F418140
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 350 | 194 | 344 | 212 |
Family's Representative Sequence
| Representative Sequence | 3300005339|Ga0070660_100048113|Ga0070660_1000481132 |
| Length | 264 |
| Sequence | MRESIGRARIALLGRPTAAIARLRRTTAWCGFDGGLALRCSIRFGTAGPGKARRMKRNARSLGWLWLGMFVLVYLMTISACSSLGSYPPAPTSAQTEVQSYKVGPLDTLNIVVWRNPDLSGTVAVRPDGRISSPLVPDLLVAGRTPVEIGKEIESILGKYVREPNVTVLVTNFQGMFGEQIRIVGEAARPQAIAYRQNMTLLDVMILSGGLTEFADGNGAVLVRGSEGGKQYSVRLKDLLRRGDIAANVDVKPGDVIIIPQSWF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 2 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 3 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 4 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 5 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 6 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 7 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 91 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 153 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 154 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 155 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 156 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 157 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 160 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 162 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 163 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 164 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 165 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 166 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 167 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 168 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 169 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 170 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 171 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 172 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 173 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 174 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 175 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 176 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 177 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 181 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 183 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 184 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 185 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 192 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 193 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.43 |
| Metatranscriptomes | 0.86 |
| Isolates | 1.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.86 |
| Nodule | 0.29 |
| Rhizoplane | 0.86 |
| Rhizosphere | 89.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006770J48903_1026620 | 3300003305 | Bacteria | 932 |
| 2 | Ga0006777J48905_1064439 | 3300003308 | Bacteria | 1137 |
| 3 | rootH2_10047099 | 3300003320 | Bacteria | 12920 |
| 4 | rootL2_10000057 | 3300003322 | Bacteria | 97630 |
| 5 | rootL2_10063700 | 3300003322 | Bacteria | 2201 |
| 6 | rootH1_10012740 | 3300003323 | Bacteria | 14596 |
| 7 | Ga0032354_1088087 | 3300003693 | Bacteria | 748 |
| 8 | Ga0055524_1002178 | 3300003775 | Bacteria | 10303 |
| 9 | Ga0055524_1006904 | 3300003775 | Bacteria | 4886 |
| 10 | Ga0070658_10958581 | 3300005327 | Bacteria | 744 |
| 11 | Ga0070670_100015131 | 3300005331 | Bacteria | 6620 |
| 12 | Ga0070670_100071084 | 3300005331 | Bacteria | 2987 |
| 13 | Ga0070677_10108467 | 3300005333 | Bacteria | 1236 |
| 14 | Ga0068869_100022088 | 3300005334 | Bacteria | 4382 |
| 15 | Ga0068869_100093003 | 3300005334 | Bacteria | 2271 |
| 16 | Ga0070666_10399636 | 3300005335 | Bacteria | 988 |
| 17 | Ga0070666_10559713 | 3300005335 | Unclassified | 832 |
| 18 | Ga0070680_100195356 | 3300005336 | Unclassified | 1706 |
| 19 | Ga0070682_100100774 | 3300005337 | Bacteria | 1906 |
| 20 | Ga0068868_100026934 | 3300005338 | Bacteria | 4383 |
| 21 | Ga0068868_100096500 | 3300005338 | Bacteria | 2388 |
| 22 | Ga0070660_100048113 | 3300005339 | Bacteria | 3274 |
| 23 | Ga0070660_100136062 | 3300005339 | Unclassified | 1969 |
| 24 | Ga0070668_100081732 | 3300005347 | Bacteria | 2533 |
| 25 | Ga0070668_100247082 | 3300005347 | Bacteria | 1480 |
| 26 | Ga0070668_100317785 | 3300005347 | Bacteria | 1310 |
| 27 | Ga0070668_100613234 | 3300005347 | Bacteria | 953 |
| 28 | Ga0070669_100015448 | 3300005353 | Bacteria | 5440 |
| 29 | Ga0070669_100329545 | 3300005353 | Bacteria | 1235 |
| 30 | Ga0070675_100024429 | 3300005354 | Bacteria | 4840 |
| 31 | Ga0070675_100035842 | 3300005354 | Bacteria | 4034 |
| 32 | Ga0070675_100046368 | 3300005354 | Bacteria | 3558 |
| 33 | Ga0070675_100084702 | 3300005354 | Bacteria | 2647 |
| 34 | Ga0070675_100626268 | 3300005354 | Bacteria | 977 |
| 35 | Ga0070671_100159067 | 3300005355 | Bacteria | 1909 |
| 36 | Ga0070671_100290364 | 3300005355 | Bacteria | 1392 |
| 37 | Ga0070671_100567026 | 3300005355 | Bacteria | 980 |
| 38 | Ga0070674_100024834 | 3300005356 | Bacteria | 3893 |
| 39 | Ga0070674_100179314 | 3300005356 | Bacteria | 1621 |
| 40 | Ga0070674_100278980 | 3300005356 | Bacteria | 1324 |
| 41 | Ga0070673_100037871 | 3300005364 | Bacteria | 3678 |
| 42 | Ga0070688_100183938 | 3300005365 | Bacteria | 1451 |
| 43 | Ga0070659_100160471 | 3300005366 | Bacteria | 1838 |
| 44 | Ga0070659_100214297 | 3300005366 | Unclassified | 1588 |
| 45 | Ga0070667_100264239 | 3300005367 | Bacteria | 1542 |
| 46 | Ga0070667_100366822 | 3300005367 | Bacteria | 1306 |
| 47 | Ga0070714_100031454 | 3300005435 | Bacteria | 4428 |
| 48 | Ga0070711_100128709 | 3300005439 | Bacteria | 1883 |
| 49 | Ga0070705_100060278 | 3300005440 | Bacteria | 2250 |
| 50 | Ga0070700_100027108 | 3300005441 | Bacteria | 3394 |
| 51 | Ga0070678_100291464 | 3300005456 | Bacteria | 1384 |
| 52 | Ga0070662_100011957 | 3300005457 | Bacteria | 5741 |
| 53 | Ga0070681_10065791 | 3300005458 | Bacteria | 3594 |
| 54 | Ga0070681_10150863 | 3300005458 | Bacteria | 2250 |
| 55 | Ga0068867_100000108 | 3300005459 | Bacteria | 53317 |
| 56 | Ga0068867_100029685 | 3300005459 | Bacteria | 3940 |
| 57 | Ga0068867_100030746 | 3300005459 | Bacteria | 3874 |
| 58 | Ga0068867_100491527 | 3300005459 | Unclassified | 1053 |
| 59 | Ga0070679_100195692 | 3300005530 | Bacteria | 1989 |
| 60 | Ga0070684_100540326 | 3300005535 | Bacteria | 1081 |
| 61 | Ga0068853_100038133 | 3300005539 | Bacteria | 4092 |
| 62 | Ga0070672_100003665 | 3300005543 | Bacteria | 9979 |
| 63 | Ga0070672_100099159 | 3300005543 | Bacteria | 2361 |
| 64 | Ga0070672_100157346 | 3300005543 | Bacteria | 1883 |
| 65 | Ga0070672_100448651 | 3300005543 | Bacteria | 1111 |
| 66 | Ga0070672_100615353 | 3300005543 | Bacteria | 947 |
| 67 | Ga0070686_100120880 | 3300005544 | Bacteria | 1798 |
| 68 | Ga0070695_100767235 | 3300005545 | Bacteria | 770 |
| 69 | Ga0070665_100154794 | 3300005548 | Bacteria | 2294 |
| 70 | Ga0070665_100658039 | 3300005548 | Bacteria | 1061 |
| 71 | Ga0070665_100805566 | 3300005548 | Bacteria | 952 |
| 72 | Ga0070704_100756762 | 3300005549 | Unclassified | 865 |
| 73 | Ga0068855_100010612 | 3300005563 | Bacteria | 11105 |
| 74 | Ga0068855_100108629 | 3300005563 | Bacteria | 3186 |
| 75 | Ga0068855_100697734 | 3300005563 | Bacteria | 1086 |
| 76 | Ga0070664_100010341 | 3300005564 | Bacteria | 7571 |
| 77 | Ga0070664_100026396 | 3300005564 | Bacteria | 4818 |
| 78 | Ga0070664_100031902 | 3300005564 | Bacteria | 4406 |
| 79 | Ga0070664_100039307 | 3300005564 | Bacteria | 3986 |
| 80 | Ga0070664_100044966 | 3300005564 | Bacteria | 3729 |
| 81 | Ga0070664_100257988 | 3300005564 | Bacteria | 1568 |
| 82 | Ga0070664_100564047 | 3300005564 | Bacteria | 1054 |
| 83 | Ga0070664_100676443 | 3300005564 | Unclassified | 960 |
| 84 | Ga0068857_100016049 | 3300005577 | Bacteria | 6561 |
| 85 | Ga0068857_100387169 | 3300005577 | Unclassified | 1299 |
| 86 | Ga0068856_100061947 | 3300005614 | Bacteria | 3695 |
| 87 | Ga0068859_100018647 | 3300005617 | Bacteria | 6975 |
| 88 | Ga0068864_100020534 | 3300005618 | Bacteria | 5526 |
| 89 | Ga0068864_100035566 | 3300005618 | Bacteria | 4240 |
| 90 | Ga0068864_100077888 | 3300005618 | Bacteria | 2900 |
| 91 | Ga0068861_100025451 | 3300005719 | Bacteria | 4293 |
| 92 | Ga0068861_100335168 | 3300005719 | Unclassified | 1322 |
| 93 | Ga0068870_10032402 | 3300005840 | Bacteria | 2656 |
| 94 | Ga0068863_100032064 | 3300005841 | Bacteria | 5011 |
| 95 | Ga0068863_100041398 | 3300005841 | Bacteria | 4381 |
| 96 | Ga0068863_100096643 | 3300005841 | Bacteria | 2804 |
| 97 | Ga0068858_100236456 | 3300005842 | Bacteria | 1733 |
| 98 | Ga0068860_100019553 | 3300005843 | Bacteria | 6566 |
| 99 | Ga0068860_100179010 | 3300005843 | Bacteria | 2049 |
| 100 | Ga0068860_100280002 | 3300005843 | Bacteria | 1629 |
| 101 | Ga0068860_100531882 | 3300005843 | Bacteria | 1176 |
| 102 | Ga0068860_100744767 | 3300005843 | Bacteria | 991 |
| 103 | Ga0068862_100003630 | 3300005844 | Bacteria | 13195 |
| 104 | Ga0068862_100013386 | 3300005844 | Bacteria | 6788 |
| 105 | Ga0068862_100103523 | 3300005844 | Unclassified | 2493 |
| 106 | Ga0068862_100276746 | 3300005844 | Bacteria | 1537 |
| 107 | Ga0068862_100352888 | 3300005844 | Unclassified | 1365 |
| 108 | Ga0068862_101093812 | 3300005844 | Bacteria | 792 |
| 109 | Ga0068862_101335985 | 3300005844 | Bacteria | 719 |
| 110 | Ga0070712_100126498 | 3300006175 | Bacteria | 1931 |
| 111 | Ga0075366_10000995 | 3300006195 | Bacteria | 13880 |
| 112 | Ga0075366_10018564 | 3300006195 | Bacteria | 4017 |
| 113 | Ga0075366_10043208 | 3300006195 | Bacteria | 2669 |
| 114 | Ga0075366_10289624 | 3300006195 | Unclassified | 1001 |
| 115 | Ga0097621_100187984 | 3300006237 | Bacteria | 1787 |
| 116 | Ga0097621_100211128 | 3300006237 | Bacteria | 1689 |
| 117 | Ga0075370_10008714 | 3300006353 | Bacteria | 5232 |
| 118 | Ga0068871_100153347 | 3300006358 | Bacteria | 1966 |
| 119 | Ga0075430_100049176 | 3300006846 | Bacteria | 3559 |
| 120 | Ga0075430_100206486 | 3300006846 | Bacteria | 1630 |
| 121 | Ga0068865_100158154 | 3300006881 | Bacteria | 1726 |
| 122 | Ga0068865_100195969 | 3300006881 | Bacteria | 1565 |
| 123 | Ga0097620_100018647 | 3300006931 | Bacteria | 6975 |
| 124 | Ga0097620_100031378 | 3300006931 | Bacteria | 5336 |
| 125 | Ga0105240_10061433 | 3300009093 | Bacteria | 4682 |
| 126 | Ga0105243_10006785 | 3300009148 | Bacteria | 8829 |
| 127 | Ga0105243_10008569 | 3300009148 | Bacteria | 7846 |
| 128 | Ga0105243_10023002 | 3300009148 | Bacteria | 4740 |
| 129 | Ga0105242_10059814 | 3300009176 | Bacteria | 3127 |
| 130 | Ga0105242_10422588 | 3300009176 | Unclassified | 1249 |
| 131 | Ga0105248_10052132 | 3300009177 | Bacteria | 4591 |
| 132 | Ga0105248_10065961 | 3300009177 | Bacteria | 4065 |
| 133 | Ga0105238_10000971 | 3300009551 | Bacteria | 29344 |
| 134 | Ga0105238_10006785 | 3300009551 | Bacteria | 11433 |
| 135 | Ga0105249_10018110 | 3300009553 | Bacteria | 6260 |
| 136 | Ga0105246_10431182 | 3300011119 | Bacteria | 1103 |
| 137 | Ga0157319_1000001 | 3300012497 | Bacteria | 423237 |
| 138 | Ga0157373_10032438 | 3300013100 | Bacteria | 3760 |
| 139 | Ga0157370_10297879 | 3300013104 | Bacteria | 1489 |
| 140 | Ga0157369_10000994 | 3300013105 | Bacteria | 35863 |
| 141 | Ga0157369_10033215 | 3300013105 | Bacteria | 5672 |
| 142 | Ga0157369_10381008 | 3300013105 | Bacteria | 1464 |
| 143 | Ga0157369_10393273 | 3300013105 | Bacteria | 1438 |
| 144 | Ga0157374_10218658 | 3300013296 | Bacteria | 1869 |
| 145 | Ga0157374_10608911 | 3300013296 | Bacteria | 1103 |
| 146 | Ga0157378_10017946 | 3300013297 | Bacteria | 6212 |
| 147 | Ga0163162_10007895 | 3300013306 | Bacteria | 10370 |
| 148 | Ga0163162_10165687 | 3300013306 | Bacteria | 2333 |
| 149 | Ga0157372_10089607 | 3300013307 | Bacteria | 3495 |
| 150 | Ga0157375_10003600 | 3300013308 | Bacteria | 13446 |
| 151 | Ga0163163_10066691 | 3300014325 | Bacteria | 3575 |
| 152 | Ga0163163_10118632 | 3300014325 | Bacteria | 2678 |
| 153 | Ga0163163_10781437 | 3300014325 | Bacteria | 1018 |
| 154 | Ga0157380_10008997 | 3300014326 | Bacteria | 7135 |
| 155 | Ga0157380_10051090 | 3300014326 | Bacteria | 3267 |
| 156 | Ga0157377_10000035 | 3300014745 | Bacteria | 116860 |
| 157 | Ga0157379_10072908 | 3300014968 | Bacteria | 3073 |
| 158 | Ga0157376_10009209 | 3300014969 | Bacteria | 7163 |
| 159 | Ga0157376_10086194 | 3300014969 | Bacteria | 2707 |
| 160 | Ga0157376_10728616 | 3300014969 | Bacteria | 999 |
| 161 | Ga0163161_10030196 | 3300017792 | Bacteria | 3855 |
| 162 | Ga0163161_10529742 | 3300017792 | Bacteria | 963 |
| 163 | Ga0213872_10000053 | 3300021361 | Bacteria | 103215 |
| 164 | Ga0213872_10119032 | 3300021361 | Bacteria | 1168 |
| 165 | Ga0209673_1005099 | 3300025273 | Bacteria | 6742 |
| 166 | Ga0209050_1002952 | 3300025298 | Bacteria | 13298 |
| 167 | Ga0209256_1000742 | 3300025299 | Bacteria | 42803 |
| 168 | Ga0209256_1003850 | 3300025299 | Bacteria | 10020 |
| 169 | Ga0209051_1000963 | 3300025303 | Bacteria | 28248 |
| 170 | Ga0209051_1002358 | 3300025303 | Bacteria | 13664 |
| 171 | Ga0209257_1001410 | 3300025304 | Bacteria | 28667 |
| 172 | Ga0209257_1004445 | 3300025304 | Bacteria | 10858 |
| 173 | Ga0207697_10021208 | 3300025315 | Bacteria | 2661 |
| 174 | Ga0207682_10019372 | 3300025893 | Bacteria | 2663 |
| 175 | Ga0207682_10033710 | 3300025893 | Unclassified | 2062 |
| 176 | Ga0207642_10113671 | 3300025899 | Bacteria | 1383 |
| 177 | Ga0207688_10125669 | 3300025901 | Bacteria | 1500 |
| 178 | Ga0207680_10126995 | 3300025903 | Bacteria | 1675 |
| 179 | Ga0207680_10517032 | 3300025903 | Unclassified | 851 |
| 180 | Ga0207645_10010387 | 3300025907 | Bacteria | 6392 |
| 181 | Ga0207645_10155456 | 3300025907 | Bacteria | 1494 |
| 182 | Ga0207645_10183202 | 3300025907 | Bacteria | 1374 |
| 183 | Ga0207643_10003370 | 3300025908 | Bacteria | 8609 |
| 184 | Ga0207705_10339670 | 3300025909 | Bacteria | 1156 |
| 185 | Ga0207654_10425749 | 3300025911 | Bacteria | 927 |
| 186 | Ga0207707_10183401 | 3300025912 | Bacteria | 1827 |
| 187 | Ga0207695_10043772 | 3300025913 | Bacteria | 4767 |
| 188 | Ga0207695_10058590 | 3300025913 | Bacteria | 3997 |
| 189 | Ga0207671_10003589 | 3300025914 | Bacteria | 15350 |
| 190 | Ga0207663_10275515 | 3300025916 | Bacteria | 1248 |
| 191 | Ga0207657_10104301 | 3300025919 | Unclassified | 2349 |
| 192 | Ga0207657_10118723 | 3300025919 | Bacteria | 2177 |
| 193 | Ga0207657_10528675 | 3300025919 | Bacteria | 923 |
| 194 | Ga0207649_10014844 | 3300025920 | Bacteria | 4369 |
| 195 | Ga0207652_10231568 | 3300025921 | Bacteria | 1665 |
| 196 | Ga0207681_10104353 | 3300025923 | Bacteria | 2050 |
| 197 | Ga0207681_10130666 | 3300025923 | Bacteria | 1856 |
| 198 | Ga0207694_10004663 | 3300025924 | Bacteria | 10674 |
| 199 | Ga0207694_10101375 | 3300025924 | Bacteria | 2281 |
| 200 | Ga0207650_10009727 | 3300025925 | Bacteria | 6575 |
| 201 | Ga0207650_10011462 | 3300025925 | Bacteria | 6102 |
| 202 | Ga0207650_10097715 | 3300025925 | Bacteria | 2255 |
| 203 | Ga0207659_10027501 | 3300025926 | Bacteria | 3852 |
| 204 | Ga0207659_10040560 | 3300025926 | Bacteria | 3256 |
| 205 | Ga0207659_10128063 | 3300025926 | Bacteria | 1955 |
| 206 | Ga0207659_10226653 | 3300025926 | Bacteria | 1505 |
| 207 | Ga0207659_10334213 | 3300025926 | Bacteria | 1253 |
| 208 | Ga0207659_10659483 | 3300025926 | Bacteria | 894 |
| 209 | Ga0207687_10292173 | 3300025927 | Unclassified | 1310 |
| 210 | Ga0207687_10547205 | 3300025927 | Unclassified | 971 |
| 211 | Ga0207700_10000355 | 3300025928 | Bacteria | 26804 |
| 212 | Ga0207644_10130993 | 3300025931 | Bacteria | 1920 |
| 213 | Ga0207644_10165911 | 3300025931 | Bacteria | 1720 |
| 214 | Ga0207690_10071025 | 3300025932 | Bacteria | 2400 |
| 215 | Ga0207690_10146562 | 3300025932 | Unclassified | 1746 |
| 216 | Ga0207706_10009362 | 3300025933 | Bacteria | 8995 |
| 217 | Ga0207706_10589026 | 3300025933 | Bacteria | 956 |
| 218 | Ga0207686_10023996 | 3300025934 | Bacteria | 3528 |
| 219 | Ga0207709_10005991 | 3300025935 | Bacteria | 6853 |
| 220 | Ga0207709_10090308 | 3300025935 | Bacteria | 2000 |
| 221 | Ga0207669_10160105 | 3300025937 | Bacteria | 1589 |
| 222 | Ga0207669_10586118 | 3300025937 | Unclassified | 904 |
| 223 | Ga0207704_10409915 | 3300025938 | Bacteria | 1072 |
| 224 | Ga0207704_10492505 | 3300025938 | Bacteria | 986 |
| 225 | Ga0207691_10002319 | 3300025940 | Bacteria | 18634 |
| 226 | Ga0207691_10007470 | 3300025940 | Bacteria | 10522 |
| 227 | Ga0207691_10176068 | 3300025940 | Bacteria | 1871 |
| 228 | Ga0207711_10055649 | 3300025941 | Bacteria | 3397 |
| 229 | Ga0207711_10292091 | 3300025941 | Bacteria | 1503 |
| 230 | Ga0207711_10605380 | 3300025941 | Bacteria | 1022 |
| 231 | Ga0207711_10654176 | 3300025941 | Bacteria | 980 |
| 232 | Ga0207689_10002027 | 3300025942 | Bacteria | 19152 |
| 233 | Ga0207689_10015770 | 3300025942 | Bacteria | 6396 |
| 234 | Ga0207689_10108601 | 3300025942 | Bacteria | 2280 |
| 235 | Ga0207689_10140367 | 3300025942 | Bacteria | 1990 |
| 236 | Ga0207661_10253145 | 3300025944 | Bacteria | 1566 |
| 237 | Ga0207679_10060971 | 3300025945 | Bacteria | 2806 |
| 238 | Ga0207679_10114116 | 3300025945 | Unclassified | 2138 |
| 239 | Ga0207679_10122617 | 3300025945 | Unclassified | 2072 |
| 240 | Ga0207679_10167211 | 3300025945 | Bacteria | 1807 |
| 241 | Ga0207679_10171128 | 3300025945 | Bacteria | 1788 |
| 242 | Ga0207679_10727872 | 3300025945 | Bacteria | 901 |
| 243 | Ga0207667_10001650 | 3300025949 | Bacteria | 28122 |
| 244 | Ga0207667_10041856 | 3300025949 | Bacteria | 4871 |
| 245 | Ga0207667_10362852 | 3300025949 | Bacteria | 1477 |
| 246 | Ga0207651_10002768 | 3300025960 | Bacteria | 8419 |
| 247 | Ga0207712_10110280 | 3300025961 | Bacteria | 2063 |
| 248 | Ga0207668_10003511 | 3300025972 | Bacteria | 9210 |
| 249 | Ga0207668_10034569 | 3300025972 | Bacteria | 3358 |
| 250 | Ga0207668_10293871 | 3300025972 | Bacteria | 1338 |
| 251 | Ga0207668_10360456 | 3300025972 | Bacteria | 1218 |
| 252 | Ga0207640_10226860 | 3300025981 | Bacteria | 1434 |
| 253 | Ga0207658_10016999 | 3300025986 | Bacteria | 5007 |
| 254 | Ga0207658_10413417 | 3300025986 | Bacteria | 1188 |
| 255 | Ga0207677_10016865 | 3300026023 | Bacteria | 4338 |
| 256 | Ga0207703_10053155 | 3300026035 | Bacteria | 3292 |
| 257 | Ga0207639_10452644 | 3300026041 | Unclassified | 1166 |
| 258 | Ga0207678_10031110 | 3300026067 | Bacteria | 4657 |
| 259 | Ga0207708_10022848 | 3300026075 | Bacteria | 4723 |
| 260 | Ga0207702_10061796 | 3300026078 | Bacteria | 3197 |
| 261 | Ga0207702_10117036 | 3300026078 | Bacteria | 2379 |
| 262 | Ga0207641_10047179 | 3300026088 | Bacteria | 3632 |
| 263 | Ga0207641_10125123 | 3300026088 | Bacteria | 2300 |
| 264 | Ga0207641_10366367 | 3300026088 | Bacteria | 1377 |
| 265 | Ga0207641_10662987 | 3300026088 | Bacteria | 1025 |
| 266 | Ga0207648_10000040 | 3300026089 | Bacteria | 116539 |
| 267 | Ga0207648_10014343 | 3300026089 | Bacteria | 7325 |
| 268 | Ga0207648_10040680 | 3300026089 | Bacteria | 4084 |
| 269 | Ga0207648_10042847 | 3300026089 | Bacteria | 3974 |
| 270 | Ga0207648_10044545 | 3300026089 | Bacteria | 3892 |
| 271 | Ga0207648_10125415 | 3300026089 | Unclassified | 2259 |
| 272 | Ga0207648_10523264 | 3300026089 | Unclassified | 1087 |
| 273 | Ga0207676_10016326 | 3300026095 | Bacteria | 5377 |
| 274 | Ga0207676_10075643 | 3300026095 | Bacteria | 2717 |
| 275 | Ga0207674_10008315 | 3300026116 | Bacteria | 12009 |
| 276 | Ga0207674_10220429 | 3300026116 | Bacteria | 1845 |
| 277 | Ga0207675_100005676 | 3300026118 | Bacteria | 11943 |
| 278 | Ga0207675_100029581 | 3300026118 | Bacteria | 5103 |
| 279 | Ga0207675_100231523 | 3300026118 | Bacteria | 1783 |
| 280 | Ga0207683_10009050 | 3300026121 | Bacteria | 8487 |
| 281 | Ga0207683_10251262 | 3300026121 | Bacteria | 1614 |
| 282 | Ga0207698_10137499 | 3300026142 | Bacteria | 2099 |
| 283 | Ga0207698_10177966 | 3300026142 | Bacteria | 1880 |
| 284 | Ga0207698_10616957 | 3300026142 | Bacteria | 1071 |
| 285 | Ga0268266_10293508 | 3300028379 | Bacteria | 1515 |
| 286 | Ga0268265_10035927 | 3300028380 | Bacteria | 3625 |
| 287 | Ga0268265_10112568 | 3300028380 | Bacteria | 2225 |
| 288 | Ga0268265_10145085 | 3300028380 | Unclassified | 1993 |
| 289 | Ga0268264_10006512 | 3300028381 | Bacteria | 9835 |
| 290 | Ga0268264_10506748 | 3300028381 | Bacteria | 1178 |
| 291 | Ga0268264_10556712 | 3300028381 | Bacteria | 1125 |
| 292 | Ga0307515_10000089 | 3300028794 | Bacteria | 215736 |
| 293 | Ga0307515_10015292 | 3300028794 | Bacteria | 14149 |
| 294 | Ga0265328_10000916 | 3300031239 | Bacteria | 13610 |
| 295 | Ga0265316_10463128 | 3300031344 | Bacteria | 908 |
| 296 | Ga0307513_10025908 | 3300031456 | Bacteria | 6775 |
| 297 | Ga0307514_10000947 | 3300031649 | Bacteria | 43838 |
| 298 | Ga0307412_10712258 | 3300031911 | Bacteria | 863 |
| 299 | Ga0307409_100986425 | 3300031995 | Bacteria | 860 |
| 300 | Ga0373924_0007675 | 3300035410 | Bacteria | 3899 |
| 301 | Ga0373937_0156612 | 3300036401 | Bacteria | 2135 |
| 302 | Ga0373937_0239417 | 3300036401 | Bacteria | 1710 |
| 303 | Ga0395905_0055832 | 3300037471 | Bacteria | 3696 |
| 304 | Ga0436361_0192271 | 3300039447 | Bacteria | 8176 |
| 305 | Ga0436361_0708614 | 3300039447 | Bacteria | 59038 |
| 306 | Ga0436361_0709643 | 3300039447 | Bacteria | 1339 |
| 307 | Ga0436361_1127912 | 3300039447 | Bacteria | 46645 |
| 308 | Ga0451802_1268127 | 3300041460 | Bacteria | 1877 |
| 309 | Ga0451853_3615062 | 3300041512 | Bacteria | 954 |
| 310 | Ga0439454_018738 | 3300042011 | Bacteria | 1000 |
| 311 | Ga0450890_000450 | 3300042127 | Bacteria | 6000 |
| 312 | Ga0439459_0001156 | 3300042438 | Bacteria | 3832 |
| 313 | Ga0439460_0121641 | 3300042461 | Bacteria | 854 |
| 314 | Ga0451577_0006231 | 3300042876 | Bacteria | 11962 |
| 315 | Ga0451577_0092636 | 3300042876 | Bacteria | 2698 |
| 316 | Ga0451577_0454110 | 3300042876 | Bacteria | 1164 |
| 317 | Ga0466972_0019283 | 3300044658 | Bacteria | 3411 |
| 318 | Ga0453683_0011533 | 3300044673 | Bacteria | 5823 |
| 319 | Ga0466965_0102346 | 3300044683 | Bacteria | 1465 |
| 320 | Ga0453684_0000965 | 3300044712 | Bacteria | 94813 |
| 321 | Ga0453684_0021172 | 3300044712 | Bacteria | 9737 |
| 322 | Ga0453684_0654035 | 3300044712 | Bacteria | 1146 |
| 323 | Ga0466970_0056634 | 3300044765 | Bacteria | 2095 |
| 324 | Ga0466959_0211724 | 3300045049 | Bacteria | 1347 |
| 325 | Ga0451576_0007353 | 3300045051 | Bacteria | 13200 |
| 326 | Ga0451576_0163478 | 3300045051 | Bacteria | 2323 |
| 327 | Ga0495580_0433139 | 3300046472 | Bacteria | 884 |
| 328 | Ga0495654_0018873 | 3300046530 | Unclassified | 3609 |
| 329 | Ga0495686_0001317 | 3300047472 | Bacteria | 27841 |
| 330 | Ga0496102_0004606 | 3300048905 | Bacteria | 11667 |
| 331 | Ga0496109_0477062 | 3300048912 | Bacteria | 1178 |
| 332 | Ga0496124_0021113 | 3300048927 | Bacteria | 6005 |
| 333 | Ga0496125_0005139 | 3300048928 | Bacteria | 14720 |
| 334 | Ga0496126_0128479 | 3300048929 | Bacteria | 2191 |
| 335 | Ga0501043_0000128 | 3300049579 | Bacteria | 70511 |
| 336 | Ga0501046_0000090 | 3300049580 | Bacteria | 98195 |
| 337 | Ga0501047_0000062 | 3300049581 | Bacteria | 137218 |
| 338 | Ga0501048_0002949 | 3300049582 | Bacteria | 13004 |
| 339 | Ga0501035_0030169 | 3300049822 | Bacteria | 4944 |
| 340 | Ga0501045_0002367 | 3300049824 | Bacteria | 12797 |
| 341 | nmdc:mga0k408_4455_c1 | 3300050493 | Bacteria | 7434 |
| 342 | nmdc:mga07m45_6590_c1 | 3300050496 | Bacteria | 5883 |
| 343 | nmdc:mga0qj67_229688_c1 | 3300050509 | Bacteria | 1506 |
| 344 | nmdc:mga08y16_959165_c1 | 3300050511 | Bacteria | 838 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006195 | Ga0075366_10000995 | Ga0075366_100009957 | 198 |
| 2 | 3300050493 | nmdc:mga0k408_4455_c1 | nmdc:mga0k408_4455_c1_1825_2442 | 198 |
| 3 | 3300044712 | Ga0453684_0000965 | Ga0453684_0000965_59240_59860 | 199 |
| 4 | 3300021361 | Ga0213872_10000053 | Ga0213872_1000005343 | 200 |
| 5 | 3300021361 | Ga0213872_10119032 | Ga0213872_101190322 | 200 |
| 6 | 3300039447 | Ga0436361_0708614 | Ga0436361_0708614_27002_27619 | 200 |
| 7 | 3300039447 | Ga0436361_0709643 | Ga0436361_0709643_478_1095 | 200 |
| 8 | 3300005334 | Ga0068869_100093003 | Ga0068869_1000930032 | 201 |
| 9 | 3300005338 | Ga0068868_100096500 | Ga0068868_1000965002 | 201 |
| 10 | 3300005354 | Ga0070675_100626268 | Ga0070675_1006262681 | 201 |
| 11 | 3300005543 | Ga0070672_100157346 | Ga0070672_1001573462 | 201 |
| 12 | 3300006881 | Ga0068865_100158154 | Ga0068865_1001581542 | 201 |
| 13 | 3300011119 | Ga0105246_10431182 | Ga0105246_104311821 | 201 |
| 14 | 3300025907 | Ga0207645_10155456 | Ga0207645_101554561 | 201 |
| 15 | 3300025926 | Ga0207659_10659483 | Ga0207659_106594831 | 201 |
| 16 | 3300025940 | Ga0207691_10176068 | Ga0207691_101760681 | 201 |
| 17 | 3300025942 | Ga0207689_10108601 | Ga0207689_101086012 | 201 |
| 18 | 3300026089 | Ga0207648_10014343 | Ga0207648_100143433 | 201 |
| 19 | iso_pu_bacteria | 2643221592 | 2643971151 | 201 |
| 20 | iso_pu_bacteria | 2643221625 | 2644142083 | 201 |
| 21 | iso_pu_bacteria | 2643221648 | 2644276308 | 201 |
| 22 | 3300005549 | Ga0070704_100756762 | Ga0070704_1007567621 | 202 |
| 23 | 3300005564 | Ga0070664_100676443 | Ga0070664_1006764432 | 202 |
| 24 | 3300025927 | Ga0207687_10292173 | Ga0207687_102921731 | 202 |
| 25 | 3300031344 | Ga0265316_10463128 | Ga0265316_104631281 | 202 |
| 26 | 3300031911 | Ga0307412_10712258 | Ga0307412_107122581 | 202 |
| 27 | iso_pu_bacteria | 2891633521 | 2891635401 | 202 |
| 28 | 3300003320 | rootH2_10047099 | rootH2_100470992 | 203 |
| 29 | 3300003322 | rootL2_10000057 | rootL2_1000005742 | 203 |
| 30 | 3300003323 | rootH1_10012740 | rootH1_100127405 | 203 |
| 31 | 3300003775 | Ga0055524_1002178 | Ga0055524_10021784 | 203 |
| 32 | 3300003775 | Ga0055524_1006904 | Ga0055524_10069042 | 203 |
| 33 | 3300005543 | Ga0070672_100615353 | Ga0070672_1006153532 | 203 |
| 34 | 3300006353 | Ga0075370_10008714 | Ga0075370_100087141 | 203 |
| 35 | 3300012497 | Ga0157319_1000001 | Ga0157319_1000001261 | 203 |
| 36 | 3300025273 | Ga0209673_1005099 | Ga0209673_10050995 | 203 |
| 37 | 3300025298 | Ga0209050_1002952 | Ga0209050_10029523 | 203 |
| 38 | 3300025299 | Ga0209256_1000742 | Ga0209256_100074236 | 203 |
| 39 | 3300025299 | Ga0209256_1003850 | Ga0209256_10038505 | 203 |
| 40 | 3300025303 | Ga0209051_1000963 | Ga0209051_100096328 | 203 |
| 41 | 3300025304 | Ga0209257_1001410 | Ga0209257_100141018 | 203 |
| 42 | 3300025304 | Ga0209257_1004445 | Ga0209257_10044456 | 203 |
| 43 | 3300042011 | Ga0439454_018738 | Ga0439454_018738_72_710 | 203 |
| 44 | 3300042127 | Ga0450890_000450 | Ga0450890_000450_879_1517 | 203 |
| 45 | 3300042438 | Ga0439459_0001156 | Ga0439459_0001156_204_842 | 203 |
| 46 | 3300042876 | Ga0451577_0092636 | Ga0451577_0092636_1708_2328 | 203 |
| 47 | 3300048927 | Ga0496124_0021113 | Ga0496124_0021113_3563_4201 | 203 |
| 48 | 3300050496 | nmdc:mga07m45_6590_c1 | nmdc:mga07m45_6590_c1_175_813 | 203 |
| 49 | iso_pu_bacteria | 2831864461 | 2831866523 | 203 |
| 50 | iso_pu_bacteria | 2886848708 | 2886852653 | 203 |
| 51 | 3300005355 | Ga0070671_100290364 | Ga0070671_1002903642 | 204 |
| 52 | 3300005367 | Ga0070667_100264239 | Ga0070667_1002642391 | 204 |
| 53 | 3300005543 | Ga0070672_100099159 | Ga0070672_1000991592 | 204 |
| 54 | 3300005548 | Ga0070665_100658039 | Ga0070665_1006580391 | 204 |
| 55 | 3300005548 | Ga0070665_100805566 | Ga0070665_1008055662 | 204 |
| 56 | 3300005564 | Ga0070664_100031902 | Ga0070664_1000319023 | 204 |
| 57 | 3300005841 | Ga0068863_100032064 | Ga0068863_1000320644 | 204 |
| 58 | 3300005843 | Ga0068860_100744767 | Ga0068860_1007447672 | 204 |
| 59 | 3300025899 | Ga0207642_10113671 | Ga0207642_101136712 | 204 |
| 60 | 3300025901 | Ga0207688_10125669 | Ga0207688_101256692 | 204 |
| 61 | 3300025903 | Ga0207680_10126995 | Ga0207680_101269951 | 204 |
| 62 | 3300025907 | Ga0207645_10010387 | Ga0207645_100103872 | 204 |
| 63 | 3300025909 | Ga0207705_10339670 | Ga0207705_103396701 | 204 |
| 64 | 3300025913 | Ga0207695_10043772 | Ga0207695_100437723 | 204 |
| 65 | 3300025914 | Ga0207671_10003589 | Ga0207671_100035894 | 204 |
| 66 | 3300025926 | Ga0207659_10226653 | Ga0207659_102266532 | 204 |
| 67 | 3300025933 | Ga0207706_10589026 | Ga0207706_105890261 | 204 |
| 68 | 3300025940 | Ga0207691_10007470 | Ga0207691_100074708 | 204 |
| 69 | 3300025941 | Ga0207711_10292091 | Ga0207711_102920911 | 204 |
| 70 | 3300025941 | Ga0207711_10654176 | Ga0207711_106541761 | 204 |
| 71 | 3300025942 | Ga0207689_10140367 | Ga0207689_101403672 | 204 |
| 72 | 3300025944 | Ga0207661_10253145 | Ga0207661_102531452 | 204 |
| 73 | 3300025972 | Ga0207668_10034569 | Ga0207668_100345693 | 204 |
| 74 | 3300026088 | Ga0207641_10662987 | Ga0207641_106629871 | 204 |
| 75 | 3300026089 | Ga0207648_10040680 | Ga0207648_100406803 | 204 |
| 76 | 3300026121 | Ga0207683_10251262 | Ga0207683_102512622 | 204 |
| 77 | 3300026142 | Ga0207698_10137499 | Ga0207698_101374992 | 204 |
| 78 | 3300028379 | Ga0268266_10293508 | Ga0268266_102935082 | 204 |
| 79 | 3300028794 | Ga0307515_10015292 | Ga0307515_100152926 | 204 |
| 80 | 3300031456 | Ga0307513_10025908 | Ga0307513_100259082 | 204 |
| 81 | 3300031649 | Ga0307514_10000947 | Ga0307514_100009475 | 204 |
| 82 | 3300047472 | Ga0495686_0001317 | Ga0495686_0001317_23925_24554 | 204 |
| 83 | 3300042461 | Ga0439460_0121641 | Ga0439460_0121641_120_749 | 205 |
| 84 | 3300042876 | Ga0451577_0006231 | Ga0451577_0006231_4447_5076 | 205 |
| 85 | 3300042876 | Ga0451577_0454110 | Ga0451577_0454110_128_754 | 205 |
| 86 | 3300044673 | Ga0453683_0011533 | Ga0453683_0011533_596_1225 | 205 |
| 87 | 3300044712 | Ga0453684_0021172 | Ga0453684_0021172_6227_6856 | 205 |
| 88 | 3300044712 | Ga0453684_0654035 | Ga0453684_0654035_375_1004 | 205 |
| 89 | 3300045051 | Ga0451576_0007353 | Ga0451576_0007353_2664_3293 | 205 |
| 90 | 3300005331 | Ga0070670_100071084 | Ga0070670_1000710842 | 206 |
| 91 | 3300005335 | Ga0070666_10559713 | Ga0070666_105597131 | 206 |
| 92 | 3300005353 | Ga0070669_100015448 | Ga0070669_1000154482 | 206 |
| 93 | 3300005354 | Ga0070675_100084702 | Ga0070675_1000847022 | 206 |
| 94 | 3300005355 | Ga0070671_100159067 | Ga0070671_1001590672 | 206 |
| 95 | 3300005355 | Ga0070671_100567026 | Ga0070671_1005670261 | 206 |
| 96 | 3300005356 | Ga0070674_100278980 | Ga0070674_1002789802 | 206 |
| 97 | 3300005457 | Ga0070662_100011957 | Ga0070662_1000119573 | 206 |
| 98 | 3300005459 | Ga0068867_100030746 | Ga0068867_1000307462 | 206 |
| 99 | 3300005543 | Ga0070672_100003665 | Ga0070672_1000036652 | 206 |
| 100 | 3300005618 | Ga0068864_100077888 | Ga0068864_1000778883 | 206 |
| 101 | 3300005719 | Ga0068861_100025451 | Ga0068861_1000254514 | 206 |
| 102 | 3300005843 | Ga0068860_100019553 | Ga0068860_1000195533 | 206 |
| 103 | 3300006237 | Ga0097621_100211128 | Ga0097621_1002111282 | 206 |
| 104 | 3300009177 | Ga0105248_10052132 | Ga0105248_100521323 | 206 |
| 105 | 3300013296 | Ga0157374_10608911 | Ga0157374_106089111 | 206 |
| 106 | 3300013306 | Ga0163162_10007895 | Ga0163162_100078954 | 206 |
| 107 | 3300013308 | Ga0157375_10003600 | Ga0157375_100036007 | 206 |
| 108 | 3300014325 | Ga0163163_10118632 | Ga0163163_101186321 | 206 |
| 109 | 3300014326 | Ga0157380_10008997 | Ga0157380_100089973 | 206 |
| 110 | 3300014969 | Ga0157376_10086194 | Ga0157376_100861942 | 206 |
| 111 | 3300017792 | Ga0163161_10030196 | Ga0163161_100301963 | 206 |
| 112 | 3300025893 | Ga0207682_10033710 | Ga0207682_100337101 | 206 |
| 113 | 3300025903 | Ga0207680_10517032 | Ga0207680_105170321 | 206 |
| 114 | 3300025925 | Ga0207650_10011462 | Ga0207650_100114621 | 206 |
| 115 | 3300025925 | Ga0207650_10097715 | Ga0207650_100977152 | 206 |
| 116 | 3300025926 | Ga0207659_10040560 | Ga0207659_100405601 | 206 |
| 117 | 3300025931 | Ga0207644_10165911 | Ga0207644_101659112 | 206 |
| 118 | 3300025933 | Ga0207706_10009362 | Ga0207706_100093623 | 206 |
| 119 | 3300025937 | Ga0207669_10586118 | Ga0207669_105861181 | 206 |
| 120 | 3300025940 | Ga0207691_10002319 | Ga0207691_100023192 | 206 |
| 121 | 3300025941 | Ga0207711_10605380 | Ga0207711_106053802 | 206 |
| 122 | 3300025960 | Ga0207651_10002768 | Ga0207651_100027685 | 206 |
| 123 | 3300025972 | Ga0207668_10003511 | Ga0207668_100035114 | 206 |
| 124 | 3300026088 | Ga0207641_10047179 | Ga0207641_100471792 | 206 |
| 125 | 3300026089 | Ga0207648_10044545 | Ga0207648_100445452 | 206 |
| 126 | 3300026095 | Ga0207676_10016326 | Ga0207676_100163264 | 206 |
| 127 | 3300026095 | Ga0207676_10075643 | Ga0207676_100756433 | 206 |
| 128 | 3300026118 | Ga0207675_100005676 | Ga0207675_1000056767 | 206 |
| 129 | 3300026142 | Ga0207698_10616957 | Ga0207698_106169571 | 206 |
| 130 | 3300028381 | Ga0268264_10006512 | Ga0268264_100065124 | 206 |
| 131 | 3300028794 | Ga0307515_10000089 | Ga0307515_1000008992 | 206 |
| 132 | 3300039447 | Ga0436361_0192271 | Ga0436361_0192271_3908_4546 | 206 |
| 133 | 3300039447 | Ga0436361_1127912 | Ga0436361_1127912_28142_28819 | 206 |
| 134 | 3300045051 | Ga0451576_0163478 | Ga0451576_0163478_379_1014 | 206 |
| 135 | 3300005331 | Ga0070670_100015131 | Ga0070670_1000151314 | 207 |
| 136 | 3300005333 | Ga0070677_10108467 | Ga0070677_101084671 | 207 |
| 137 | 3300005335 | Ga0070666_10399636 | Ga0070666_103996362 | 207 |
| 138 | 3300005347 | Ga0070668_100081732 | Ga0070668_1000817322 | 207 |
| 139 | 3300005347 | Ga0070668_100247082 | Ga0070668_1002470821 | 207 |
| 140 | 3300005347 | Ga0070668_100613234 | Ga0070668_1006132341 | 207 |
| 141 | 3300005353 | Ga0070669_100329545 | Ga0070669_1003295452 | 207 |
| 142 | 3300005354 | Ga0070675_100035842 | Ga0070675_1000358422 | 207 |
| 143 | 3300005354 | Ga0070675_100046368 | Ga0070675_1000463681 | 207 |
| 144 | 3300005356 | Ga0070674_100024834 | Ga0070674_1000248344 | 207 |
| 145 | 3300005364 | Ga0070673_100037871 | Ga0070673_1000378713 | 207 |
| 146 | 3300005365 | Ga0070688_100183938 | Ga0070688_1001839382 | 207 |
| 147 | 3300005440 | Ga0070705_100060278 | Ga0070705_1000602782 | 207 |
| 148 | 3300005441 | Ga0070700_100027108 | Ga0070700_1000271082 | 207 |
| 149 | 3300005456 | Ga0070678_100291464 | Ga0070678_1002914642 | 207 |
| 150 | 3300005458 | Ga0070681_10065791 | Ga0070681_100657912 | 207 |
| 151 | 3300005459 | Ga0068867_100029685 | Ga0068867_1000296851 | 207 |
| 152 | 3300005543 | Ga0070672_100448651 | Ga0070672_1004486512 | 207 |
| 153 | 3300005544 | Ga0070686_100120880 | Ga0070686_1001208801 | 207 |
| 154 | 3300005545 | Ga0070695_100767235 | Ga0070695_1007672351 | 207 |
| 155 | 3300005563 | Ga0068855_100108629 | Ga0068855_1001086293 | 207 |
| 156 | 3300005564 | Ga0070664_100010341 | Ga0070664_1000103413 | 207 |
| 157 | 3300005564 | Ga0070664_100257988 | Ga0070664_1002579882 | 207 |
| 158 | 3300005617 | Ga0068859_100018647 | Ga0068859_1000186476 | 207 |
| 159 | 3300005618 | Ga0068864_100020534 | Ga0068864_1000205344 | 207 |
| 160 | 3300005618 | Ga0068864_100035566 | Ga0068864_1000355661 | 207 |
| 161 | 3300005719 | Ga0068861_100335168 | Ga0068861_1003351682 | 207 |
| 162 | 3300005840 | Ga0068870_10032402 | Ga0068870_100324022 | 207 |
| 163 | 3300005841 | Ga0068863_100041398 | Ga0068863_1000413984 | 207 |
| 164 | 3300005841 | Ga0068863_100096643 | Ga0068863_1000966433 | 207 |
| 165 | 3300005842 | Ga0068858_100236456 | Ga0068858_1002364562 | 207 |
| 166 | 3300005843 | Ga0068860_100280002 | Ga0068860_1002800022 | 207 |
| 167 | 3300005844 | Ga0068862_100013386 | Ga0068862_1000133864 | 207 |
| 168 | 3300005844 | Ga0068862_100103523 | Ga0068862_1001035232 | 207 |
| 169 | 3300005844 | Ga0068862_100276746 | Ga0068862_1002767462 | 207 |
| 170 | 3300005844 | Ga0068862_101093812 | Ga0068862_1010938121 | 207 |
| 171 | 3300006195 | Ga0075366_10043208 | Ga0075366_100432082 | 207 |
| 172 | 3300006237 | Ga0097621_100187984 | Ga0097621_1001879842 | 207 |
| 173 | 3300006846 | Ga0075430_100049176 | Ga0075430_1000491764 | 207 |
| 174 | 3300006881 | Ga0068865_100195969 | Ga0068865_1001959693 | 207 |
| 175 | 3300006931 | Ga0097620_100018647 | Ga0097620_1000186476 | 207 |
| 176 | 3300009148 | Ga0105243_10006785 | Ga0105243_100067857 | 207 |
| 177 | 3300009148 | Ga0105243_10023002 | Ga0105243_100230022 | 207 |
| 178 | 3300009176 | Ga0105242_10059814 | Ga0105242_100598143 | 207 |
| 179 | 3300009176 | Ga0105242_10422588 | Ga0105242_104225882 | 207 |
| 180 | 3300009177 | Ga0105248_10065961 | Ga0105248_100659613 | 207 |
| 181 | 3300009553 | Ga0105249_10018110 | Ga0105249_100181104 | 207 |
| 182 | 3300013105 | Ga0157369_10381008 | Ga0157369_103810082 | 207 |
| 183 | 3300013297 | Ga0157378_10017946 | Ga0157378_100179462 | 207 |
| 184 | 3300013306 | Ga0163162_10165687 | Ga0163162_101656872 | 207 |
| 185 | 3300014325 | Ga0163163_10066691 | Ga0163163_100666913 | 207 |
| 186 | 3300014325 | Ga0163163_10781437 | Ga0163163_107814372 | 207 |
| 187 | 3300014326 | Ga0157380_10051090 | Ga0157380_100510903 | 207 |
| 188 | 3300014969 | Ga0157376_10009209 | Ga0157376_100092094 | 207 |
| 189 | 3300014969 | Ga0157376_10728616 | Ga0157376_107286161 | 207 |
| 190 | 3300017792 | Ga0163161_10529742 | Ga0163161_105297422 | 207 |
| 191 | 3300025315 | Ga0207697_10021208 | Ga0207697_100212082 | 207 |
| 192 | 3300025893 | Ga0207682_10019372 | Ga0207682_100193723 | 207 |
| 193 | 3300025907 | Ga0207645_10183202 | Ga0207645_101832021 | 207 |
| 194 | 3300025908 | Ga0207643_10003370 | Ga0207643_100033707 | 207 |
| 195 | 3300025923 | Ga0207681_10104353 | Ga0207681_101043531 | 207 |
| 196 | 3300025923 | Ga0207681_10130666 | Ga0207681_101306662 | 207 |
| 197 | 3300025925 | Ga0207650_10009727 | Ga0207650_100097274 | 207 |
| 198 | 3300025926 | Ga0207659_10027501 | Ga0207659_100275012 | 207 |
| 199 | 3300025926 | Ga0207659_10334213 | Ga0207659_103342132 | 207 |
| 200 | 3300025928 | Ga0207700_10000355 | Ga0207700_100003554 | 207 |
| 201 | 3300025934 | Ga0207686_10023996 | Ga0207686_100239963 | 207 |
| 202 | 3300025935 | Ga0207709_10090308 | Ga0207709_100903082 | 207 |
| 203 | 3300025938 | Ga0207704_10492505 | Ga0207704_104925051 | 207 |
| 204 | 3300025942 | Ga0207689_10002027 | Ga0207689_1000202711 | 207 |
| 205 | 3300025945 | Ga0207679_10122617 | Ga0207679_101226171 | 207 |
| 206 | 3300025945 | Ga0207679_10171128 | Ga0207679_101711282 | 207 |
| 207 | 3300025949 | Ga0207667_10362852 | Ga0207667_103628521 | 207 |
| 208 | 3300025961 | Ga0207712_10110280 | Ga0207712_101102801 | 207 |
| 209 | 3300025972 | Ga0207668_10360456 | Ga0207668_103604562 | 207 |
| 210 | 3300026035 | Ga0207703_10053155 | Ga0207703_100531553 | 207 |
| 211 | 3300026075 | Ga0207708_10022848 | Ga0207708_100228484 | 207 |
| 212 | 3300026088 | Ga0207641_10125123 | Ga0207641_101251231 | 207 |
| 213 | 3300026089 | Ga0207648_10042847 | Ga0207648_100428471 | 207 |
| 214 | 3300026118 | Ga0207675_100029581 | Ga0207675_1000295814 | 207 |
| 215 | 3300026121 | Ga0207683_10009050 | Ga0207683_100090504 | 207 |
| 216 | 3300028380 | Ga0268265_10112568 | Ga0268265_101125682 | 207 |
| 217 | 3300028380 | Ga0268265_10145085 | Ga0268265_101450852 | 207 |
| 218 | 3300028381 | Ga0268264_10556712 | Ga0268264_105567122 | 207 |
| 219 | 3300041512 | Ga0451853_3615062 | Ga0451853_3615062_120_758 | 207 |
| 220 | 3300049822 | Ga0501035_0030169 | Ga0501035_0030169_3373_4011 | 207 |
| 221 | 3300050509 | nmdc:mga0qj67_229688_c1 | nmdc:mga0qj67_229688_c1_620_1252 | 207 |
| 222 | 3300050511 | nmdc:mga08y16_959165_c1 | nmdc:mga08y16_959165_c1_98_730 | 207 |
| 223 | 3300005327 | Ga0070658_10958581 | Ga0070658_109585811 | 208 |
| 224 | 3300005334 | Ga0068869_100022088 | Ga0068869_1000220885 | 208 |
| 225 | 3300005337 | Ga0070682_100100774 | Ga0070682_1001007741 | 208 |
| 226 | 3300005338 | Ga0068868_100026934 | Ga0068868_1000269342 | 208 |
| 227 | 3300005354 | Ga0070675_100024429 | Ga0070675_1000244292 | 208 |
| 228 | 3300005367 | Ga0070667_100366822 | Ga0070667_1003668222 | 208 |
| 229 | 3300005435 | Ga0070714_100031454 | Ga0070714_1000314542 | 208 |
| 230 | 3300005459 | Ga0068867_100491527 | Ga0068867_1004915271 | 208 |
| 231 | 3300005530 | Ga0070679_100195692 | Ga0070679_1001956921 | 208 |
| 232 | 3300005535 | Ga0070684_100540326 | Ga0070684_1005403261 | 208 |
| 233 | 3300005563 | Ga0068855_100697734 | Ga0068855_1006977341 | 208 |
| 234 | 3300005564 | Ga0070664_100039307 | Ga0070664_1000393073 | 208 |
| 235 | 3300005577 | Ga0068857_100016049 | Ga0068857_1000160495 | 208 |
| 236 | 3300005614 | Ga0068856_100061947 | Ga0068856_1000619475 | 208 |
| 237 | 3300005843 | Ga0068860_100179010 | Ga0068860_1001790102 | 208 |
| 238 | 3300005844 | Ga0068862_100003630 | Ga0068862_10000363010 | 208 |
| 239 | 3300005844 | Ga0068862_100352888 | Ga0068862_1003528881 | 208 |
| 240 | 3300005844 | Ga0068862_101335985 | Ga0068862_1013359851 | 208 |
| 241 | 3300006195 | Ga0075366_10289624 | Ga0075366_102896242 | 208 |
| 242 | 3300006358 | Ga0068871_100153347 | Ga0068871_1001533472 | 208 |
| 243 | 3300006846 | Ga0075430_100206486 | Ga0075430_1002064862 | 208 |
| 244 | 3300006931 | Ga0097620_100031378 | Ga0097620_1000313781 | 208 |
| 245 | 3300009093 | Ga0105240_10061433 | Ga0105240_100614332 | 208 |
| 246 | 3300009551 | Ga0105238_10000971 | Ga0105238_100009711 | 208 |
| 247 | 3300013100 | Ga0157373_10032438 | Ga0157373_100324381 | 208 |
| 248 | 3300013104 | Ga0157370_10297879 | Ga0157370_102978792 | 208 |
| 249 | 3300013105 | Ga0157369_10033215 | Ga0157369_100332154 | 208 |
| 250 | 3300014968 | Ga0157379_10072908 | Ga0157379_100729082 | 208 |
| 251 | 3300025911 | Ga0207654_10425749 | Ga0207654_104257491 | 208 |
| 252 | 3300025913 | Ga0207695_10058590 | Ga0207695_100585904 | 208 |
| 253 | 3300025919 | Ga0207657_10118723 | Ga0207657_101187231 | 208 |
| 254 | 3300025920 | Ga0207649_10014844 | Ga0207649_100148443 | 208 |
| 255 | 3300025921 | Ga0207652_10231568 | Ga0207652_102315682 | 208 |
| 256 | 3300025924 | Ga0207694_10101375 | Ga0207694_101013751 | 208 |
| 257 | 3300025927 | Ga0207687_10547205 | Ga0207687_105472051 | 208 |
| 258 | 3300025938 | Ga0207704_10409915 | Ga0207704_104099152 | 208 |
| 259 | 3300025941 | Ga0207711_10055649 | Ga0207711_100556491 | 208 |
| 260 | 3300025942 | Ga0207689_10015770 | Ga0207689_100157701 | 208 |
| 261 | 3300025945 | Ga0207679_10114116 | Ga0207679_101141163 | 208 |
| 262 | 3300025949 | Ga0207667_10041856 | Ga0207667_100418564 | 208 |
| 263 | 3300025981 | Ga0207640_10226860 | Ga0207640_102268602 | 208 |
| 264 | 3300025986 | Ga0207658_10413417 | Ga0207658_104134171 | 208 |
| 265 | 3300026023 | Ga0207677_10016865 | Ga0207677_100168652 | 208 |
| 266 | 3300026078 | Ga0207702_10061796 | Ga0207702_100617962 | 208 |
| 267 | 3300026078 | Ga0207702_10117036 | Ga0207702_101170363 | 208 |
| 268 | 3300026088 | Ga0207641_10366367 | Ga0207641_103663672 | 208 |
| 269 | 3300026089 | Ga0207648_10523264 | Ga0207648_105232641 | 208 |
| 270 | 3300026116 | Ga0207674_10008315 | Ga0207674_100083153 | 208 |
| 271 | 3300026118 | Ga0207675_100231523 | Ga0207675_1002315231 | 208 |
| 272 | 3300028380 | Ga0268265_10035927 | Ga0268265_100359272 | 208 |
| 273 | 3300035410 | Ga0373924_0007675 | Ga0373924_0007675_2583_3302 | 208 |
| 274 | 3300048912 | Ga0496109_0477062 | Ga0496109_0477062_103_741 | 208 |
| 275 | 3300005366 | Ga0070659_100160471 | Ga0070659_1001604712 | 209 |
| 276 | 3300005564 | Ga0070664_100026396 | Ga0070664_1000263961 | 209 |
| 277 | 3300005564 | Ga0070664_100044966 | Ga0070664_1000449664 | 209 |
| 278 | 3300013105 | Ga0157369_10393273 | Ga0157369_103932732 | 209 |
| 279 | 3300013307 | Ga0157372_10089607 | Ga0157372_100896073 | 209 |
| 280 | 3300025919 | Ga0207657_10528675 | Ga0207657_105286751 | 209 |
| 281 | 3300025932 | Ga0207690_10071025 | Ga0207690_100710252 | 209 |
| 282 | 3300025945 | Ga0207679_10060971 | Ga0207679_100609712 | 209 |
| 283 | 3300025945 | Ga0207679_10167211 | Ga0207679_101672112 | 209 |
| 284 | 3300005439 | Ga0070711_100128709 | Ga0070711_1001287092 | 210 |
| 285 | 3300005564 | Ga0070664_100564047 | Ga0070664_1005640472 | 210 |
| 286 | 3300006175 | Ga0070712_100126498 | Ga0070712_1001264981 | 210 |
| 287 | 3300025916 | Ga0207663_10275515 | Ga0207663_102755152 | 210 |
| 288 | 3300025931 | Ga0207644_10130993 | Ga0207644_101309933 | 210 |
| 289 | 3300025945 | Ga0207679_10727872 | Ga0207679_107278721 | 210 |
| 290 | 3300036401 | Ga0373937_0156612 | Ga0373937_0156612_151_792 | 210 |
| 291 | 3300046472 | Ga0495580_0433139 | Ga0495580_0433139_222_863 | 210 |
| 292 | 3300046530 | Ga0495654_0018873 | Ga0495654_0018873_2346_3098 | 210 |
| 293 | 3300048905 | Ga0496102_0004606 | Ga0496102_0004606_5536_6180 | 210 |
| 294 | 3300048928 | Ga0496125_0005139 | Ga0496125_0005139_2821_3585 | 210 |
| 295 | 3300048929 | Ga0496126_0128479 | Ga0496126_0128479_1201_1965 | 210 |
| 296 | 3300003322 | rootL2_10063700 | rootL2_100637004 | 211 |
| 297 | 3300005336 | Ga0070680_100195356 | Ga0070680_1001953562 | 211 |
| 298 | 3300005339 | Ga0070660_100136062 | Ga0070660_1001360621 | 211 |
| 299 | 3300005366 | Ga0070659_100214297 | Ga0070659_1002142972 | 211 |
| 300 | 3300005458 | Ga0070681_10150863 | Ga0070681_101508632 | 211 |
| 301 | 3300005539 | Ga0068853_100038133 | Ga0068853_1000381332 | 211 |
| 302 | 3300005563 | Ga0068855_100010612 | Ga0068855_1000106125 | 211 |
| 303 | 3300005577 | Ga0068857_100387169 | Ga0068857_1003871692 | 211 |
| 304 | 3300006195 | Ga0075366_10018564 | Ga0075366_100185642 | 211 |
| 305 | 3300009551 | Ga0105238_10006785 | Ga0105238_100067857 | 211 |
| 306 | 3300013105 | Ga0157369_10000994 | Ga0157369_100009944 | 211 |
| 307 | 3300025303 | Ga0209051_1002358 | Ga0209051_10023582 | 211 |
| 308 | 3300025912 | Ga0207707_10183401 | Ga0207707_101834012 | 211 |
| 309 | 3300025919 | Ga0207657_10104301 | Ga0207657_101043013 | 211 |
| 310 | 3300025924 | Ga0207694_10004663 | Ga0207694_100046632 | 211 |
| 311 | 3300025932 | Ga0207690_10146562 | Ga0207690_101465621 | 211 |
| 312 | 3300025949 | Ga0207667_10001650 | Ga0207667_1000165022 | 211 |
| 313 | 3300026041 | Ga0207639_10452644 | Ga0207639_104526442 | 211 |
| 314 | 3300026116 | Ga0207674_10220429 | Ga0207674_102204292 | 211 |
| 315 | 3300026142 | Ga0207698_10177966 | Ga0207698_101779661 | 211 |
| 316 | 3300031239 | Ga0265328_10000916 | Ga0265328_100009169 | 211 |
| 317 | 3300036401 | Ga0373937_0239417 | Ga0373937_0239417_577_1230 | 211 |
| 318 | 3300037471 | Ga0395905_0055832 | Ga0395905_0055832_2938_3591 | 211 |
| 319 | 3300044658 | Ga0466972_0019283 | Ga0466972_0019283_2290_2928 | 211 |
| 320 | 3300044683 | Ga0466965_0102346 | Ga0466965_0102346_38_676 | 211 |
| 321 | 3300044765 | Ga0466970_0056634 | Ga0466970_0056634_773_1411 | 211 |
| 322 | 3300045049 | Ga0466959_0211724 | Ga0466959_0211724_379_1017 | 211 |
| 323 | 3300041460 | Ga0451802_1268127 | Ga0451802_1268127_649_1308 | 212 |
| 324 | 3300013296 | Ga0157374_10218658 | Ga0157374_102186582 | 215 |
| 325 | 3300031995 | Ga0307409_100986425 | Ga0307409_1009864251 | 216 |
| 326 | 3300005356 | Ga0070674_100179314 | Ga0070674_1001793142 | 218 |
| 327 | 3300025926 | Ga0207659_10128063 | Ga0207659_101280633 | 218 |
| 328 | 3300025937 | Ga0207669_10160105 | Ga0207669_101601052 | 218 |
| 329 | 3300003305 | Ga0006770J48903_1026620 | Ga0006770J48903_10266201 | 219 |
| 330 | 3300003308 | Ga0006777J48905_1064439 | Ga0006777J48905_10644391 | 219 |
| 331 | 3300003693 | Ga0032354_1088087 | Ga0032354_10880871 | 219 |
| 332 | 3300005339 | Ga0070660_100048113 | Ga0070660_1000481132 | 219 |
| 333 | 3300005347 | Ga0070668_100317785 | Ga0070668_1003177851 | 219 |
| 334 | 3300005459 | Ga0068867_100000108 | Ga0068867_10000010856 | 219 |
| 335 | 3300005548 | Ga0070665_100154794 | Ga0070665_1001547941 | 219 |
| 336 | 3300005843 | Ga0068860_100531882 | Ga0068860_1005318821 | 219 |
| 337 | 3300009148 | Ga0105243_10008569 | Ga0105243_100085694 | 219 |
| 338 | 3300014745 | Ga0157377_10000035 | Ga0157377_10000035117 | 219 |
| 339 | 3300025935 | Ga0207709_10005991 | Ga0207709_100059914 | 219 |
| 340 | 3300025972 | Ga0207668_10293871 | Ga0207668_102938712 | 219 |
| 341 | 3300025986 | Ga0207658_10016999 | Ga0207658_100169993 | 219 |
| 342 | 3300026067 | Ga0207678_10031110 | Ga0207678_100311105 | 219 |
| 343 | 3300026089 | Ga0207648_10000040 | Ga0207648_10000040117 | 219 |
| 344 | 3300026089 | Ga0207648_10125415 | Ga0207648_101254152 | 219 |
| 345 | 3300028381 | Ga0268264_10506748 | Ga0268264_105067481 | 219 |
| 346 | 3300049579 | Ga0501043_0000128 | Ga0501043_0000128_6261_6935 | 219 |
| 347 | 3300049580 | Ga0501046_0000090 | Ga0501046_0000090_6263_6937 | 219 |
| 348 | 3300049581 | Ga0501047_0000062 | Ga0501047_0000062_45360_46034 | 219 |
| 349 | 3300049582 | Ga0501048_0002949 | Ga0501048_0002949_3275_3949 | 219 |
| 350 | 3300049824 | Ga0501045_0002367 | Ga0501045_0002367_10017_10691 | 219 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nql-assembly1.cif.gz_Bc | 55s mammalian mitochondrial ribosome with ict1 and p site trnamet | 0.689 | 135 | 213 |
| 5gha-assembly1.cif.gz_F | sulfur transferase ttua in complex with sulfur carrier ttub | 0.5981 | 134 | 216 |
| 7ard-assembly1.cif.gz_O | cryo-em structure of polytomella complex-i (complete composition) | 0.5979 | 135 | 182 |
| 5gha-assembly2.cif.gz_H | sulfur transferase ttua in complex with sulfur carrier ttub | 0.5931 | 136 | 219 |
| 3r3m-assembly1.cif.gz_A | crystal structure of the faf1 ubx domain | 0.5822 | 134 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2w8hA03 | Alpha Beta;2-Layer Sandwich;wza like fold;wza like domain | 0.9583 | 59 | 128 | 3.30.1950.10 |
| 2w8hA03 | Alpha Beta;2-Layer Sandwich;wza like fold;wza like domain | 0.8129 | 59 | 128 | 3.30.1950.10 |
| 3p42D03 | Alpha Beta;Roll;Outer membrane lipoprotein wza fold like;Outer membrane lipoprotein wza domain like | 0.7349 | 134 | 213 | 3.10.560.10 |
| af_Q9M0X0_1_69_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.7311 | 135 | 163 | 3.10.20.90 |
| 3p42D03 | Alpha Beta;Roll;Outer membrane lipoprotein wza fold like;Outer membrane lipoprotein wza domain like | 0.7089 | 134 | 213 | 3.10.560.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A836W7L5-F1-model_v4 | Sugar ABC transporter substrate-binding protein | 0.8535 | 41 | 129 |
GO:0006811
GO:0009279 GO:0015159 GO:0015288 GO:0046930 |
| AF-A0A2V7FT22-F1-model_v4 | Polysaccharide export protein N-terminal domain-containing protein | 0.8193 | 39 | 128 |
GO:0015159
|
| AF-A0A4Q6C2U3-F1-model_v4 | Sugar ABC transporter substrate-binding protein | 0.8181 | 39 | 129 |
GO:0006811
GO:0009279 GO:0015159 GO:0015288 GO:0046930 |
| AF-A0A7W1SWT9-F1-model_v4 | Polysaccharide biosynthesis/export family protein | 0.8001 | 39 | 128 |
GO:0015159
|
| AF-Q4BZC7-F1-model_v4 | Polysaccharide export protein | 0.7896 | 39 | 128 |
GO:0006811
GO:0009279 GO:0015159 GO:0015288 GO:0046930 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar