F418167

General Info

Members Datasets Scaffolds Average Seq Length
350 173 700 269

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100369893|Ga0070708_1003698931
Length 313
Sequence VRRAAGDRRQDALGLKGCEAGRELGTENWQLRTVLELFLLSRYFMPSCSNAETLQRIQSALEAARVIFSRFTSGAIEAEYKAGHDPVTEADKAVDAVLRKELLREGEGWLSEESVDDFTRLEKSRIWVVDPLDGTREFVAGIREFCVSVAMVENGRPIAGGICNPATEETFIGSLQTGVTYNGKPAHPSQRTRLEGAVVLASRSEVKRGEWKQFENASFKIRPMGSVAYKLALVSAGLADATFTLTPKNEWDVAAGGALVDSAGGFVSTLRSSSLRCNNKSPLLSGLLACGPLLHEELLALVRHHLPADSRHF

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.71
Rhizosphere 90.29
Stem 0
Stem Tuber 0
Unclassified 12.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100369893 3300005445 Bacteria 1351
2 Ga0065715_10309309 3300005293 Bacteria 1024
3 Ga0070676_10038301 3300005328 Bacteria 2769
4 Ga0070683_100040155 3300005329 Bacteria 4300
5 Ga0068869_100055757 3300005334 Unclassified 2881
6 Ga0068869_100068994 3300005334 Bacteria 2613
7 Ga0070680_100162746 3300005336 Bacteria 1875
8 Ga0070682_100093432 3300005337 Bacteria 1972
9 Ga0068868_100204314 3300005338 Bacteria 1648
10 Ga0070660_100100174 3300005339 Bacteria 2294
11 Ga0070689_100537915 3300005340 Bacteria 1005
12 Ga0070661_100003863 3300005344 Bacteria 10309
13 Ga0070661_100030468 3300005344 Unclassified 3898
14 Ga0070668_100174958 3300005347 Bacteria 1750
15 Ga0070669_100223166 3300005353 Bacteria 1491
16 Ga0070667_100039864 3300005367 Bacteria 3937
17 Ga0070709_10009147 3300005434 Bacteria 5453
18 Ga0070709_10122770 3300005434 Unclassified 1763
19 Ga0070709_10267368 3300005434 Bacteria 1238
20 Ga0070709_10378516 3300005434 Bacteria 1052
21 Ga0070714_100019237 3300005435 Bacteria 5558
22 Ga0070714_100234134 3300005435 Bacteria 1693
23 Ga0070714_100283817 3300005435 Bacteria 1539
24 Ga0070714_100436579 3300005435 Bacteria 1242
25 Ga0070713_100019475 3300005436 Bacteria 5183
26 Ga0070713_100020643 3300005436 Bacteria 5054
27 Ga0070713_100063441 3300005436 Unclassified 3098
28 Ga0070710_10284654 3300005437 Bacteria 1074
29 Ga0070711_100082412 3300005439 Bacteria 2296
30 Ga0070711_100206639 3300005439 Unclassified 1518
31 Ga0070711_100284538 3300005439 Bacteria 1309
32 Ga0070694_100030457 3300005444 Bacteria 3530
33 Ga0070708_100000932 3300005445 Bacteria 22137
34 Ga0070708_100011492 3300005445 Bacteria 7207
35 Ga0070708_100033122 3300005445 Bacteria 4488
36 Ga0070708_100057662 3300005445 Unclassified 3458
37 Ga0070663_100076753 3300005455 Bacteria 2444
38 Ga0070678_100074922 3300005456 Bacteria 2545
39 Ga0070662_100015561 3300005457 Bacteria 5099
40 Ga0070662_100061325 3300005457 Bacteria 2745
41 Ga0070681_10004346 3300005458 Bacteria 13476
42 Ga0068867_100048929 3300005459 Bacteria 3111
43 Ga0070685_10014758 3300005466 Bacteria 4142
44 Ga0070685_10230803 3300005466 Bacteria 1217
45 Ga0070706_100001277 3300005467 Bacteria 26851
46 Ga0070706_100056186 3300005467 Unclassified 3633
47 Ga0070707_100029292 3300005468 Bacteria 5242
48 Ga0070707_100029826 3300005468 Bacteria 5191
49 Ga0070707_100062092 3300005468 Bacteria 3584
50 Ga0070707_100085270 3300005468 Bacteria 3053
51 Ga0070707_100097738 3300005468 Bacteria 2844
52 Ga0070707_100165127 3300005468 Bacteria 2158
53 Ga0070698_100212696 3300005471 Bacteria 1868
54 Ga0070699_100140214 3300005518 Bacteria 2134
55 Ga0070679_100012400 3300005530 Bacteria 8144
56 Ga0070679_100081910 3300005530 Bacteria 3217
57 Ga0070679_100153867 3300005530 Bacteria 2275
58 Ga0070684_100260664 3300005535 Bacteria 1586
59 Ga0070697_100000126 3300005536 Bacteria 60796
60 Ga0070697_100000316 3300005536 Bacteria 38384
61 Ga0070697_100020404 3300005536 Bacteria 5241
62 Ga0070697_100021475 3300005536 Bacteria 5115
63 Ga0070697_100053903 3300005536 Bacteria 3268
64 Ga0070697_100317638 3300005536 Unclassified 1341
65 Ga0070697_100409047 3300005536 Bacteria 1178
66 Ga0068853_100335265 3300005539 Bacteria 1404
67 Ga0070686_100209013 3300005544 Bacteria 1404
68 Ga0070696_100249564 3300005546 Bacteria 1341
69 Ga0070693_100072100 3300005547 Bacteria 2037
70 Ga0070704_100109370 3300005549 Bacteria 2100
71 Ga0068855_100281558 3300005563 Bacteria 1846
72 Ga0070664_100005634 3300005564 Bacteria 10082
73 Ga0070664_100013394 3300005564 Bacteria 6680
74 Ga0068857_100093505 3300005577 Bacteria 2692
75 Ga0068854_100044147 3300005578 Unclassified 3162
76 Ga0068854_100065194 3300005578 Bacteria 2648
77 Ga0068856_100004571 3300005614 Bacteria 13752
78 Ga0068856_100217398 3300005614 Bacteria 1926
79 Ga0068856_100305619 3300005614 Bacteria 1608
80 Ga0068859_100068475 3300005617 Bacteria 3584
81 Ga0068859_100160606 3300005617 Bacteria 2326
82 Ga0068864_100135112 3300005618 Bacteria 2220
83 Ga0068861_100386511 3300005719 Bacteria 1238
84 Ga0068851_10006005 3300005834 Bacteria 5532
85 Ga0068851_10011112 3300005834 Bacteria 4216
86 Ga0068863_100028941 3300005841 Bacteria 5291
87 Ga0068863_100029166 3300005841 Bacteria 5268
88 Ga0068863_100171616 3300005841 Bacteria 2080
89 Ga0068858_100232452 3300005842 Bacteria 1748
90 Ga0068860_100023529 3300005843 Bacteria 5953
91 Ga0068860_100024100 3300005843 Bacteria 5882
92 Ga0068862_100120542 3300005844 Bacteria 2311
93 Ga0070717_10017042 3300006028 Bacteria 5643
94 Ga0070717_10018307 3300006028 Bacteria 5465
95 Ga0070717_10023169 3300006028 Bacteria 4916
96 Ga0070717_10118338 3300006028 Bacteria 2267
97 Ga0070717_10179617 3300006028 Bacteria 1844
98 Ga0070717_10289505 3300006028 Unclassified 1454
99 Ga0070715_10010807 3300006163 Bacteria 3265
100 Ga0070716_100138108 3300006173 Unclassified 1550
101 Ga0070716_100176409 3300006173 Bacteria 1399
102 Ga0070712_100000167 3300006175 Bacteria 35889
103 Ga0097621_100016981 3300006237 Bacteria 5518
104 Ga0097621_100038111 3300006237 Bacteria 3856
105 Ga0097621_100067141 3300006237 Bacteria 2956
106 Ga0097621_100091776 3300006237 Bacteria 2542
107 Ga0068871_100039260 3300006358 Bacteria 3787
108 Ga0068871_100161576 3300006358 Unclassified 1916
109 Ga0075433_10003738 3300006852 Bacteria 11778
110 Ga0075433_10262043 3300006852 Bacteria 1532
111 Ga0075434_100000143 3300006871 Bacteria 43754
112 Ga0075434_100002077 3300006871 Bacteria 17389
113 Ga0075434_100020323 3300006871 Bacteria 6439
114 Ga0075434_100027470 3300006871 Bacteria 5588
115 Ga0068865_100146045 3300006881 Bacteria 1789
116 Ga0068865_100616427 3300006881 Bacteria 919
117 Ga0075436_100025976 3300006914 Bacteria 4032
118 Ga0075436_100065734 3300006914 Bacteria 2506
119 Ga0097620_100068479 3300006931 Bacteria 3584
120 Ga0097620_100160609 3300006931 Bacteria 2326
121 Ga0075435_100000097 3300007076 Bacteria 46173
122 Ga0075435_100024541 3300007076 Bacteria 4681
123 Ga0075435_100054902 3300007076 Unclassified 3216
124 Ga0099795_10042632 3300007788 Bacteria 1620
125 Ga0105240_10007332 3300009093 Bacteria 16046
126 Ga0105240_10048243 3300009093 Bacteria 5384
127 Ga0105240_10068487 3300009093 Bacteria 4395
128 Ga0105240_10175476 3300009093 Bacteria 2534
129 Ga0105240_10541536 3300009093 Bacteria 1289
130 Ga0105245_10278787 3300009098 Bacteria 1633
131 Ga0105245_10287238 3300009098 Bacteria 1610
132 Ga0105247_10026627 3300009101 Bacteria 3493
133 Ga0105247_10161226 3300009101 Bacteria 1485
134 Ga0114129_10777169 3300009147 Unclassified 1224
135 Ga0105243_10149353 3300009148 Bacteria 2003
136 Ga0105241_10010052 3300009174 Bacteria 6945
137 Ga0105241_10018362 3300009174 Bacteria 5146
138 Ga0105241_10029656 3300009174 Bacteria 4084
139 Ga0105241_10461710 3300009174 Bacteria 1125
140 Ga0105242_10295378 3300009176 Bacteria 1477
141 Ga0105242_10596515 3300009176 Bacteria 1066
142 Ga0105248_10045819 3300009177 Bacteria 4903
143 Ga0105248_10161897 3300009177 Bacteria 2524
144 Ga0105237_10007551 3300009545 Bacteria 11882
145 Ga0105237_10023889 3300009545 Bacteria 6256
146 Ga0105237_10075560 3300009545 Unclassified 3360
147 Ga0105238_10013702 3300009551 Bacteria 8190
148 Ga0105238_10166129 3300009551 Bacteria 2182
149 Ga0105249_10005698 3300009553 Bacteria 10769
150 Ga0105239_10091583 3300010375 Bacteria 3355
151 Ga0105239_10170682 3300010375 Bacteria 2432
152 Ga0105246_10013431 3300011119 Bacteria 5134
153 Ga0157373_10000434 3300013100 Bacteria 33195
154 Ga0157373_10005628 3300013100 Bacteria 9394
155 Ga0157373_10057264 3300013100 Bacteria 2765
156 Ga0157369_10009683 3300013105 Bacteria 11018
157 Ga0157369_10043127 3300013105 Bacteria 4918
158 Ga0157369_10280644 3300013105 Bacteria 1735
159 Ga0157369_10532002 3300013105 Unclassified 1215
160 Ga0157369_10731137 3300013105 Bacteria 1019
161 Ga0157374_10005764 3300013296 Bacteria 10453
162 Ga0157374_10011912 3300013296 Bacteria 7547
163 Ga0157374_10075675 3300013296 Bacteria 3181
164 Ga0157374_10299394 3300013296 Bacteria 1591
165 Ga0157378_10014892 3300013297 Bacteria 6805
166 Ga0157378_10017693 3300013297 Bacteria 6257
167 Ga0157378_10294765 3300013297 Bacteria 1568
168 Ga0163162_10015959 3300013306 Bacteria 7340
169 Ga0163162_10283731 3300013306 Bacteria 1788
170 Ga0157372_10000682 3300013307 Bacteria 37288
171 Ga0157372_10001463 3300013307 Bacteria 25613
172 Ga0157372_10001619 3300013307 Bacteria 24410
173 Ga0157372_10004790 3300013307 Bacteria 14375
174 Ga0157372_10009857 3300013307 Bacteria 10158
175 Ga0157372_10524427 3300013307 Bacteria 1381
176 Ga0157375_10011852 3300013308 Bacteria 7711
177 Ga0157375_10147172 3300013308 Bacteria 2487
178 Ga0157375_10211069 3300013308 Bacteria 2099
179 Ga0163163_10015012 3300014325 Bacteria 7141
180 Ga0163163_10239522 3300014325 Bacteria 1864
181 Ga0163163_10468596 3300014325 Unclassified 1320
182 Ga0182008_10017836 3300014497 Bacteria 3678
183 Ga0157377_10107266 3300014745 Bacteria 1674
184 Ga0157379_10102646 3300014968 Bacteria 2566
185 Ga0157379_10273075 3300014968 Bacteria 1537
186 Ga0157376_10028506 3300014969 Unclassified 4438
187 Ga0157376_10086877 3300014969 Bacteria 2697
188 Ga0182006_1039307 3300015261 Bacteria 1867
189 Ga0182007_10010142 3300015262 Bacteria 3742
190 Ga0182005_1003882 3300015265 Bacteria 4953
191 Ga0228598_1018531 3300024227 Bacteria 1373
192 Ga0207692_10032490 3300025898 Unclassified 2509
193 Ga0207642_10036630 3300025899 Unclassified 2107
194 Ga0207680_10180982 3300025903 Bacteria 1425
195 Ga0207647_10000762 3300025904 Bacteria 25198
196 Ga0207699_10009066 3300025906 Unclassified 4939
197 Ga0207699_10136395 3300025906 Bacteria 1608
198 Ga0207699_10160563 3300025906 Unclassified 1496
199 Ga0207705_10032084 3300025909 Bacteria 3753
200 Ga0207684_10020619 3300025910 Bacteria 5632
201 Ga0207684_10038049 3300025910 Bacteria 4083
202 Ga0207684_10107633 3300025910 Bacteria 2385
203 Ga0207684_10150028 3300025910 Bacteria 2006
204 Ga0207684_10190995 3300025910 Bacteria 1767
205 Ga0207654_10005846 3300025911 Bacteria 6203
206 Ga0207654_10007287 3300025911 Bacteria 5574
207 Ga0207654_10070603 3300025911 Bacteria 2074
208 Ga0207707_10005014 3300025912 Bacteria 11626
209 Ga0207707_10130696 3300025912 Bacteria 2196
210 Ga0207707_10257136 3300025912 Bacteria 1516
211 Ga0207695_10016674 3300025913 Bacteria 8584
212 Ga0207695_10052398 3300025913 Bacteria 4276
213 Ga0207695_10129487 3300025913 Bacteria 2482
214 Ga0207695_10388402 3300025913 Bacteria 1281
215 Ga0207671_10015152 3300025914 Bacteria 6057
216 Ga0207671_10028763 3300025914 Bacteria 4152
217 Ga0207663_10034057 3300025916 Bacteria 3041
218 Ga0207663_10271205 3300025916 Bacteria 1257
219 Ga0207657_10002405 3300025919 Bacteria 20242
220 Ga0207657_10002756 3300025919 Bacteria 18918
221 Ga0207649_10056839 3300025920 Bacteria 2444
222 Ga0207649_10159576 3300025920 Unclassified 1562
223 Ga0207652_10069479 3300025921 Unclassified 3058
224 Ga0207652_10084079 3300025921 Bacteria 2787
225 Ga0207652_10331425 3300025921 Bacteria 1374
226 Ga0207646_10025162 3300025922 Bacteria 5448
227 Ga0207646_10027168 3300025922 Bacteria 5219
228 Ga0207646_10060290 3300025922 Bacteria 3388
229 Ga0207646_10105355 3300025922 Bacteria 2529
230 Ga0207646_10142232 3300025922 Bacteria 2161
231 Ga0207646_10153094 3300025922 Bacteria 2080
232 Ga0207646_10173552 3300025922 Unclassified 1947
233 Ga0207646_10188336 3300025922 Bacteria 1864
234 Ga0207681_10271343 3300025923 Bacteria 1332
235 Ga0207694_10142965 3300025924 Bacteria 1924
236 Ga0207687_10022944 3300025927 Bacteria 4155
237 Ga0207687_10032632 3300025927 Bacteria 3528
238 Ga0207700_10025646 3300025928 Bacteria 4098
239 Ga0207700_10053387 3300025928 Bacteria 3028
240 Ga0207664_10098227 3300025929 Unclassified 2414
241 Ga0207664_10416653 3300025929 Bacteria 1196
242 Ga0207690_10067566 3300025932 Bacteria 2452
243 Ga0207706_10000590 3300025933 Bacteria 38531
244 Ga0207706_10017787 3300025933 Bacteria 6402
245 Ga0207686_10258282 3300025934 Unclassified 1276
246 Ga0207665_10063164 3300025939 Bacteria 2514
247 Ga0207665_10119662 3300025939 Bacteria 1859
248 Ga0207665_10202564 3300025939 Unclassified 1447
249 Ga0207665_10262032 3300025939 Bacteria 1281
250 Ga0207711_10003859 3300025941 Bacteria 12900
251 Ga0207711_10030181 3300025941 Bacteria 4572
252 Ga0207689_10001132 3300025942 Bacteria 25698
253 Ga0207689_10006988 3300025942 Bacteria 9921
254 Ga0207712_10334997 3300025961 Bacteria 1253
255 Ga0207640_10106892 3300025981 Unclassified 1975
256 Ga0207640_10489102 3300025981 Bacteria 1022
257 Ga0207703_10003817 3300026035 Bacteria 12522
258 Ga0207703_10064873 3300026035 Bacteria 2999
259 Ga0207703_10206450 3300026035 Bacteria 1749
260 Ga0207639_10504273 3300026041 Bacteria 1106
261 Ga0207678_10001070 3300026067 Bacteria 25089
262 Ga0207678_10221321 3300026067 Bacteria 1620
263 Ga0207702_10006874 3300026078 Bacteria 9754
264 Ga0207641_10030476 3300026088 Bacteria 4469
265 Ga0207641_10043036 3300026088 Bacteria 3791
266 Ga0207641_10063291 3300026088 Bacteria 3160
267 Ga0207648_10032796 3300026089 Bacteria 4583
268 Ga0207676_10310163 3300026095 Bacteria 1444
269 Ga0207674_10050729 3300026116 Unclassified 4238
270 Ga0207675_100099598 3300026118 Bacteria 2737
271 Ga0207683_10084348 3300026121 Bacteria 2824
272 Ga0268266_10008196 3300028379 Bacteria 9318
273 Ga0268266_10344801 3300028379 Unclassified 1399
274 Ga0268264_10015536 3300028381 Bacteria 6241
275 Ga0268264_10136200 3300028381 Bacteria 2184
276 Ga0265765_1009826 3300030879 Bacteria 1058
277 Ga0265760_10003004 3300031090 Bacteria 4933
278 Ga0265760_10005448 3300031090 Unclassified 3649
279 Ga0265340_10030847 3300031247 Bacteria 2685
280 Ga0265339_10013741 3300031249 Unclassified 4900
281 Ga0265316_10001089 3300031344 Bacteria 29440
282 Ga0265314_10016292 3300031711 Bacteria 5876
283 Ga0265314_10073596 3300031711 Bacteria 2278
284 Ga0265314_10218148 3300031711 Bacteria 1115
285 Ga0373929_0027864 3300035085 Bacteria 1190
286 Ga0373941_0160141 3300035115 Bacteria 832
287 Ga0373927_0243524 3300035695 Unclassified 1182
288 Ga0373933_0176608 3300035724 Bacteria 1361
289 Ga0373937_0081025 3300036401 Bacteria 3003
290 Ga0373937_0789486 3300036401 Unclassified 897
291 Ga0373925_0096456 3300037068 Bacteria 2267
292 Ga0373925_0162601 3300037068 Bacteria 1759
293 Ga0373925_0373032 3300037068 Bacteria 1161
294 Ga0466964_0112103 3300044706 Unclassified 1218
295 Ga0466968_0047996 3300044735 Bacteria 1817
296 Ga0451576_0379777 3300045051 Unclassified 1481
297 Ga0466967_0067189 3300045976 Bacteria 3197
298 Ga0495580_0001856 3300046472 Bacteria 18580
299 Ga0495580_0005160 3300046472 Bacteria 10865
300 Ga0495580_0043577 3300046472 Bacteria 3193
301 Ga0495580_0088784 3300046472 Bacteria 2152
302 Ga0495623_0208190 3300046679 Bacteria 1121
303 Ga0496100_0003877 3300048903 Bacteria 7850
304 Ga0496100_0042274 3300048903 Unclassified 2911
305 Ga0496101_0017156 3300048904 Bacteria 4906
306 Ga0496102_0000882 3300048905 Bacteria 28596
307 Ga0496102_0022487 3300048905 Bacteria 5587
308 Ga0496102_0095016 3300048905 Bacteria 2762
309 Ga0496102_0123809 3300048905 Bacteria 2416
310 Ga0496102_0336843 3300048905 Bacteria 1421
311 Ga0496102_0352664 3300048905 Bacteria 1385
312 Ga0496103_0078026 3300048906 Bacteria 2080
313 Ga0496103_0338637 3300048906 Bacteria 967
314 Ga0496104_0075418 3300048907 Bacteria 3211
315 Ga0496104_0083313 3300048907 Bacteria 3050
316 Ga0496104_0202743 3300048907 Unclassified 1896
317 Ga0496104_0254689 3300048907 Bacteria 1668
318 Ga0496104_0292762 3300048907 Bacteria 1540
319 Ga0496105_0059590 3300048908 Bacteria 3150
320 Ga0496105_0319920 3300048908 Unclassified 1244
321 Ga0496106_0413216 3300048909 Bacteria 1084
322 Ga0496107_0058191 3300048910 Bacteria 2795
323 Ga0496107_0089413 3300048910 Bacteria 2249
324 Ga0496109_0263538 3300048912 Bacteria 1623
325 Ga0496110_0108090 3300048913 Bacteria 2497
326 Ga0496110_0571268 3300048913 Bacteria 1027
327 Ga0496111_0011538 3300048914 Bacteria 5958
328 Ga0496112_0019997 3300048915 Bacteria 6338
329 Ga0496112_0029031 3300048915 Bacteria 5346
330 Ga0496112_0080258 3300048915 Unclassified 3226
331 Ga0496112_0178328 3300048915 Bacteria 2089
332 Ga0496112_0379551 3300048915 Bacteria 1354
333 Ga0496113_0034168 3300048916 Bacteria 3708
334 Ga0496113_0090476 3300048916 Bacteria 2357
335 Ga0496114_0053643 3300048917 Bacteria 3360
336 Ga0496115_0018475 3300048918 Bacteria 5353
337 nmdc:mga05p37_613391_c1 3300050507 Unclassified 1226
338 nmdc:mga0n895_19219_c1 3300050512 Bacteria 6345
339 nmdc:mga0n895_26960_c1 3300050512 Bacteria 5451
340 nmdc:mga0n895_360_c1 3300050512 Bacteria 30630
341 nmdc:mga0n895_4376_c1 3300050512 Bacteria 11584
342 nmdc:mga0n895_885514_c1 3300050512 Bacteria 879
343 nmdc:mga0rr50_25920_c1 3300050513 Bacteria 4083
344 nmdc:mga0rr50_404_c1 3300050513 Bacteria 23529
345 nmdc:mga0rr50_45533_c1 3300050513 Unclassified 3225
346 nmdc:mga08x19_110616_c1 3300050514 Bacteria 1832
347 nmdc:mga08x19_2921_c1 3300050514 Bacteria 10276
348 nmdc:mga0a205_271954_c1 3300050515 Bacteria 1571
349 nmdc:mga0a205_575_c1 3300050515 Bacteria 29128
350 Ga0495619_0218049 3300053085 Bacteria 1321
351 Ga0070708_100369893
352 Ga0065715_10309309
353 Ga0070676_10038301
354 Ga0070683_100040155
355 Ga0068869_100055757
356 Ga0068869_100068994
357 Ga0070680_100162746
358 Ga0070682_100093432
359 Ga0068868_100204314
360 Ga0070660_100100174
361 Ga0070689_100537915
362 Ga0070661_100003863
363 Ga0070661_100030468
364 Ga0070668_100174958
365 Ga0070669_100223166
366 Ga0070667_100039864
367 Ga0070709_10009147
368 Ga0070709_10122770
369 Ga0070709_10267368
370 Ga0070709_10378516
371 Ga0070714_100019237
372 Ga0070714_100234134
373 Ga0070714_100283817
374 Ga0070714_100436579
375 Ga0070713_100019475
376 Ga0070713_100020643
377 Ga0070713_100063441
378 Ga0070710_10284654
379 Ga0070711_100082412
380 Ga0070711_100206639
381 Ga0070711_100284538
382 Ga0070694_100030457
383 Ga0070708_100000932
384 Ga0070708_100011492
385 Ga0070708_100033122
386 Ga0070708_100057662
387 Ga0070663_100076753
388 Ga0070678_100074922
389 Ga0070662_100015561
390 Ga0070662_100061325
391 Ga0070681_10004346
392 Ga0068867_100048929
393 Ga0070685_10014758
394 Ga0070685_10230803
395 Ga0070706_100001277
396 Ga0070706_100056186
397 Ga0070707_100029292
398 Ga0070707_100029826
399 Ga0070707_100062092
400 Ga0070707_100085270
401 Ga0070707_100097738
402 Ga0070707_100165127
403 Ga0070698_100212696
404 Ga0070699_100140214
405 Ga0070679_100012400
406 Ga0070679_100081910
407 Ga0070679_100153867
408 Ga0070684_100260664
409 Ga0070697_100000126
410 Ga0070697_100000316
411 Ga0070697_100020404
412 Ga0070697_100021475
413 Ga0070697_100053903
414 Ga0070697_100317638
415 Ga0070697_100409047
416 Ga0068853_100335265
417 Ga0070686_100209013
418 Ga0070696_100249564
419 Ga0070693_100072100
420 Ga0070704_100109370
421 Ga0068855_100281558
422 Ga0070664_100005634
423 Ga0070664_100013394
424 Ga0068857_100093505
425 Ga0068854_100044147
426 Ga0068854_100065194
427 Ga0068856_100004571
428 Ga0068856_100217398
429 Ga0068856_100305619
430 Ga0068859_100068475
431 Ga0068859_100160606
432 Ga0068864_100135112
433 Ga0068861_100386511
434 Ga0068851_10006005
435 Ga0068851_10011112
436 Ga0068863_100028941
437 Ga0068863_100029166
438 Ga0068863_100171616
439 Ga0068858_100232452
440 Ga0068860_100023529
441 Ga0068860_100024100
442 Ga0068862_100120542
443 Ga0070717_10017042
444 Ga0070717_10018307
445 Ga0070717_10023169
446 Ga0070717_10118338
447 Ga0070717_10179617
448 Ga0070717_10289505
449 Ga0070715_10010807
450 Ga0070716_100138108
451 Ga0070716_100176409
452 Ga0070712_100000167
453 Ga0097621_100016981
454 Ga0097621_100038111
455 Ga0097621_100067141
456 Ga0097621_100091776
457 Ga0068871_100039260
458 Ga0068871_100161576
459 Ga0075433_10003738
460 Ga0075433_10262043
461 Ga0075434_100000143
462 Ga0075434_100002077
463 Ga0075434_100020323
464 Ga0075434_100027470
465 Ga0068865_100146045
466 Ga0068865_100616427
467 Ga0075436_100025976
468 Ga0075436_100065734
469 Ga0097620_100068479
470 Ga0097620_100160609
471 Ga0075435_100000097
472 Ga0075435_100024541
473 Ga0075435_100054902
474 Ga0099795_10042632
475 Ga0105240_10007332
476 Ga0105240_10048243
477 Ga0105240_10068487
478 Ga0105240_10175476
479 Ga0105240_10541536
480 Ga0105245_10278787
481 Ga0105245_10287238
482 Ga0105247_10026627
483 Ga0105247_10161226
484 Ga0114129_10777169
485 Ga0105243_10149353
486 Ga0105241_10010052
487 Ga0105241_10018362
488 Ga0105241_10029656
489 Ga0105241_10461710
490 Ga0105242_10295378
491 Ga0105242_10596515
492 Ga0105248_10045819
493 Ga0105248_10161897
494 Ga0105237_10007551
495 Ga0105237_10023889
496 Ga0105237_10075560
497 Ga0105238_10013702
498 Ga0105238_10166129
499 Ga0105249_10005698
500 Ga0105239_10091583
501 Ga0105239_10170682
502 Ga0105246_10013431
503 Ga0157373_10000434
504 Ga0157373_10005628
505 Ga0157373_10057264
506 Ga0157369_10009683
507 Ga0157369_10043127
508 Ga0157369_10280644
509 Ga0157369_10532002
510 Ga0157369_10731137
511 Ga0157374_10005764
512 Ga0157374_10011912
513 Ga0157374_10075675
514 Ga0157374_10299394
515 Ga0157378_10014892
516 Ga0157378_10017693
517 Ga0157378_10294765
518 Ga0163162_10015959
519 Ga0163162_10283731
520 Ga0157372_10000682
521 Ga0157372_10001463
522 Ga0157372_10001619
523 Ga0157372_10004790
524 Ga0157372_10009857
525 Ga0157372_10524427
526 Ga0157375_10011852
527 Ga0157375_10147172
528 Ga0157375_10211069
529 Ga0163163_10015012
530 Ga0163163_10239522
531 Ga0163163_10468596
532 Ga0182008_10017836
533 Ga0157377_10107266
534 Ga0157379_10102646
535 Ga0157379_10273075
536 Ga0157376_10028506
537 Ga0157376_10086877
538 Ga0182006_1039307
539 Ga0182007_10010142
540 Ga0182005_1003882
541 Ga0228598_1018531
542 Ga0207692_10032490
543 Ga0207642_10036630
544 Ga0207680_10180982
545 Ga0207647_10000762
546 Ga0207699_10009066
547 Ga0207699_10136395
548 Ga0207699_10160563
549 Ga0207705_10032084
550 Ga0207684_10020619
551 Ga0207684_10038049
552 Ga0207684_10107633
553 Ga0207684_10150028
554 Ga0207684_10190995
555 Ga0207654_10005846
556 Ga0207654_10007287
557 Ga0207654_10070603
558 Ga0207707_10005014
559 Ga0207707_10130696
560 Ga0207707_10257136
561 Ga0207695_10016674
562 Ga0207695_10052398
563 Ga0207695_10129487
564 Ga0207695_10388402
565 Ga0207671_10015152
566 Ga0207671_10028763
567 Ga0207663_10034057
568 Ga0207663_10271205
569 Ga0207657_10002405
570 Ga0207657_10002756
571 Ga0207649_10056839
572 Ga0207649_10159576
573 Ga0207652_10069479
574 Ga0207652_10084079
575 Ga0207652_10331425
576 Ga0207646_10025162
577 Ga0207646_10027168
578 Ga0207646_10060290
579 Ga0207646_10105355
580 Ga0207646_10142232
581 Ga0207646_10153094
582 Ga0207646_10173552
583 Ga0207646_10188336
584 Ga0207681_10271343
585 Ga0207694_10142965
586 Ga0207687_10022944
587 Ga0207687_10032632
588 Ga0207700_10025646
589 Ga0207700_10053387
590 Ga0207664_10098227
591 Ga0207664_10416653
592 Ga0207690_10067566
593 Ga0207706_10000590
594 Ga0207706_10017787
595 Ga0207686_10258282
596 Ga0207665_10063164
597 Ga0207665_10119662
598 Ga0207665_10202564
599 Ga0207665_10262032
600 Ga0207711_10003859
601 Ga0207711_10030181
602 Ga0207689_10001132
603 Ga0207689_10006988
604 Ga0207712_10334997
605 Ga0207640_10106892
606 Ga0207640_10489102
607 Ga0207703_10003817
608 Ga0207703_10064873
609 Ga0207703_10206450
610 Ga0207639_10504273
611 Ga0207678_10001070
612 Ga0207678_10221321
613 Ga0207702_10006874
614 Ga0207641_10030476
615 Ga0207641_10043036
616 Ga0207641_10063291
617 Ga0207648_10032796
618 Ga0207676_10310163
619 Ga0207674_10050729
620 Ga0207675_100099598
621 Ga0207683_10084348
622 Ga0268266_10008196
623 Ga0268266_10344801
624 Ga0268264_10015536
625 Ga0268264_10136200
626 Ga0265765_1009826
627 Ga0265760_10003004
628 Ga0265760_10005448
629 Ga0265340_10030847
630 Ga0265339_10013741
631 Ga0265316_10001089
632 Ga0265314_10016292
633 Ga0265314_10073596
634 Ga0265314_10218148
635 Ga0373929_0027864
636 Ga0373941_0160141
637 Ga0373927_0243524
638 Ga0373933_0176608
639 Ga0373937_0081025
640 Ga0373937_0789486
641 Ga0373925_0096456
642 Ga0373925_0162601
643 Ga0373925_0373032
644 Ga0466964_0112103
645 Ga0466968_0047996
646 Ga0451576_0379777
647 Ga0466967_0067189
648 Ga0495580_0001856
649 Ga0495580_0005160
650 Ga0495580_0043577
651 Ga0495580_0088784
652 Ga0495623_0208190
653 Ga0496100_0003877
654 Ga0496100_0042274
655 Ga0496101_0017156
656 Ga0496102_0000882
657 Ga0496102_0022487
658 Ga0496102_0095016
659 Ga0496102_0123809
660 Ga0496102_0336843
661 Ga0496102_0352664
662 Ga0496103_0078026
663 Ga0496103_0338637
664 Ga0496104_0075418
665 Ga0496104_0083313
666 Ga0496104_0202743
667 Ga0496104_0254689
668 Ga0496104_0292762
669 Ga0496105_0059590
670 Ga0496105_0319920
671 Ga0496106_0413216
672 Ga0496107_0058191
673 Ga0496107_0089413
674 Ga0496109_0263538
675 Ga0496110_0108090
676 Ga0496110_0571268
677 Ga0496111_0011538
678 Ga0496112_0019997
679 Ga0496112_0029031
680 Ga0496112_0080258
681 Ga0496112_0178328
682 Ga0496112_0379551
683 Ga0496113_0034168
684 Ga0496113_0090476
685 Ga0496114_0053643
686 Ga0496115_0018475
687 nmdc:mga05p37_613391_c1
688 nmdc:mga0n895_19219_c1
689 nmdc:mga0n895_26960_c1
690 nmdc:mga0n895_360_c1
691 nmdc:mga0n895_4376_c1
692 nmdc:mga0n895_885514_c1
693 nmdc:mga0rr50_25920_c1
694 nmdc:mga0rr50_404_c1
695 nmdc:mga0rr50_45533_c1
696 nmdc:mga08x19_110616_c1
697 nmdc:mga08x19_2921_c1
698 nmdc:mga0a205_271954_c1
699 nmdc:mga0a205_575_c1
700 Ga0495619_0218049

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

50

306

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zhh-assembly1.cif.gz_A structure of inositol monophosphatase from anabaena (nostoc) sp. pcc 7120 0.8812 6 260
2p3v-assembly1.cif.gz_A thermotoga maritima impase tm1415 0.8727 44 260
3luz-assembly1.cif.gz_B crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.8682 10 259
2pcr-assembly1.cif.gz_C crystal structure of myo-inositol-1(or 4)-monophosphatase (aq_1983) from aquifex aeolicus vf5 0.8622 7 262
3t0j-assembly1.cif.gz_D crystal structure of inositol monophosphatase - ii from staphylococcus aureus mssa476 0.8584 11 264
ID Description Score Start End Superfamily
af_Q54U72_1_145_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.8906 47 140 3.30.540.10
5zhhC01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.8782 10 141 3.30.540.10
2p3nA01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.8751 45 141 3.30.540.10
5eqaA01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.8733 11 142 3.30.540.10
af_E7F1M4_1_172_3.30.500.10 Alpha Beta;2-Layer Sandwich;Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1;MHC class I-like antigen recognition-like 0.8663 102 128 3.30.500.10
ID Description Score Start End GO Terms
AF-X1F3P4-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ 0.957 115 260 GO:0006020
GO:0007165
GO:0008934
GO:0046854
AF-A0A1F9DPB0-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ 0.95 46 262 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A1F8WNJ4-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ 0.9281 8 259 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A3C1NDW9-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ 0.9234 43 256 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A2E1IU79-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ (EC 3.1.3.7) (3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase) (3'-phosphoadenosine 5'-phosphate phosphatase) (PAP phosphatase) 0.9198 45 259 GO:0000103
GO:0000287
GO:0005886
GO:0008441
GO:0046854
GO:0050427

Map