F418140

General Info

Members Datasets Scaffolds Average Seq Length
350 194 344 212

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100048113|Ga0070660_1000481132
Length 264
Sequence MRESIGRARIALLGRPTAAIARLRRTTAWCGFDGGLALRCSIRFGTAGPGKARRMKRNARSLGWLWLGMFVLVYLMTISACSSLGSYPPAPTSAQTEVQSYKVGPLDTLNIVVWRNPDLSGTVAVRPDGRISSPLVPDLLVAGRTPVEIGKEIESILGKYVREPNVTVLVTNFQGMFGEQIRIVGEAARPQAIAYRQNMTLLDVMILSGGLTEFADGNGAVLVRGSEGGKQYSVRLKDLLRRGDIAANVDVKPGDVIIIPQSWF

Samples

Sample ID Description Type Environment
1 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
2 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
3 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
4 2831864461 Roseateles noduli HZ7 Isolate Nodule
5 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
6 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
7 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
166 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
167 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
168 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.43
Metatranscriptomes 0.86
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.86
Nodule 0.29
Rhizoplane 0.86
Rhizosphere 89.71
Stem 0
Stem Tuber 0
Unclassified 4.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006770J48903_1026620 3300003305 Bacteria 932
2 Ga0006777J48905_1064439 3300003308 Bacteria 1137
3 rootH2_10047099 3300003320 Bacteria 12920
4 rootL2_10000057 3300003322 Bacteria 97630
5 rootL2_10063700 3300003322 Bacteria 2201
6 rootH1_10012740 3300003323 Bacteria 14596
7 Ga0032354_1088087 3300003693 Bacteria 748
8 Ga0055524_1002178 3300003775 Bacteria 10303
9 Ga0055524_1006904 3300003775 Bacteria 4886
10 Ga0070658_10958581 3300005327 Bacteria 744
11 Ga0070670_100015131 3300005331 Bacteria 6620
12 Ga0070670_100071084 3300005331 Bacteria 2987
13 Ga0070677_10108467 3300005333 Bacteria 1236
14 Ga0068869_100022088 3300005334 Bacteria 4382
15 Ga0068869_100093003 3300005334 Bacteria 2271
16 Ga0070666_10399636 3300005335 Bacteria 988
17 Ga0070666_10559713 3300005335 Unclassified 832
18 Ga0070680_100195356 3300005336 Unclassified 1706
19 Ga0070682_100100774 3300005337 Bacteria 1906
20 Ga0068868_100026934 3300005338 Bacteria 4383
21 Ga0068868_100096500 3300005338 Bacteria 2388
22 Ga0070660_100048113 3300005339 Bacteria 3274
23 Ga0070660_100136062 3300005339 Unclassified 1969
24 Ga0070668_100081732 3300005347 Bacteria 2533
25 Ga0070668_100247082 3300005347 Bacteria 1480
26 Ga0070668_100317785 3300005347 Bacteria 1310
27 Ga0070668_100613234 3300005347 Bacteria 953
28 Ga0070669_100015448 3300005353 Bacteria 5440
29 Ga0070669_100329545 3300005353 Bacteria 1235
30 Ga0070675_100024429 3300005354 Bacteria 4840
31 Ga0070675_100035842 3300005354 Bacteria 4034
32 Ga0070675_100046368 3300005354 Bacteria 3558
33 Ga0070675_100084702 3300005354 Bacteria 2647
34 Ga0070675_100626268 3300005354 Bacteria 977
35 Ga0070671_100159067 3300005355 Bacteria 1909
36 Ga0070671_100290364 3300005355 Bacteria 1392
37 Ga0070671_100567026 3300005355 Bacteria 980
38 Ga0070674_100024834 3300005356 Bacteria 3893
39 Ga0070674_100179314 3300005356 Bacteria 1621
40 Ga0070674_100278980 3300005356 Bacteria 1324
41 Ga0070673_100037871 3300005364 Bacteria 3678
42 Ga0070688_100183938 3300005365 Bacteria 1451
43 Ga0070659_100160471 3300005366 Bacteria 1838
44 Ga0070659_100214297 3300005366 Unclassified 1588
45 Ga0070667_100264239 3300005367 Bacteria 1542
46 Ga0070667_100366822 3300005367 Bacteria 1306
47 Ga0070714_100031454 3300005435 Bacteria 4428
48 Ga0070711_100128709 3300005439 Bacteria 1883
49 Ga0070705_100060278 3300005440 Bacteria 2250
50 Ga0070700_100027108 3300005441 Bacteria 3394
51 Ga0070678_100291464 3300005456 Bacteria 1384
52 Ga0070662_100011957 3300005457 Bacteria 5741
53 Ga0070681_10065791 3300005458 Bacteria 3594
54 Ga0070681_10150863 3300005458 Bacteria 2250
55 Ga0068867_100000108 3300005459 Bacteria 53317
56 Ga0068867_100029685 3300005459 Bacteria 3940
57 Ga0068867_100030746 3300005459 Bacteria 3874
58 Ga0068867_100491527 3300005459 Unclassified 1053
59 Ga0070679_100195692 3300005530 Bacteria 1989
60 Ga0070684_100540326 3300005535 Bacteria 1081
61 Ga0068853_100038133 3300005539 Bacteria 4092
62 Ga0070672_100003665 3300005543 Bacteria 9979
63 Ga0070672_100099159 3300005543 Bacteria 2361
64 Ga0070672_100157346 3300005543 Bacteria 1883
65 Ga0070672_100448651 3300005543 Bacteria 1111
66 Ga0070672_100615353 3300005543 Bacteria 947
67 Ga0070686_100120880 3300005544 Bacteria 1798
68 Ga0070695_100767235 3300005545 Bacteria 770
69 Ga0070665_100154794 3300005548 Bacteria 2294
70 Ga0070665_100658039 3300005548 Bacteria 1061
71 Ga0070665_100805566 3300005548 Bacteria 952
72 Ga0070704_100756762 3300005549 Unclassified 865
73 Ga0068855_100010612 3300005563 Bacteria 11105
74 Ga0068855_100108629 3300005563 Bacteria 3186
75 Ga0068855_100697734 3300005563 Bacteria 1086
76 Ga0070664_100010341 3300005564 Bacteria 7571
77 Ga0070664_100026396 3300005564 Bacteria 4818
78 Ga0070664_100031902 3300005564 Bacteria 4406
79 Ga0070664_100039307 3300005564 Bacteria 3986
80 Ga0070664_100044966 3300005564 Bacteria 3729
81 Ga0070664_100257988 3300005564 Bacteria 1568
82 Ga0070664_100564047 3300005564 Bacteria 1054
83 Ga0070664_100676443 3300005564 Unclassified 960
84 Ga0068857_100016049 3300005577 Bacteria 6561
85 Ga0068857_100387169 3300005577 Unclassified 1299
86 Ga0068856_100061947 3300005614 Bacteria 3695
87 Ga0068859_100018647 3300005617 Bacteria 6975
88 Ga0068864_100020534 3300005618 Bacteria 5526
89 Ga0068864_100035566 3300005618 Bacteria 4240
90 Ga0068864_100077888 3300005618 Bacteria 2900
91 Ga0068861_100025451 3300005719 Bacteria 4293
92 Ga0068861_100335168 3300005719 Unclassified 1322
93 Ga0068870_10032402 3300005840 Bacteria 2656
94 Ga0068863_100032064 3300005841 Bacteria 5011
95 Ga0068863_100041398 3300005841 Bacteria 4381
96 Ga0068863_100096643 3300005841 Bacteria 2804
97 Ga0068858_100236456 3300005842 Bacteria 1733
98 Ga0068860_100019553 3300005843 Bacteria 6566
99 Ga0068860_100179010 3300005843 Bacteria 2049
100 Ga0068860_100280002 3300005843 Bacteria 1629
101 Ga0068860_100531882 3300005843 Bacteria 1176
102 Ga0068860_100744767 3300005843 Bacteria 991
103 Ga0068862_100003630 3300005844 Bacteria 13195
104 Ga0068862_100013386 3300005844 Bacteria 6788
105 Ga0068862_100103523 3300005844 Unclassified 2493
106 Ga0068862_100276746 3300005844 Bacteria 1537
107 Ga0068862_100352888 3300005844 Unclassified 1365
108 Ga0068862_101093812 3300005844 Bacteria 792
109 Ga0068862_101335985 3300005844 Bacteria 719
110 Ga0070712_100126498 3300006175 Bacteria 1931
111 Ga0075366_10000995 3300006195 Bacteria 13880
112 Ga0075366_10018564 3300006195 Bacteria 4017
113 Ga0075366_10043208 3300006195 Bacteria 2669
114 Ga0075366_10289624 3300006195 Unclassified 1001
115 Ga0097621_100187984 3300006237 Bacteria 1787
116 Ga0097621_100211128 3300006237 Bacteria 1689
117 Ga0075370_10008714 3300006353 Bacteria 5232
118 Ga0068871_100153347 3300006358 Bacteria 1966
119 Ga0075430_100049176 3300006846 Bacteria 3559
120 Ga0075430_100206486 3300006846 Bacteria 1630
121 Ga0068865_100158154 3300006881 Bacteria 1726
122 Ga0068865_100195969 3300006881 Bacteria 1565
123 Ga0097620_100018647 3300006931 Bacteria 6975
124 Ga0097620_100031378 3300006931 Bacteria 5336
125 Ga0105240_10061433 3300009093 Bacteria 4682
126 Ga0105243_10006785 3300009148 Bacteria 8829
127 Ga0105243_10008569 3300009148 Bacteria 7846
128 Ga0105243_10023002 3300009148 Bacteria 4740
129 Ga0105242_10059814 3300009176 Bacteria 3127
130 Ga0105242_10422588 3300009176 Unclassified 1249
131 Ga0105248_10052132 3300009177 Bacteria 4591
132 Ga0105248_10065961 3300009177 Bacteria 4065
133 Ga0105238_10000971 3300009551 Bacteria 29344
134 Ga0105238_10006785 3300009551 Bacteria 11433
135 Ga0105249_10018110 3300009553 Bacteria 6260
136 Ga0105246_10431182 3300011119 Bacteria 1103
137 Ga0157319_1000001 3300012497 Bacteria 423237
138 Ga0157373_10032438 3300013100 Bacteria 3760
139 Ga0157370_10297879 3300013104 Bacteria 1489
140 Ga0157369_10000994 3300013105 Bacteria 35863
141 Ga0157369_10033215 3300013105 Bacteria 5672
142 Ga0157369_10381008 3300013105 Bacteria 1464
143 Ga0157369_10393273 3300013105 Bacteria 1438
144 Ga0157374_10218658 3300013296 Bacteria 1869
145 Ga0157374_10608911 3300013296 Bacteria 1103
146 Ga0157378_10017946 3300013297 Bacteria 6212
147 Ga0163162_10007895 3300013306 Bacteria 10370
148 Ga0163162_10165687 3300013306 Bacteria 2333
149 Ga0157372_10089607 3300013307 Bacteria 3495
150 Ga0157375_10003600 3300013308 Bacteria 13446
151 Ga0163163_10066691 3300014325 Bacteria 3575
152 Ga0163163_10118632 3300014325 Bacteria 2678
153 Ga0163163_10781437 3300014325 Bacteria 1018
154 Ga0157380_10008997 3300014326 Bacteria 7135
155 Ga0157380_10051090 3300014326 Bacteria 3267
156 Ga0157377_10000035 3300014745 Bacteria 116860
157 Ga0157379_10072908 3300014968 Bacteria 3073
158 Ga0157376_10009209 3300014969 Bacteria 7163
159 Ga0157376_10086194 3300014969 Bacteria 2707
160 Ga0157376_10728616 3300014969 Bacteria 999
161 Ga0163161_10030196 3300017792 Bacteria 3855
162 Ga0163161_10529742 3300017792 Bacteria 963
163 Ga0213872_10000053 3300021361 Bacteria 103215
164 Ga0213872_10119032 3300021361 Bacteria 1168
165 Ga0209673_1005099 3300025273 Bacteria 6742
166 Ga0209050_1002952 3300025298 Bacteria 13298
167 Ga0209256_1000742 3300025299 Bacteria 42803
168 Ga0209256_1003850 3300025299 Bacteria 10020
169 Ga0209051_1000963 3300025303 Bacteria 28248
170 Ga0209051_1002358 3300025303 Bacteria 13664
171 Ga0209257_1001410 3300025304 Bacteria 28667
172 Ga0209257_1004445 3300025304 Bacteria 10858
173 Ga0207697_10021208 3300025315 Bacteria 2661
174 Ga0207682_10019372 3300025893 Bacteria 2663
175 Ga0207682_10033710 3300025893 Unclassified 2062
176 Ga0207642_10113671 3300025899 Bacteria 1383
177 Ga0207688_10125669 3300025901 Bacteria 1500
178 Ga0207680_10126995 3300025903 Bacteria 1675
179 Ga0207680_10517032 3300025903 Unclassified 851
180 Ga0207645_10010387 3300025907 Bacteria 6392
181 Ga0207645_10155456 3300025907 Bacteria 1494
182 Ga0207645_10183202 3300025907 Bacteria 1374
183 Ga0207643_10003370 3300025908 Bacteria 8609
184 Ga0207705_10339670 3300025909 Bacteria 1156
185 Ga0207654_10425749 3300025911 Bacteria 927
186 Ga0207707_10183401 3300025912 Bacteria 1827
187 Ga0207695_10043772 3300025913 Bacteria 4767
188 Ga0207695_10058590 3300025913 Bacteria 3997
189 Ga0207671_10003589 3300025914 Bacteria 15350
190 Ga0207663_10275515 3300025916 Bacteria 1248
191 Ga0207657_10104301 3300025919 Unclassified 2349
192 Ga0207657_10118723 3300025919 Bacteria 2177
193 Ga0207657_10528675 3300025919 Bacteria 923
194 Ga0207649_10014844 3300025920 Bacteria 4369
195 Ga0207652_10231568 3300025921 Bacteria 1665
196 Ga0207681_10104353 3300025923 Bacteria 2050
197 Ga0207681_10130666 3300025923 Bacteria 1856
198 Ga0207694_10004663 3300025924 Bacteria 10674
199 Ga0207694_10101375 3300025924 Bacteria 2281
200 Ga0207650_10009727 3300025925 Bacteria 6575
201 Ga0207650_10011462 3300025925 Bacteria 6102
202 Ga0207650_10097715 3300025925 Bacteria 2255
203 Ga0207659_10027501 3300025926 Bacteria 3852
204 Ga0207659_10040560 3300025926 Bacteria 3256
205 Ga0207659_10128063 3300025926 Bacteria 1955
206 Ga0207659_10226653 3300025926 Bacteria 1505
207 Ga0207659_10334213 3300025926 Bacteria 1253
208 Ga0207659_10659483 3300025926 Bacteria 894
209 Ga0207687_10292173 3300025927 Unclassified 1310
210 Ga0207687_10547205 3300025927 Unclassified 971
211 Ga0207700_10000355 3300025928 Bacteria 26804
212 Ga0207644_10130993 3300025931 Bacteria 1920
213 Ga0207644_10165911 3300025931 Bacteria 1720
214 Ga0207690_10071025 3300025932 Bacteria 2400
215 Ga0207690_10146562 3300025932 Unclassified 1746
216 Ga0207706_10009362 3300025933 Bacteria 8995
217 Ga0207706_10589026 3300025933 Bacteria 956
218 Ga0207686_10023996 3300025934 Bacteria 3528
219 Ga0207709_10005991 3300025935 Bacteria 6853
220 Ga0207709_10090308 3300025935 Bacteria 2000
221 Ga0207669_10160105 3300025937 Bacteria 1589
222 Ga0207669_10586118 3300025937 Unclassified 904
223 Ga0207704_10409915 3300025938 Bacteria 1072
224 Ga0207704_10492505 3300025938 Bacteria 986
225 Ga0207691_10002319 3300025940 Bacteria 18634
226 Ga0207691_10007470 3300025940 Bacteria 10522
227 Ga0207691_10176068 3300025940 Bacteria 1871
228 Ga0207711_10055649 3300025941 Bacteria 3397
229 Ga0207711_10292091 3300025941 Bacteria 1503
230 Ga0207711_10605380 3300025941 Bacteria 1022
231 Ga0207711_10654176 3300025941 Bacteria 980
232 Ga0207689_10002027 3300025942 Bacteria 19152
233 Ga0207689_10015770 3300025942 Bacteria 6396
234 Ga0207689_10108601 3300025942 Bacteria 2280
235 Ga0207689_10140367 3300025942 Bacteria 1990
236 Ga0207661_10253145 3300025944 Bacteria 1566
237 Ga0207679_10060971 3300025945 Bacteria 2806
238 Ga0207679_10114116 3300025945 Unclassified 2138
239 Ga0207679_10122617 3300025945 Unclassified 2072
240 Ga0207679_10167211 3300025945 Bacteria 1807
241 Ga0207679_10171128 3300025945 Bacteria 1788
242 Ga0207679_10727872 3300025945 Bacteria 901
243 Ga0207667_10001650 3300025949 Bacteria 28122
244 Ga0207667_10041856 3300025949 Bacteria 4871
245 Ga0207667_10362852 3300025949 Bacteria 1477
246 Ga0207651_10002768 3300025960 Bacteria 8419
247 Ga0207712_10110280 3300025961 Bacteria 2063
248 Ga0207668_10003511 3300025972 Bacteria 9210
249 Ga0207668_10034569 3300025972 Bacteria 3358
250 Ga0207668_10293871 3300025972 Bacteria 1338
251 Ga0207668_10360456 3300025972 Bacteria 1218
252 Ga0207640_10226860 3300025981 Bacteria 1434
253 Ga0207658_10016999 3300025986 Bacteria 5007
254 Ga0207658_10413417 3300025986 Bacteria 1188
255 Ga0207677_10016865 3300026023 Bacteria 4338
256 Ga0207703_10053155 3300026035 Bacteria 3292
257 Ga0207639_10452644 3300026041 Unclassified 1166
258 Ga0207678_10031110 3300026067 Bacteria 4657
259 Ga0207708_10022848 3300026075 Bacteria 4723
260 Ga0207702_10061796 3300026078 Bacteria 3197
261 Ga0207702_10117036 3300026078 Bacteria 2379
262 Ga0207641_10047179 3300026088 Bacteria 3632
263 Ga0207641_10125123 3300026088 Bacteria 2300
264 Ga0207641_10366367 3300026088 Bacteria 1377
265 Ga0207641_10662987 3300026088 Bacteria 1025
266 Ga0207648_10000040 3300026089 Bacteria 116539
267 Ga0207648_10014343 3300026089 Bacteria 7325
268 Ga0207648_10040680 3300026089 Bacteria 4084
269 Ga0207648_10042847 3300026089 Bacteria 3974
270 Ga0207648_10044545 3300026089 Bacteria 3892
271 Ga0207648_10125415 3300026089 Unclassified 2259
272 Ga0207648_10523264 3300026089 Unclassified 1087
273 Ga0207676_10016326 3300026095 Bacteria 5377
274 Ga0207676_10075643 3300026095 Bacteria 2717
275 Ga0207674_10008315 3300026116 Bacteria 12009
276 Ga0207674_10220429 3300026116 Bacteria 1845
277 Ga0207675_100005676 3300026118 Bacteria 11943
278 Ga0207675_100029581 3300026118 Bacteria 5103
279 Ga0207675_100231523 3300026118 Bacteria 1783
280 Ga0207683_10009050 3300026121 Bacteria 8487
281 Ga0207683_10251262 3300026121 Bacteria 1614
282 Ga0207698_10137499 3300026142 Bacteria 2099
283 Ga0207698_10177966 3300026142 Bacteria 1880
284 Ga0207698_10616957 3300026142 Bacteria 1071
285 Ga0268266_10293508 3300028379 Bacteria 1515
286 Ga0268265_10035927 3300028380 Bacteria 3625
287 Ga0268265_10112568 3300028380 Bacteria 2225
288 Ga0268265_10145085 3300028380 Unclassified 1993
289 Ga0268264_10006512 3300028381 Bacteria 9835
290 Ga0268264_10506748 3300028381 Bacteria 1178
291 Ga0268264_10556712 3300028381 Bacteria 1125
292 Ga0307515_10000089 3300028794 Bacteria 215736
293 Ga0307515_10015292 3300028794 Bacteria 14149
294 Ga0265328_10000916 3300031239 Bacteria 13610
295 Ga0265316_10463128 3300031344 Bacteria 908
296 Ga0307513_10025908 3300031456 Bacteria 6775
297 Ga0307514_10000947 3300031649 Bacteria 43838
298 Ga0307412_10712258 3300031911 Bacteria 863
299 Ga0307409_100986425 3300031995 Bacteria 860
300 Ga0373924_0007675 3300035410 Bacteria 3899
301 Ga0373937_0156612 3300036401 Bacteria 2135
302 Ga0373937_0239417 3300036401 Bacteria 1710
303 Ga0395905_0055832 3300037471 Bacteria 3696
304 Ga0436361_0192271 3300039447 Bacteria 8176
305 Ga0436361_0708614 3300039447 Bacteria 59038
306 Ga0436361_0709643 3300039447 Bacteria 1339
307 Ga0436361_1127912 3300039447 Bacteria 46645
308 Ga0451802_1268127 3300041460 Bacteria 1877
309 Ga0451853_3615062 3300041512 Bacteria 954
310 Ga0439454_018738 3300042011 Bacteria 1000
311 Ga0450890_000450 3300042127 Bacteria 6000
312 Ga0439459_0001156 3300042438 Bacteria 3832
313 Ga0439460_0121641 3300042461 Bacteria 854
314 Ga0451577_0006231 3300042876 Bacteria 11962
315 Ga0451577_0092636 3300042876 Bacteria 2698
316 Ga0451577_0454110 3300042876 Bacteria 1164
317 Ga0466972_0019283 3300044658 Bacteria 3411
318 Ga0453683_0011533 3300044673 Bacteria 5823
319 Ga0466965_0102346 3300044683 Bacteria 1465
320 Ga0453684_0000965 3300044712 Bacteria 94813
321 Ga0453684_0021172 3300044712 Bacteria 9737
322 Ga0453684_0654035 3300044712 Bacteria 1146
323 Ga0466970_0056634 3300044765 Bacteria 2095
324 Ga0466959_0211724 3300045049 Bacteria 1347
325 Ga0451576_0007353 3300045051 Bacteria 13200
326 Ga0451576_0163478 3300045051 Bacteria 2323
327 Ga0495580_0433139 3300046472 Bacteria 884
328 Ga0495654_0018873 3300046530 Unclassified 3609
329 Ga0495686_0001317 3300047472 Bacteria 27841
330 Ga0496102_0004606 3300048905 Bacteria 11667
331 Ga0496109_0477062 3300048912 Bacteria 1178
332 Ga0496124_0021113 3300048927 Bacteria 6005
333 Ga0496125_0005139 3300048928 Bacteria 14720
334 Ga0496126_0128479 3300048929 Bacteria 2191
335 Ga0501043_0000128 3300049579 Bacteria 70511
336 Ga0501046_0000090 3300049580 Bacteria 98195
337 Ga0501047_0000062 3300049581 Bacteria 137218
338 Ga0501048_0002949 3300049582 Bacteria 13004
339 Ga0501035_0030169 3300049822 Bacteria 4944
340 Ga0501045_0002367 3300049824 Bacteria 12797
341 nmdc:mga0k408_4455_c1 3300050493 Bacteria 7434
342 nmdc:mga07m45_6590_c1 3300050496 Bacteria 5883
343 nmdc:mga0qj67_229688_c1 3300050509 Bacteria 1506
344 nmdc:mga08y16_959165_c1 3300050511 Bacteria 838

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006195 Ga0075366_10000995 Ga0075366_100009957 198
2 3300050493 nmdc:mga0k408_4455_c1 nmdc:mga0k408_4455_c1_1825_2442 198
3 3300044712 Ga0453684_0000965 Ga0453684_0000965_59240_59860 199
4 3300021361 Ga0213872_10000053 Ga0213872_1000005343 200
5 3300021361 Ga0213872_10119032 Ga0213872_101190322 200
6 3300039447 Ga0436361_0708614 Ga0436361_0708614_27002_27619 200
7 3300039447 Ga0436361_0709643 Ga0436361_0709643_478_1095 200
8 3300005334 Ga0068869_100093003 Ga0068869_1000930032 201
9 3300005338 Ga0068868_100096500 Ga0068868_1000965002 201
10 3300005354 Ga0070675_100626268 Ga0070675_1006262681 201
11 3300005543 Ga0070672_100157346 Ga0070672_1001573462 201
12 3300006881 Ga0068865_100158154 Ga0068865_1001581542 201
13 3300011119 Ga0105246_10431182 Ga0105246_104311821 201
14 3300025907 Ga0207645_10155456 Ga0207645_101554561 201
15 3300025926 Ga0207659_10659483 Ga0207659_106594831 201
16 3300025940 Ga0207691_10176068 Ga0207691_101760681 201
17 3300025942 Ga0207689_10108601 Ga0207689_101086012 201
18 3300026089 Ga0207648_10014343 Ga0207648_100143433 201
19 iso_pu_bacteria 2643221592 2643971151 201
20 iso_pu_bacteria 2643221625 2644142083 201
21 iso_pu_bacteria 2643221648 2644276308 201
22 3300005549 Ga0070704_100756762 Ga0070704_1007567621 202
23 3300005564 Ga0070664_100676443 Ga0070664_1006764432 202
24 3300025927 Ga0207687_10292173 Ga0207687_102921731 202
25 3300031344 Ga0265316_10463128 Ga0265316_104631281 202
26 3300031911 Ga0307412_10712258 Ga0307412_107122581 202
27 iso_pu_bacteria 2891633521 2891635401 202
28 3300003320 rootH2_10047099 rootH2_100470992 203
29 3300003322 rootL2_10000057 rootL2_1000005742 203
30 3300003323 rootH1_10012740 rootH1_100127405 203
31 3300003775 Ga0055524_1002178 Ga0055524_10021784 203
32 3300003775 Ga0055524_1006904 Ga0055524_10069042 203
33 3300005543 Ga0070672_100615353 Ga0070672_1006153532 203
34 3300006353 Ga0075370_10008714 Ga0075370_100087141 203
35 3300012497 Ga0157319_1000001 Ga0157319_1000001261 203
36 3300025273 Ga0209673_1005099 Ga0209673_10050995 203
37 3300025298 Ga0209050_1002952 Ga0209050_10029523 203
38 3300025299 Ga0209256_1000742 Ga0209256_100074236 203
39 3300025299 Ga0209256_1003850 Ga0209256_10038505 203
40 3300025303 Ga0209051_1000963 Ga0209051_100096328 203
41 3300025304 Ga0209257_1001410 Ga0209257_100141018 203
42 3300025304 Ga0209257_1004445 Ga0209257_10044456 203
43 3300042011 Ga0439454_018738 Ga0439454_018738_72_710 203
44 3300042127 Ga0450890_000450 Ga0450890_000450_879_1517 203
45 3300042438 Ga0439459_0001156 Ga0439459_0001156_204_842 203
46 3300042876 Ga0451577_0092636 Ga0451577_0092636_1708_2328 203
47 3300048927 Ga0496124_0021113 Ga0496124_0021113_3563_4201 203
48 3300050496 nmdc:mga07m45_6590_c1 nmdc:mga07m45_6590_c1_175_813 203
49 iso_pu_bacteria 2831864461 2831866523 203
50 iso_pu_bacteria 2886848708 2886852653 203
51 3300005355 Ga0070671_100290364 Ga0070671_1002903642 204
52 3300005367 Ga0070667_100264239 Ga0070667_1002642391 204
53 3300005543 Ga0070672_100099159 Ga0070672_1000991592 204
54 3300005548 Ga0070665_100658039 Ga0070665_1006580391 204
55 3300005548 Ga0070665_100805566 Ga0070665_1008055662 204
56 3300005564 Ga0070664_100031902 Ga0070664_1000319023 204
57 3300005841 Ga0068863_100032064 Ga0068863_1000320644 204
58 3300005843 Ga0068860_100744767 Ga0068860_1007447672 204
59 3300025899 Ga0207642_10113671 Ga0207642_101136712 204
60 3300025901 Ga0207688_10125669 Ga0207688_101256692 204
61 3300025903 Ga0207680_10126995 Ga0207680_101269951 204
62 3300025907 Ga0207645_10010387 Ga0207645_100103872 204
63 3300025909 Ga0207705_10339670 Ga0207705_103396701 204
64 3300025913 Ga0207695_10043772 Ga0207695_100437723 204
65 3300025914 Ga0207671_10003589 Ga0207671_100035894 204
66 3300025926 Ga0207659_10226653 Ga0207659_102266532 204
67 3300025933 Ga0207706_10589026 Ga0207706_105890261 204
68 3300025940 Ga0207691_10007470 Ga0207691_100074708 204
69 3300025941 Ga0207711_10292091 Ga0207711_102920911 204
70 3300025941 Ga0207711_10654176 Ga0207711_106541761 204
71 3300025942 Ga0207689_10140367 Ga0207689_101403672 204
72 3300025944 Ga0207661_10253145 Ga0207661_102531452 204
73 3300025972 Ga0207668_10034569 Ga0207668_100345693 204
74 3300026088 Ga0207641_10662987 Ga0207641_106629871 204
75 3300026089 Ga0207648_10040680 Ga0207648_100406803 204
76 3300026121 Ga0207683_10251262 Ga0207683_102512622 204
77 3300026142 Ga0207698_10137499 Ga0207698_101374992 204
78 3300028379 Ga0268266_10293508 Ga0268266_102935082 204
79 3300028794 Ga0307515_10015292 Ga0307515_100152926 204
80 3300031456 Ga0307513_10025908 Ga0307513_100259082 204
81 3300031649 Ga0307514_10000947 Ga0307514_100009475 204
82 3300047472 Ga0495686_0001317 Ga0495686_0001317_23925_24554 204
83 3300042461 Ga0439460_0121641 Ga0439460_0121641_120_749 205
84 3300042876 Ga0451577_0006231 Ga0451577_0006231_4447_5076 205
85 3300042876 Ga0451577_0454110 Ga0451577_0454110_128_754 205
86 3300044673 Ga0453683_0011533 Ga0453683_0011533_596_1225 205
87 3300044712 Ga0453684_0021172 Ga0453684_0021172_6227_6856 205
88 3300044712 Ga0453684_0654035 Ga0453684_0654035_375_1004 205
89 3300045051 Ga0451576_0007353 Ga0451576_0007353_2664_3293 205
90 3300005331 Ga0070670_100071084 Ga0070670_1000710842 206
91 3300005335 Ga0070666_10559713 Ga0070666_105597131 206
92 3300005353 Ga0070669_100015448 Ga0070669_1000154482 206
93 3300005354 Ga0070675_100084702 Ga0070675_1000847022 206
94 3300005355 Ga0070671_100159067 Ga0070671_1001590672 206
95 3300005355 Ga0070671_100567026 Ga0070671_1005670261 206
96 3300005356 Ga0070674_100278980 Ga0070674_1002789802 206
97 3300005457 Ga0070662_100011957 Ga0070662_1000119573 206
98 3300005459 Ga0068867_100030746 Ga0068867_1000307462 206
99 3300005543 Ga0070672_100003665 Ga0070672_1000036652 206
100 3300005618 Ga0068864_100077888 Ga0068864_1000778883 206
101 3300005719 Ga0068861_100025451 Ga0068861_1000254514 206
102 3300005843 Ga0068860_100019553 Ga0068860_1000195533 206
103 3300006237 Ga0097621_100211128 Ga0097621_1002111282 206
104 3300009177 Ga0105248_10052132 Ga0105248_100521323 206
105 3300013296 Ga0157374_10608911 Ga0157374_106089111 206
106 3300013306 Ga0163162_10007895 Ga0163162_100078954 206
107 3300013308 Ga0157375_10003600 Ga0157375_100036007 206
108 3300014325 Ga0163163_10118632 Ga0163163_101186321 206
109 3300014326 Ga0157380_10008997 Ga0157380_100089973 206
110 3300014969 Ga0157376_10086194 Ga0157376_100861942 206
111 3300017792 Ga0163161_10030196 Ga0163161_100301963 206
112 3300025893 Ga0207682_10033710 Ga0207682_100337101 206
113 3300025903 Ga0207680_10517032 Ga0207680_105170321 206
114 3300025925 Ga0207650_10011462 Ga0207650_100114621 206
115 3300025925 Ga0207650_10097715 Ga0207650_100977152 206
116 3300025926 Ga0207659_10040560 Ga0207659_100405601 206
117 3300025931 Ga0207644_10165911 Ga0207644_101659112 206
118 3300025933 Ga0207706_10009362 Ga0207706_100093623 206
119 3300025937 Ga0207669_10586118 Ga0207669_105861181 206
120 3300025940 Ga0207691_10002319 Ga0207691_100023192 206
121 3300025941 Ga0207711_10605380 Ga0207711_106053802 206
122 3300025960 Ga0207651_10002768 Ga0207651_100027685 206
123 3300025972 Ga0207668_10003511 Ga0207668_100035114 206
124 3300026088 Ga0207641_10047179 Ga0207641_100471792 206
125 3300026089 Ga0207648_10044545 Ga0207648_100445452 206
126 3300026095 Ga0207676_10016326 Ga0207676_100163264 206
127 3300026095 Ga0207676_10075643 Ga0207676_100756433 206
128 3300026118 Ga0207675_100005676 Ga0207675_1000056767 206
129 3300026142 Ga0207698_10616957 Ga0207698_106169571 206
130 3300028381 Ga0268264_10006512 Ga0268264_100065124 206
131 3300028794 Ga0307515_10000089 Ga0307515_1000008992 206
132 3300039447 Ga0436361_0192271 Ga0436361_0192271_3908_4546 206
133 3300039447 Ga0436361_1127912 Ga0436361_1127912_28142_28819 206
134 3300045051 Ga0451576_0163478 Ga0451576_0163478_379_1014 206
135 3300005331 Ga0070670_100015131 Ga0070670_1000151314 207
136 3300005333 Ga0070677_10108467 Ga0070677_101084671 207
137 3300005335 Ga0070666_10399636 Ga0070666_103996362 207
138 3300005347 Ga0070668_100081732 Ga0070668_1000817322 207
139 3300005347 Ga0070668_100247082 Ga0070668_1002470821 207
140 3300005347 Ga0070668_100613234 Ga0070668_1006132341 207
141 3300005353 Ga0070669_100329545 Ga0070669_1003295452 207
142 3300005354 Ga0070675_100035842 Ga0070675_1000358422 207
143 3300005354 Ga0070675_100046368 Ga0070675_1000463681 207
144 3300005356 Ga0070674_100024834 Ga0070674_1000248344 207
145 3300005364 Ga0070673_100037871 Ga0070673_1000378713 207
146 3300005365 Ga0070688_100183938 Ga0070688_1001839382 207
147 3300005440 Ga0070705_100060278 Ga0070705_1000602782 207
148 3300005441 Ga0070700_100027108 Ga0070700_1000271082 207
149 3300005456 Ga0070678_100291464 Ga0070678_1002914642 207
150 3300005458 Ga0070681_10065791 Ga0070681_100657912 207
151 3300005459 Ga0068867_100029685 Ga0068867_1000296851 207
152 3300005543 Ga0070672_100448651 Ga0070672_1004486512 207
153 3300005544 Ga0070686_100120880 Ga0070686_1001208801 207
154 3300005545 Ga0070695_100767235 Ga0070695_1007672351 207
155 3300005563 Ga0068855_100108629 Ga0068855_1001086293 207
156 3300005564 Ga0070664_100010341 Ga0070664_1000103413 207
157 3300005564 Ga0070664_100257988 Ga0070664_1002579882 207
158 3300005617 Ga0068859_100018647 Ga0068859_1000186476 207
159 3300005618 Ga0068864_100020534 Ga0068864_1000205344 207
160 3300005618 Ga0068864_100035566 Ga0068864_1000355661 207
161 3300005719 Ga0068861_100335168 Ga0068861_1003351682 207
162 3300005840 Ga0068870_10032402 Ga0068870_100324022 207
163 3300005841 Ga0068863_100041398 Ga0068863_1000413984 207
164 3300005841 Ga0068863_100096643 Ga0068863_1000966433 207
165 3300005842 Ga0068858_100236456 Ga0068858_1002364562 207
166 3300005843 Ga0068860_100280002 Ga0068860_1002800022 207
167 3300005844 Ga0068862_100013386 Ga0068862_1000133864 207
168 3300005844 Ga0068862_100103523 Ga0068862_1001035232 207
169 3300005844 Ga0068862_100276746 Ga0068862_1002767462 207
170 3300005844 Ga0068862_101093812 Ga0068862_1010938121 207
171 3300006195 Ga0075366_10043208 Ga0075366_100432082 207
172 3300006237 Ga0097621_100187984 Ga0097621_1001879842 207
173 3300006846 Ga0075430_100049176 Ga0075430_1000491764 207
174 3300006881 Ga0068865_100195969 Ga0068865_1001959693 207
175 3300006931 Ga0097620_100018647 Ga0097620_1000186476 207
176 3300009148 Ga0105243_10006785 Ga0105243_100067857 207
177 3300009148 Ga0105243_10023002 Ga0105243_100230022 207
178 3300009176 Ga0105242_10059814 Ga0105242_100598143 207
179 3300009176 Ga0105242_10422588 Ga0105242_104225882 207
180 3300009177 Ga0105248_10065961 Ga0105248_100659613 207
181 3300009553 Ga0105249_10018110 Ga0105249_100181104 207
182 3300013105 Ga0157369_10381008 Ga0157369_103810082 207
183 3300013297 Ga0157378_10017946 Ga0157378_100179462 207
184 3300013306 Ga0163162_10165687 Ga0163162_101656872 207
185 3300014325 Ga0163163_10066691 Ga0163163_100666913 207
186 3300014325 Ga0163163_10781437 Ga0163163_107814372 207
187 3300014326 Ga0157380_10051090 Ga0157380_100510903 207
188 3300014969 Ga0157376_10009209 Ga0157376_100092094 207
189 3300014969 Ga0157376_10728616 Ga0157376_107286161 207
190 3300017792 Ga0163161_10529742 Ga0163161_105297422 207
191 3300025315 Ga0207697_10021208 Ga0207697_100212082 207
192 3300025893 Ga0207682_10019372 Ga0207682_100193723 207
193 3300025907 Ga0207645_10183202 Ga0207645_101832021 207
194 3300025908 Ga0207643_10003370 Ga0207643_100033707 207
195 3300025923 Ga0207681_10104353 Ga0207681_101043531 207
196 3300025923 Ga0207681_10130666 Ga0207681_101306662 207
197 3300025925 Ga0207650_10009727 Ga0207650_100097274 207
198 3300025926 Ga0207659_10027501 Ga0207659_100275012 207
199 3300025926 Ga0207659_10334213 Ga0207659_103342132 207
200 3300025928 Ga0207700_10000355 Ga0207700_100003554 207
201 3300025934 Ga0207686_10023996 Ga0207686_100239963 207
202 3300025935 Ga0207709_10090308 Ga0207709_100903082 207
203 3300025938 Ga0207704_10492505 Ga0207704_104925051 207
204 3300025942 Ga0207689_10002027 Ga0207689_1000202711 207
205 3300025945 Ga0207679_10122617 Ga0207679_101226171 207
206 3300025945 Ga0207679_10171128 Ga0207679_101711282 207
207 3300025949 Ga0207667_10362852 Ga0207667_103628521 207
208 3300025961 Ga0207712_10110280 Ga0207712_101102801 207
209 3300025972 Ga0207668_10360456 Ga0207668_103604562 207
210 3300026035 Ga0207703_10053155 Ga0207703_100531553 207
211 3300026075 Ga0207708_10022848 Ga0207708_100228484 207
212 3300026088 Ga0207641_10125123 Ga0207641_101251231 207
213 3300026089 Ga0207648_10042847 Ga0207648_100428471 207
214 3300026118 Ga0207675_100029581 Ga0207675_1000295814 207
215 3300026121 Ga0207683_10009050 Ga0207683_100090504 207
216 3300028380 Ga0268265_10112568 Ga0268265_101125682 207
217 3300028380 Ga0268265_10145085 Ga0268265_101450852 207
218 3300028381 Ga0268264_10556712 Ga0268264_105567122 207
219 3300041512 Ga0451853_3615062 Ga0451853_3615062_120_758 207
220 3300049822 Ga0501035_0030169 Ga0501035_0030169_3373_4011 207
221 3300050509 nmdc:mga0qj67_229688_c1 nmdc:mga0qj67_229688_c1_620_1252 207
222 3300050511 nmdc:mga08y16_959165_c1 nmdc:mga08y16_959165_c1_98_730 207
223 3300005327 Ga0070658_10958581 Ga0070658_109585811 208
224 3300005334 Ga0068869_100022088 Ga0068869_1000220885 208
225 3300005337 Ga0070682_100100774 Ga0070682_1001007741 208
226 3300005338 Ga0068868_100026934 Ga0068868_1000269342 208
227 3300005354 Ga0070675_100024429 Ga0070675_1000244292 208
228 3300005367 Ga0070667_100366822 Ga0070667_1003668222 208
229 3300005435 Ga0070714_100031454 Ga0070714_1000314542 208
230 3300005459 Ga0068867_100491527 Ga0068867_1004915271 208
231 3300005530 Ga0070679_100195692 Ga0070679_1001956921 208
232 3300005535 Ga0070684_100540326 Ga0070684_1005403261 208
233 3300005563 Ga0068855_100697734 Ga0068855_1006977341 208
234 3300005564 Ga0070664_100039307 Ga0070664_1000393073 208
235 3300005577 Ga0068857_100016049 Ga0068857_1000160495 208
236 3300005614 Ga0068856_100061947 Ga0068856_1000619475 208
237 3300005843 Ga0068860_100179010 Ga0068860_1001790102 208
238 3300005844 Ga0068862_100003630 Ga0068862_10000363010 208
239 3300005844 Ga0068862_100352888 Ga0068862_1003528881 208
240 3300005844 Ga0068862_101335985 Ga0068862_1013359851 208
241 3300006195 Ga0075366_10289624 Ga0075366_102896242 208
242 3300006358 Ga0068871_100153347 Ga0068871_1001533472 208
243 3300006846 Ga0075430_100206486 Ga0075430_1002064862 208
244 3300006931 Ga0097620_100031378 Ga0097620_1000313781 208
245 3300009093 Ga0105240_10061433 Ga0105240_100614332 208
246 3300009551 Ga0105238_10000971 Ga0105238_100009711 208
247 3300013100 Ga0157373_10032438 Ga0157373_100324381 208
248 3300013104 Ga0157370_10297879 Ga0157370_102978792 208
249 3300013105 Ga0157369_10033215 Ga0157369_100332154 208
250 3300014968 Ga0157379_10072908 Ga0157379_100729082 208
251 3300025911 Ga0207654_10425749 Ga0207654_104257491 208
252 3300025913 Ga0207695_10058590 Ga0207695_100585904 208
253 3300025919 Ga0207657_10118723 Ga0207657_101187231 208
254 3300025920 Ga0207649_10014844 Ga0207649_100148443 208
255 3300025921 Ga0207652_10231568 Ga0207652_102315682 208
256 3300025924 Ga0207694_10101375 Ga0207694_101013751 208
257 3300025927 Ga0207687_10547205 Ga0207687_105472051 208
258 3300025938 Ga0207704_10409915 Ga0207704_104099152 208
259 3300025941 Ga0207711_10055649 Ga0207711_100556491 208
260 3300025942 Ga0207689_10015770 Ga0207689_100157701 208
261 3300025945 Ga0207679_10114116 Ga0207679_101141163 208
262 3300025949 Ga0207667_10041856 Ga0207667_100418564 208
263 3300025981 Ga0207640_10226860 Ga0207640_102268602 208
264 3300025986 Ga0207658_10413417 Ga0207658_104134171 208
265 3300026023 Ga0207677_10016865 Ga0207677_100168652 208
266 3300026078 Ga0207702_10061796 Ga0207702_100617962 208
267 3300026078 Ga0207702_10117036 Ga0207702_101170363 208
268 3300026088 Ga0207641_10366367 Ga0207641_103663672 208
269 3300026089 Ga0207648_10523264 Ga0207648_105232641 208
270 3300026116 Ga0207674_10008315 Ga0207674_100083153 208
271 3300026118 Ga0207675_100231523 Ga0207675_1002315231 208
272 3300028380 Ga0268265_10035927 Ga0268265_100359272 208
273 3300035410 Ga0373924_0007675 Ga0373924_0007675_2583_3302 208
274 3300048912 Ga0496109_0477062 Ga0496109_0477062_103_741 208
275 3300005366 Ga0070659_100160471 Ga0070659_1001604712 209
276 3300005564 Ga0070664_100026396 Ga0070664_1000263961 209
277 3300005564 Ga0070664_100044966 Ga0070664_1000449664 209
278 3300013105 Ga0157369_10393273 Ga0157369_103932732 209
279 3300013307 Ga0157372_10089607 Ga0157372_100896073 209
280 3300025919 Ga0207657_10528675 Ga0207657_105286751 209
281 3300025932 Ga0207690_10071025 Ga0207690_100710252 209
282 3300025945 Ga0207679_10060971 Ga0207679_100609712 209
283 3300025945 Ga0207679_10167211 Ga0207679_101672112 209
284 3300005439 Ga0070711_100128709 Ga0070711_1001287092 210
285 3300005564 Ga0070664_100564047 Ga0070664_1005640472 210
286 3300006175 Ga0070712_100126498 Ga0070712_1001264981 210
287 3300025916 Ga0207663_10275515 Ga0207663_102755152 210
288 3300025931 Ga0207644_10130993 Ga0207644_101309933 210
289 3300025945 Ga0207679_10727872 Ga0207679_107278721 210
290 3300036401 Ga0373937_0156612 Ga0373937_0156612_151_792 210
291 3300046472 Ga0495580_0433139 Ga0495580_0433139_222_863 210
292 3300046530 Ga0495654_0018873 Ga0495654_0018873_2346_3098 210
293 3300048905 Ga0496102_0004606 Ga0496102_0004606_5536_6180 210
294 3300048928 Ga0496125_0005139 Ga0496125_0005139_2821_3585 210
295 3300048929 Ga0496126_0128479 Ga0496126_0128479_1201_1965 210
296 3300003322 rootL2_10063700 rootL2_100637004 211
297 3300005336 Ga0070680_100195356 Ga0070680_1001953562 211
298 3300005339 Ga0070660_100136062 Ga0070660_1001360621 211
299 3300005366 Ga0070659_100214297 Ga0070659_1002142972 211
300 3300005458 Ga0070681_10150863 Ga0070681_101508632 211
301 3300005539 Ga0068853_100038133 Ga0068853_1000381332 211
302 3300005563 Ga0068855_100010612 Ga0068855_1000106125 211
303 3300005577 Ga0068857_100387169 Ga0068857_1003871692 211
304 3300006195 Ga0075366_10018564 Ga0075366_100185642 211
305 3300009551 Ga0105238_10006785 Ga0105238_100067857 211
306 3300013105 Ga0157369_10000994 Ga0157369_100009944 211
307 3300025303 Ga0209051_1002358 Ga0209051_10023582 211
308 3300025912 Ga0207707_10183401 Ga0207707_101834012 211
309 3300025919 Ga0207657_10104301 Ga0207657_101043013 211
310 3300025924 Ga0207694_10004663 Ga0207694_100046632 211
311 3300025932 Ga0207690_10146562 Ga0207690_101465621 211
312 3300025949 Ga0207667_10001650 Ga0207667_1000165022 211
313 3300026041 Ga0207639_10452644 Ga0207639_104526442 211
314 3300026116 Ga0207674_10220429 Ga0207674_102204292 211
315 3300026142 Ga0207698_10177966 Ga0207698_101779661 211
316 3300031239 Ga0265328_10000916 Ga0265328_100009169 211
317 3300036401 Ga0373937_0239417 Ga0373937_0239417_577_1230 211
318 3300037471 Ga0395905_0055832 Ga0395905_0055832_2938_3591 211
319 3300044658 Ga0466972_0019283 Ga0466972_0019283_2290_2928 211
320 3300044683 Ga0466965_0102346 Ga0466965_0102346_38_676 211
321 3300044765 Ga0466970_0056634 Ga0466970_0056634_773_1411 211
322 3300045049 Ga0466959_0211724 Ga0466959_0211724_379_1017 211
323 3300041460 Ga0451802_1268127 Ga0451802_1268127_649_1308 212
324 3300013296 Ga0157374_10218658 Ga0157374_102186582 215
325 3300031995 Ga0307409_100986425 Ga0307409_1009864251 216
326 3300005356 Ga0070674_100179314 Ga0070674_1001793142 218
327 3300025926 Ga0207659_10128063 Ga0207659_101280633 218
328 3300025937 Ga0207669_10160105 Ga0207669_101601052 218
329 3300003305 Ga0006770J48903_1026620 Ga0006770J48903_10266201 219
330 3300003308 Ga0006777J48905_1064439 Ga0006777J48905_10644391 219
331 3300003693 Ga0032354_1088087 Ga0032354_10880871 219
332 3300005339 Ga0070660_100048113 Ga0070660_1000481132 219
333 3300005347 Ga0070668_100317785 Ga0070668_1003177851 219
334 3300005459 Ga0068867_100000108 Ga0068867_10000010856 219
335 3300005548 Ga0070665_100154794 Ga0070665_1001547941 219
336 3300005843 Ga0068860_100531882 Ga0068860_1005318821 219
337 3300009148 Ga0105243_10008569 Ga0105243_100085694 219
338 3300014745 Ga0157377_10000035 Ga0157377_10000035117 219
339 3300025935 Ga0207709_10005991 Ga0207709_100059914 219
340 3300025972 Ga0207668_10293871 Ga0207668_102938712 219
341 3300025986 Ga0207658_10016999 Ga0207658_100169993 219
342 3300026067 Ga0207678_10031110 Ga0207678_100311105 219
343 3300026089 Ga0207648_10000040 Ga0207648_10000040117 219
344 3300026089 Ga0207648_10125415 Ga0207648_101254152 219
345 3300028381 Ga0268264_10506748 Ga0268264_105067481 219
346 3300049579 Ga0501043_0000128 Ga0501043_0000128_6261_6935 219
347 3300049580 Ga0501046_0000090 Ga0501046_0000090_6263_6937 219
348 3300049581 Ga0501047_0000062 Ga0501047_0000062_45360_46034 219
349 3300049582 Ga0501048_0002949 Ga0501048_0002949_3275_3949 219
350 3300049824 Ga0501045_0002367 Ga0501045_0002367_10017_10691 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02563

Poly_export

Polysaccharide biosynthesis/export protein

95

171

0.96

PF22461

SLBB_2

SLBB domain

179

259

0.96

PF10531

SLBB

SLBB domain

180

235

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nql-assembly1.cif.gz_Bc 55s mammalian mitochondrial ribosome with ict1 and p site trnamet 0.689 135 213
5gha-assembly1.cif.gz_F sulfur transferase ttua in complex with sulfur carrier ttub 0.5981 134 216
7ard-assembly1.cif.gz_O cryo-em structure of polytomella complex-i (complete composition) 0.5979 135 182
5gha-assembly2.cif.gz_H sulfur transferase ttua in complex with sulfur carrier ttub 0.5931 136 219
3r3m-assembly1.cif.gz_A crystal structure of the faf1 ubx domain 0.5822 134 213
ID Description Score Start End Superfamily
2w8hA03 Alpha Beta;2-Layer Sandwich;wza like fold;wza like domain 0.9583 59 128 3.30.1950.10
2w8hA03 Alpha Beta;2-Layer Sandwich;wza like fold;wza like domain 0.8129 59 128 3.30.1950.10
3p42D03 Alpha Beta;Roll;Outer membrane lipoprotein wza fold like;Outer membrane lipoprotein wza domain like 0.7349 134 213 3.10.560.10
af_Q9M0X0_1_69_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.7311 135 163 3.10.20.90
3p42D03 Alpha Beta;Roll;Outer membrane lipoprotein wza fold like;Outer membrane lipoprotein wza domain like 0.7089 134 213 3.10.560.10
ID Description Score Start End GO Terms
AF-A0A836W7L5-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.8535 41 129 GO:0006811
GO:0009279
GO:0015159
GO:0015288
GO:0046930
AF-A0A2V7FT22-F1-model_v4 Polysaccharide export protein N-terminal domain-containing protein 0.8193 39 128 GO:0015159
AF-A0A4Q6C2U3-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.8181 39 129 GO:0006811
GO:0009279
GO:0015159
GO:0015288
GO:0046930
AF-A0A7W1SWT9-F1-model_v4 Polysaccharide biosynthesis/export family protein 0.8001 39 128 GO:0015159
AF-Q4BZC7-F1-model_v4 Polysaccharide export protein 0.7896 39 128 GO:0006811
GO:0009279
GO:0015159
GO:0015288
GO:0046930

Feature Viewer

pLDDT pTM Quality
73.33 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map