500609_003308 3300053731 Bacteria 2273
338 Ga0501084_0022238 3300054114 Bacteria 5291
339 Ga0501084_0033892 3300054114 Bacteria 4271
340 Ga0501084_0108246 3300054114 Bacteria 2335
341 Ga0501084_0726261 3300054114 Bacteria 837
342 Ga0501082_0012939 3300060353 Bacteria 7172
343 Ga0501082_0344847 3300060353 Bacteria 1298
344 Ga0501082_0399550 3300060353 Unclassified 1199
345 Ga0501082_0505755 3300060353 Bacteria 1056
346 Ga0530510_0004623 3300061734 Bacteria 9522
347 Ga0530510_0195509 3300061734 Unclassified 1502
348 Ga0530510_0199183 3300061734 Bacteria 1487
349 Ga0530510_0299220 3300061734 Bacteria 1204

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025921 Ga0207652_10138876 Ga0207652_101388762 170
2 3300049742 Ga0501080_1240826 Ga0501080_1240826_15_563 178
3 3300005444 Ga0070694_100128169 Ga0070694_1001281692 180
4 3300005467 Ga0070706_100146656 Ga0070706_1001466562 180
5 3300005471 Ga0070698_100234365 Ga0070698_1002343652 180
6 3300005518 Ga0070699_100369043 Ga0070699_1003690431 180
7 3300005530 Ga0070679_100146573 Ga0070679_1001465733 180
8 3300005545 Ga0070695_100304804 Ga0070695_1003048041 180
9 3300005546 Ga0070696_100083218 Ga0070696_1000832182 180
10 3300053130 Ga0500642_0084758 Ga0500642_0084758_22_579 184
11 3300044901 Ga0466960_0659392 Ga0466960_0659392_14_571 185
12 3300046462 Ga0495651_0007899 Ga0495651_0007899_1740_2357 186
13 3300046477 Ga0495664_0212106 Ga0495664_0212106_56_673 186
14 3300046517 Ga0495630_0050861 Ga0495630_0050861_777_1394 186
15 3300046663 Ga0495635_0271385 Ga0495635_0271385_196_813 186
16 3300047322 Ga0495680_0203151 Ga0495680_0203151_339_956 186
17 3300048088 Ga0495602_0150888 Ga0495602_0150888_1011_1628 186
18 3300053084 Ga0495595_0027950 Ga0495595_0027950_1019_1636 186
19 3300053084 Ga0495595_0028717 Ga0495595_0028717_182_799 186
20 3300046536 Ga0495587_0203711 Ga0495587_0203711_158_775 187
21 3300028558 Ga0265326_10004480 Ga0265326_100044801 188
22 3300028563 Ga0265319_1008967 Ga0265319_10089676 188
23 3300028577 Ga0265318_10003738 Ga0265318_100037382 188
24 3300028654 Ga0265322_10028749 Ga0265322_100287492 188
25 3300028800 Ga0265338_10038053 Ga0265338_100380533 188
26 3300029957 Ga0265324_10004219 Ga0265324_100042196 188
27 3300031238 Ga0265332_10004373 Ga0265332_100043738 188
28 3300031241 Ga0265325_10025961 Ga0265325_100259614 188
29 3300031242 Ga0265329_10004685 Ga0265329_100046856 188
30 3300031249 Ga0265339_10058334 Ga0265339_100583343 188
31 3300031344 Ga0265316_10015520 Ga0265316_100155207 188
32 3300031595 Ga0265313_10089620 Ga0265313_100896201 188
33 3300031711 Ga0265314_10011504 Ga0265314_100115042 188
34 3300031712 Ga0265342_10020941 Ga0265342_100209413 188
35 3300005471 Ga0070698_100008251 Ga0070698_1000082517 189
36 3300005518 Ga0070699_100038377 Ga0070699_1000383771 189
37 3300025910 Ga0207684_10015022 Ga0207684_100150223 189
38 3300037471 Ga0395905_0159317 Ga0395905_0159317_630_1253 189
39 3300014325 Ga0163163_10177399 Ga0163163_101773994 190
40 3300048907 Ga0496104_0747973 Ga0496104_0747973_97_714 190
41 3300006871 Ga0075434_100058871 Ga0075434_1000588716 191
42 3300014326 Ga0157380_10054320 Ga0157380_100543203 191
43 3300049569 Ga0501032_0669153 Ga0501032_0669153_10_624 191
44 3300050512 nmdc:mga0n895_41791_c1 nmdc:mga0n895_41791_c1_3372_3992 191
45 3300049575 Ga0501039_0216820 Ga0501039_0216820_452_1069 192
46 3300049591 Ga0501075_0586641 Ga0501075_0586641_10_627 192
47 3300049741 Ga0501079_0446992 Ga0501079_0446992_212_829 192
48 3300049743 Ga0501081_0349136 Ga0501081_0349136_362_979 192
49 3300061734 Ga0530510_0299220 Ga0530510_0299220_209_826 192
50 3300005518 Ga0070699_100486622 Ga0070699_1004866222 194
51 3300009098 Ga0105245_10538210 Ga0105245_105382102 196
52 3300046511 Ga0495608_0385386 Ga0495608_0385386_89_706 196
53 3300042147 Ga0450910_016488 Ga0450910_016488_82_711 197
54 3300048088 Ga0495602_0558529 Ga0495602_0558529_133_762 198
55 3300005331 Ga0070670_100294524 Ga0070670_1002945241 200
56 3300005334 Ga0068869_100128790 Ga0068869_1001287903 200
57 3300005337 Ga0070682_100424173 Ga0070682_1004241731 200
58 3300005340 Ga0070689_101009181 Ga0070689_1010091811 200
59 3300005344 Ga0070661_100138776 Ga0070661_1001387762 200
60 3300005345 Ga0070692_10312930 Ga0070692_103129302 200
61 3300005345 Ga0070692_10599365 Ga0070692_105993651 200
62 3300005347 Ga0070668_100265891 Ga0070668_1002658911 200
63 3300005353 Ga0070669_100085038 Ga0070669_1000850382 200
64 3300005354 Ga0070675_100009207 Ga0070675_1000092076 200
65 3300005356 Ga0070674_100752191 Ga0070674_1007521912 200
66 3300005364 Ga0070673_100183273 Ga0070673_1001832732 200
67 3300005365 Ga0070688_100005106 Ga0070688_10000510610 200
68 3300005366 Ga0070659_100218603 Ga0070659_1002186032 200
69 3300005438 Ga0070701_10053073 Ga0070701_100530732 200
70 3300005441 Ga0070700_100003207 Ga0070700_10000320710 200
71 3300005441 Ga0070700_100044824 Ga0070700_1000448241 200
72 3300005455 Ga0070663_100803816 Ga0070663_1008038161 200
73 3300005457 Ga0070662_100013088 Ga0070662_1000130886 200
74 3300005457 Ga0070662_100450070 Ga0070662_1004500702 200
75 3300005459 Ga0068867_100018122 Ga0068867_1000181221 200
76 3300005466 Ga0070685_10003827 Ga0070685_100038272 200
77 3300005544 Ga0070686_100014321 Ga0070686_1000143217 200
78 3300005546 Ga0070696_100274445 Ga0070696_1002744452 200
79 3300005564 Ga0070664_100430428 Ga0070664_1004304282 200
80 3300005615 Ga0070702_100174338 Ga0070702_1001743382 200
81 3300005616 Ga0068852_100041831 Ga0068852_1000418314 200
82 3300005617 Ga0068859_100004835 Ga0068859_1000048358 200
83 3300005618 Ga0068864_100013049 Ga0068864_1000130492 200
84 3300005718 Ga0068866_10046132 Ga0068866_100461323 200
85 3300005719 Ga0068861_101209513 Ga0068861_1012095131 200
86 3300005840 Ga0068870_10234209 Ga0068870_102342092 200
87 3300005842 Ga0068858_100023530 Ga0068858_1000235305 200
88 3300005843 Ga0068860_100132513 Ga0068860_1001325133 200
89 3300005844 Ga0068862_100029096 Ga0068862_1000290967 200
90 3300006237 Ga0097621_100348693 Ga0097621_1003486932 200
91 3300006844 Ga0075428_100124504 Ga0075428_1001245042 200
92 3300006931 Ga0097620_100004835 Ga0097620_10000483510 200
93 3300007076 Ga0075435_100481426 Ga0075435_1004814262 200
94 3300009094 Ga0111539_10049311 Ga0111539_100493117 200
95 3300009094 Ga0111539_10377162 Ga0111539_103771622 200
96 3300009098 Ga0105245_10017207 Ga0105245_100172073 200
97 3300009147 Ga0114129_12050848 Ga0114129_120508481 200
98 3300009148 Ga0105243_10009939 Ga0105243_1000993911 200
99 3300009148 Ga0105243_10356717 Ga0105243_103567172 200
100 3300009176 Ga0105242_10093585 Ga0105242_100935853 200
101 3300009177 Ga0105248_10089583 Ga0105248_100895833 200
102 3300009545 Ga0105237_10449952 Ga0105237_104499521 200
103 3300009551 Ga0105238_10043522 Ga0105238_100435223 200
104 3300009553 Ga0105249_10002179 Ga0105249_1000217915 200
105 3300010375 Ga0105239_10013128 Ga0105239_100131284 200
106 3300011119 Ga0105246_10150347 Ga0105246_101503472 200
107 3300013297 Ga0157378_10009038 Ga0157378_100090389 200
108 3300013308 Ga0157375_10002966 Ga0157375_100029666 200
109 3300014325 Ga0163163_10053629 Ga0163163_100536292 200
110 3300014326 Ga0157380_10028334 Ga0157380_100283342 200
111 3300014745 Ga0157377_10004215 Ga0157377_100042151 200
112 3300017792 Ga0163161_10099873 Ga0163161_100998733 200
113 3300025908 Ga0207643_10005851 Ga0207643_100058514 200
114 3300025917 Ga0207660_10150508 Ga0207660_101505081 200
115 3300025918 Ga0207662_10000834 Ga0207662_100008349 200
116 3300025923 Ga0207681_10031911 Ga0207681_100319113 200
117 3300025925 Ga0207650_10021877 Ga0207650_100218777 200
118 3300025926 Ga0207659_10012956 Ga0207659_100129563 200
119 3300025927 Ga0207687_10177414 Ga0207687_101774142 200
120 3300025933 Ga0207706_10011128 Ga0207706_100111285 200
121 3300025933 Ga0207706_10437088 Ga0207706_104370882 200
122 3300025935 Ga0207709_10267116 Ga0207709_102671161 200
123 3300025937 Ga0207669_10066074 Ga0207669_100660742 200
124 3300025938 Ga0207704_10203156 Ga0207704_102031562 200
125 3300025941 Ga0207711_10715098 Ga0207711_107150981 200
126 3300025942 Ga0207689_10089364 Ga0207689_100893642 200
127 3300025972 Ga0207668_10028759 Ga0207668_100287593 200
128 3300025981 Ga0207640_10372628 Ga0207640_103726282 200
129 3300026035 Ga0207703_10065336 Ga0207703_100653363 200
130 3300026067 Ga0207678_10001990 Ga0207678_1000199016 200
131 3300026075 Ga0207708_10006773 Ga0207708_1000677310 200
132 3300026089 Ga0207648_10004430 Ga0207648_100044309 200
133 3300026116 Ga0207674_10021647 Ga0207674_100216473 200
134 3300026118 Ga0207675_100231154 Ga0207675_1002311542 200
135 3300028379 Ga0268266_10837411 Ga0268266_108374111 200
136 3300028381 Ga0268264_10265733 Ga0268264_102657332 200
137 3300035691 Ga0373931_0062139 Ga0373931_0062139_142_756 200
138 3300046491 Ga0495584_0309035 Ga0495584_0309035_143_760 200
139 3300048905 Ga0496102_0231947 Ga0496102_0231947_284_898 200
140 3300048908 Ga0496105_0260727 Ga0496105_0260727_238_852 200
141 3300048909 Ga0496106_0037718 Ga0496106_0037718_2383_2997 200
142 3300048910 Ga0496107_0209929 Ga0496107_0209929_313_927 200
143 3300048912 Ga0496109_0012924 Ga0496109_0012924_1472_2086 200
144 3300048914 Ga0496111_0237501 Ga0496111_0237501_373_987 200
145 3300048917 Ga0496114_0171577 Ga0496114_0171577_783_1397 200
146 3300049572 Ga0501036_0700701 Ga0501036_0700701_76_690 200
147 3300049575 Ga0501039_0247568 Ga0501039_0247568_385_999 200
148 3300049576 Ga0501040_0029670 Ga0501040_0029670_687_1301 200
149 3300049588 Ga0501072_0015788 Ga0501072_0015788_161_775 200
150 3300049591 Ga0501075_0080104 Ga0501075_0080104_141_755 200
151 3300049591 Ga0501075_0588591 Ga0501075_0588591_149_763 200
152 3300049592 Ga0501076_0224301 Ga0501076_0224301_76_690 200
153 3300049592 Ga0501076_0344185 Ga0501076_0344185_199_813 200
154 3300050507 nmdc:mga05p37_1325723_c1 nmdc:mga05p37_1325723_c1_39_653 200
155 3300050511 nmdc:mga08y16_350921_c1 nmdc:mga08y16_350921_c1_768_1382 200
156 3300050513 nmdc:mga0rr50_828379_c1 nmdc:mga0rr50_828379_c1_23_637 200
157 3300060353 Ga0501082_0505755 Ga0501082_0505755_125_739 200
158 3300061734 Ga0530510_0004623 Ga0530510_0004623_2664_3278 200
159 3300061734 Ga0530510_0199183 Ga0530510_0199183_361_975 200
160 3300049570 Ga0501033_0750719 Ga0501033_0750719_13_630 201
161 3300049572 Ga0501036_0087962 Ga0501036_0087962_282_899 201
162 3300049574 Ga0501038_0241465 Ga0501038_0241465_596_1213 201
163 3300049576 Ga0501040_0039393 Ga0501040_0039393_439_1056 201
164 3300049577 Ga0501041_0358620 Ga0501041_0358620_80_697 201
165 3300049579 Ga0501043_0351450 Ga0501043_0351450_355_972 201
166 3300049588 Ga0501072_0102145 Ga0501072_0102145_89_706 201
167 3300049588 Ga0501072_0124155 Ga0501072_0124155_674_1291 201
168 3300049590 Ga0501074_0316268 Ga0501074_0316268_454_1071 201
169 3300049591 Ga0501075_0032063 Ga0501075_0032063_1796_2413 201
170 3300049591 Ga0501075_0072055 Ga0501075_0072055_1492_2109 201
171 3300049593 Ga0501077_0090839 Ga0501077_0090839_10_627 201
172 3300049741 Ga0501079_0029210 Ga0501079_0029210_703_1320 201
173 3300049743 Ga0501081_0033968 Ga0501081_0033968_856_1473 201
174 3300049743 Ga0501081_0113101 Ga0501081_0113101_727_1344 201
175 3300049822 Ga0501035_0564729 Ga0501035_0564729_124_741 201
176 3300049824 Ga0501045_0191010 Ga0501045_0191010_704_1321 201
177 3300053086 Ga0500578_0022971 Ga0500578_0022971_2400_3047 201
178 3300054114 Ga0501084_0726261 Ga0501084_0726261_13_630 201
179 3300060353 Ga0501082_0399550 Ga0501082_0399550_427_1044 201
180 3300061734 Ga0530510_0195509 Ga0530510_0195509_278_895 201
181 3300005445 Ga0070708_100754247 Ga0070708_1007542471 202
182 3300005468 Ga0070707_100077586 Ga0070707_1000775861 202
183 3300005536 Ga0070697_100450588 Ga0070697_1004505883 202
184 3300009147 Ga0114129_10087068 Ga0114129_100870687 202
185 3300025922 Ga0207646_10089546 Ga0207646_100895462 202
186 3300042156 Ga0439446_0023213 Ga0439446_0023213_136_756 202
187 3300048911 Ga0496108_0455362 Ga0496108_0455362_275_889 202
188 3300049568 Ga0501031_0518125 Ga0501031_0518125_110_754 202
189 3300049587 Ga0501071_0133762 Ga0501071_0133762_514_1158 202
190 3300049590 Ga0501074_0220287 Ga0501074_0220287_567_1211 202
191 3300049744 Ga0501083_0131524 Ga0501083_0131524_639_1259 202
192 3300005356 Ga0070674_100416089 Ga0070674_1004160892 203
193 3300025302 Ga0207426_1067470 Ga0207426_10674702 203
194 3300028563 Ga0265319_1077606 Ga0265319_10776061 203
195 3300028577 Ga0265318_10028101 Ga0265318_100281012 203
196 3300028654 Ga0265322_10015542 Ga0265322_100155422 203
197 3300031238 Ga0265332_10218924 Ga0265332_102189241 203
198 3300031241 Ga0265325_10081295 Ga0265325_100812952 203
199 3300031595 Ga0265313_10087725 Ga0265313_100877251 203
200 3300049574 Ga0501038_0450052 Ga0501038_0450052_46_693 203
201 3300049586 Ga0501070_0017357 Ga0501070_0017357_4564_5211 203
202 3300049587 Ga0501071_0377146 Ga0501071_0377146_402_1049 203
203 3300049742 Ga0501080_0530727 Ga0501080_0530727_206_853 203
204 3300049577 Ga0501041_0361509 Ga0501041_0361509_80_709 204
205 3300005536 Ga0070697_100018222 Ga0070697_1000182222 205
206 3300005842 Ga0068858_100192712 Ga0068858_1001927121 205
207 3300009177 Ga0105248_10421391 Ga0105248_104213911 205
208 3300013308 Ga0157375_10501906 Ga0157375_105019063 205
209 3300025941 Ga0207711_10335532 Ga0207711_103355322 205
210 3300026095 Ga0207676_10805577 Ga0207676_108055771 205
211 3300046642 Ga0495634_0138624 Ga0495634_0138624_605_1228 205
212 3300046660 Ga0495625_0211450 Ga0495625_0211450_643_1260 205
213 3300048908 Ga0496105_0127474 Ga0496105_0127474_1388_2011 205
214 3300048912 Ga0496109_0076065 Ga0496109_0076065_1376_1999 205
215 3300048912 Ga0496109_0388616 Ga0496109_0388616_624_1247 205
216 3300048913 Ga0496110_0160163 Ga0496110_0160163_830_1453 205
217 3300048914 Ga0496111_0017929 Ga0496111_0017929_549_1172 205
218 3300048915 Ga0496112_0929300 Ga0496112_0929300_83_706 205
219 3300049574 Ga0501038_0434746 Ga0501038_0434746_241_870 205
220 3300049741 Ga0501079_0474867 Ga0501079_0474867_334_963 205
221 3300005334 Ga0068869_100728578 Ga0068869_1007285781 206
222 3300005338 Ga0068868_100402354 Ga0068868_1004023542 206
223 3300005356 Ga0070674_100050305 Ga0070674_1000503053 206
224 3300005518 Ga0070699_100842960 Ga0070699_1008429602 206
225 3300006852 Ga0075433_10374270 Ga0075433_103742701 206
226 3300006871 Ga0075434_100068003 Ga0075434_1000680032 206
227 3300006881 Ga0068865_100124952 Ga0068865_1001249522 206
228 3300007076 Ga0075435_100245689 Ga0075435_1002456892 206
229 3300009098 Ga0105245_10454518 Ga0105245_104545182 206
230 3300009098 Ga0105245_11213753 Ga0105245_112137531 206
231 3300010375 Ga0105239_10624687 Ga0105239_106246871 206
232 3300014326 Ga0157380_10120513 Ga0157380_101205133 206
233 3300014745 Ga0157377_10298598 Ga0157377_102985982 206
234 3300025933 Ga0207706_10492591 Ga0207706_104925912 206
235 3300025935 Ga0207709_10270546 Ga0207709_102705462 206
236 3300025937 Ga0207669_10015240 Ga0207669_100152403 206
237 3300025938 Ga0207704_10069292 Ga0207704_100692922 206
238 3300025942 Ga0207689_10219488 Ga0207689_102194881 206
239 3300025961 Ga0207712_10724294 Ga0207712_107242942 206
240 3300025972 Ga0207668_10537581 Ga0207668_105375811 206
241 3300026095 Ga0207676_10214935 Ga0207676_102149352 206
242 3300026118 Ga0207675_100223338 Ga0207675_1002233382 206
243 3300026121 Ga0207683_10775417 Ga0207683_107754171 206
244 3300031456 Ga0307513_10155684 Ga0307513_101556842 206
245 3300041512 Ga0451853_2569526 Ga0451853_2569526_167_799 206
246 3300046615 Ga0495656_0227805 Ga0495656_0227805_50_685 206
247 3300048903 Ga0496100_0098134 Ga0496100_0098134_251_952 206
248 3300048904 Ga0496101_0531461 Ga0496101_0531461_262_894 206
249 3300048907 Ga0496104_0418806 Ga0496104_0418806_78_779 206
250 3300048909 Ga0496106_0196899 Ga0496106_0196899_93_794 206
251 3300048911 Ga0496108_0013624 Ga0496108_0013624_4034_4735 206
252 3300048911 Ga0496108_0276603 Ga0496108_0276603_627_1259 206
253 3300048912 Ga0496109_0009855 Ga0496109_0009855_3658_4359 206
254 3300048912 Ga0496109_0562673 Ga0496109_0562673_339_971 206
255 3300048913 Ga0496110_0001722 Ga0496110_0001722_12262_12963 206
256 3300048915 Ga0496112_0373989 Ga0496112_0373989_573_1205 206
257 3300048916 Ga0496113_0246143 Ga0496113_0246143_535_1167 206
258 3300048917 Ga0496114_0023298 Ga0496114_0023298_1258_1893 206
259 3300048917 Ga0496114_0039094 Ga0496114_0039094_2535_3236 206
260 3300050512 nmdc:mga0n895_137750_c1 nmdc:mga0n895_137750_c1_1495_2133 206
261 3300050514 nmdc:mga08x19_168755_c1 nmdc:mga08x19_168755_c1_806_1444 206
262 3300050515 nmdc:mga0a205_309992_c1 nmdc:mga0a205_309992_c1_753_1391 206
263 3300053078 Ga0495612_0163108 Ga0495612_0163108_251_880 206
264 3300035725 Ga0373947_0233233 Ga0373947_0233233_43_699 207
265 3300046473 Ga0495582_0226303 Ga0495582_0226303_375_1031 207
266 3300053093 Ga0500651_0007723 Ga0500651_0007723_4567_5214 207
267 3300053094 Ga0500566_0033799 Ga0500566_0033799_1791_2438 207
268 3300053103 Ga0500555_011419 Ga0500555_011419_1145_1792 207
269 3300053119 Ga0500595_001295 Ga0500595_001295_1659_2306 207
270 3300053142 Ga0500577_0006962 Ga0500577_0006962_178_825 207
271 3300005985 Ga0081539_10045352 Ga0081539_100453523 208
272 3300049589 Ga0501073_0200988 Ga0501073_0200988_607_1254 208
273 3300049592 Ga0501076_0193795 Ga0501076_0193795_941_1579 208
274 3300049741 Ga0501079_0285221 Ga0501079_0285221_582_1220 208
275 3300049742 Ga0501080_0304849 Ga0501080_0304849_149_787 208
276 3300054114 Ga0501084_0108246 Ga0501084_0108246_1035_1673 208
277 3300060353 Ga0501082_0344847 Ga0501082_0344847_35_673 208
278 3300053731 Ga0500609_001663 Ga0500609_001663_1659_2306 214
279 3300003215 JGI25153J46596_10000048 JGI25153J46596_10000048114 215
280 3300003794 Ga0055531_10012321 Ga0055531_100123214 215
281 3300005719 Ga0068861_100660206 Ga0068861_1006602062 215
282 3300005844 Ga0068862_100070316 Ga0068862_1000703163 215
283 3300006177 Ga0075362_10084089 Ga0075362_100840892 215
284 3300025297 Ga0209758_1000048 Ga0209758_1000048324 215
285 3300025298 Ga0209050_1005599 Ga0209050_10055996 215
286 3300025303 Ga0209051_1054023 Ga0209051_10540232 215
287 3300025304 Ga0209257_1000237 Ga0209257_100023759 215
288 3300026118 Ga0207675_100404505 Ga0207675_1004045052 215
289 3300028379 Ga0268266_10389635 Ga0268266_103896352 215
290 3300028380 Ga0268265_10034341 Ga0268265_100343413 215
291 3300031456 Ga0307513_10289828 Ga0307513_102898282 215
292 3300031616 Ga0307508_10181539 Ga0307508_101815392 215
293 3300041505 Ga0451849_1493866 Ga0451849_1493866_410_1057 215
294 3300049569 Ga0501032_0002982 Ga0501032_0002982_9634_10281 215
295 3300049569 Ga0501032_0118860 Ga0501032_0118860_373_1020 215
296 3300049570 Ga0501033_0009223 Ga0501033_0009223_3550_4197 215
297 3300049571 Ga0501034_0004301 Ga0501034_0004301_820_1467 215
298 3300049571 Ga0501034_0229517 Ga0501034_0229517_1007_1654 215
299 3300049572 Ga0501036_0039021 Ga0501036_0039021_3109_3756 215
300 3300049573 Ga0501037_0000746 Ga0501037_0000746_18076_18723 215
301 3300049573 Ga0501037_0150927 Ga0501037_0150927_478_1125 215
302 3300049574 Ga0501038_0001994 Ga0501038_0001994_12269_12916 215
303 3300049574 Ga0501038_0030867 Ga0501038_0030867_3712_4359 215
304 3300049574 Ga0501038_0612644 Ga0501038_0612644_16_663 215
305 3300049575 Ga0501039_0013262 Ga0501039_0013262_830_1477 215
306 3300049579 Ga0501043_0003818 Ga0501043_0003818_10968_11615 215
307 3300049580 Ga0501046_0019455 Ga0501046_0019455_3110_3757 215
308 3300049580 Ga0501046_0153655 Ga0501046_0153655_1015_1662 215
309 3300049581 Ga0501047_0014963 Ga0501047_0014963_294_941 215
310 3300049581 Ga0501047_0289290 Ga0501047_0289290_354_1001 215
311 3300049581 Ga0501047_0442211 Ga0501047_0442211_172_819 215
312 3300049582 Ga0501048_0013781 Ga0501048_0013781_3713_4360 215
313 3300049584 Ga0501068_0007540 Ga0501068_0007540_4856_5503 215
314 3300049584 Ga0501068_0083365 Ga0501068_0083365_790_1437 215
315 3300049585 Ga0501069_0001518 Ga0501069_0001518_4898_5545 215
316 3300049586 Ga0501070_0010948 Ga0501070_0010948_711_1358 215
317 3300049588 Ga0501072_0020363 Ga0501072_0020363_3987_4634 215
318 3300049589 Ga0501073_0005008 Ga0501073_0005008_5007_5654 215
319 3300049589 Ga0501073_0097625 Ga0501073_0097625_328_975 215
320 3300049590 Ga0501074_0009909 Ga0501074_0009909_3263_3910 215
321 3300049741 Ga0501079_0186885 Ga0501079_0186885_875_1522 215
322 3300049742 Ga0501080_0037364 Ga0501080_0037364_3110_3757 215
323 3300049742 Ga0501080_0064400 Ga0501080_0064400_378_1025 215
324 3300049744 Ga0501083_0002333 Ga0501083_0002333_671_1318 215
325 3300049744 Ga0501083_0259041 Ga0501083_0259041_246_893 215
326 3300049822 Ga0501035_0013483 Ga0501035_0013483_6311_6958 215
327 3300049823 Ga0501044_0015227 Ga0501044_0015227_7416_8063 215
328 3300049823 Ga0501044_0024868 Ga0501044_0024868_587_1234 215
329 3300049823 Ga0501044_0145396 Ga0501044_0145396_1076_1723 215
330 3300049823 Ga0501044_0220478 Ga0501044_0220478_856_1503 215
331 3300053088 Ga0500644_0011981 Ga0500644_0011981_81_728 215
332 3300053092 Ga0500583_0111834 Ga0500583_0111834_294_944 215
333 3300053092 Ga0500583_0354567 Ga0500583_0354567_48_695 215
334 3300053096 Ga0500641_0008123 Ga0500641_0008123_2991_3638 215
335 3300053096 Ga0500641_0120530 Ga0500641_0120530_448_1095 215
336 3300053109 Ga0500569_039474 Ga0500569_039474_16_663 215
337 3300053118 Ga0500594_0041225 Ga0500594_0041225_196_843 215
338 3300053130 Ga0500642_0007462 Ga0500642_0007462_809_1456 215
339 3300053130 Ga0500642_0024834 Ga0500642_0024834_1629_2276 215
340 3300053139 Ga0500568_0003100 Ga0500568_0003100_519_1166 215
341 3300053146 Ga0500588_0001607 Ga0500588_0001607_2727_3374 215
342 3300053146 Ga0500588_0003599 Ga0500588_0003599_1605_2252 215
343 3300053151 Ga0500604_0001319 Ga0500604_0001319_1711_2358 215
344 3300053151 Ga0500604_0004451 Ga0500604_0004451_2011_2658 215
345 3300053153 Ga0500616_0001080 Ga0500616_0001080_26471_27118 215
346 3300053731 Ga0500609_003308 Ga0500609_003308_1212_1859 215
347 3300054114 Ga0501084_0022238 Ga0501084_0022238_1578_2225 215
348 3300054114 Ga0501084_0033892 Ga0501084_0033892_3353_4000 215
349 3300060353 Ga0501082_0012939 Ga0501082_0012939_3814_4461 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

14

202

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.4933 6 208
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.467 6 208
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.4573 6 208
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.4459 5 214
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.4375 6 208
ID Description Score Start End Superfamily
af_Q9P7Q0_1_262_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6395 2 209 1.20.1250.20
af_Q9P7Q0_1_262_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6195 2 209 1.20.1250.20
af_Q10320_1_287_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6128 8 210 1.20.1250.20
af_Q10320_1_287_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.582 8 210 1.20.1250.20
af_B9G125_1_232_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.58 12 208 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2W4R3A8-F1-model_v4 Lysine transporter LysE 0.9466 3 210 GO:0005886
GO:0015171
AF-A0A7W1GWE8-F1-model_v4 LysE family translocator 0.946 7 210 GO:0005886
GO:0015171
AF-H6NCX6-F1-model_v4 Lysine exporter protein LysE/YggA 0.9441 8 212 GO:0005886
GO:0015171
AF-A0A5E4PL78-F1-model_v4 Lysine transporter LysE 0.9373 21 207 GO:0005886
GO:0015171
AF-A0A3A6PBK7-F1-model_v4 LysE family translocator 0.9357 2 210 GO:0005886
GO:0015171

Feature Viewer

pLDDT pTM Quality
83.69 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map