F418248

General Info

Members Datasets Scaffolds Average Seq Length
350 198 350 135

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10421628|Ga0182008_104216281
Length 156
Sequence MTRDVIATCPVCEGELQVSRLRCTTCGTAIEGQFSVGRFGRLSREQMYLLESFLRARGNLRDMERELGISYPTVRNRVEGLVRALGLGDGEAPSAAEPEPPAQAAPHIAAHRREVLERLARHDITAEQAAAELKGEVAAGAISSDAKPEAIHDQSD

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
120 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
124 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
125 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
126 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
127 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.57
Rhizosphere 91.14
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10220741 3300003320 Bacteria 3555
2 Ga0070690_100057315 3300005330 Bacteria 2500
3 Ga0068869_101797854 3300005334 Bacteria 548
4 Ga0070680_100000002 3300005336 Bacteria 211003
5 Ga0068868_100115183 3300005338 Bacteria 2188
6 Ga0070691_10371900 3300005341 Unclassified 799
7 Ga0070687_100233304 3300005343 Unclassified 1133
8 Ga0070687_100522883 3300005343 Bacteria 803
9 Ga0070692_11066413 3300005345 Bacteria 569
10 Ga0070669_100287867 3300005353 Bacteria 1318
11 Ga0070671_101184579 3300005355 Unclassified 672
12 Ga0070674_100769605 3300005356 Bacteria 829
13 Ga0070673_101467791 3300005364 Bacteria 643
14 Ga0070673_101805803 3300005364 Unclassified 579
15 Ga0070659_101468545 3300005366 Bacteria 607
16 Ga0070667_100454871 3300005367 Bacteria 1170
17 Ga0070711_100394469 3300005439 Bacteria 1122
18 Ga0070705_100139267 3300005440 Unclassified 1595
19 Ga0070705_100363031 3300005440 Bacteria 1060
20 Ga0070705_100479431 3300005440 Bacteria 940
21 Ga0070700_100671796 3300005441 Unclassified 820
22 Ga0070694_100023351 3300005444 Bacteria 3976
23 Ga0070708_100134001 3300005445 Bacteria 2294
24 Ga0070708_100762679 3300005445 Bacteria 910
25 Ga0070708_101444669 3300005445 Unclassified 641
26 Ga0070663_101175319 3300005455 Bacteria 673
27 Ga0070662_100409487 3300005457 Bacteria 1120
28 Ga0070681_10193255 3300005458 Unclassified 1955
29 Ga0070706_100121235 3300005467 Bacteria 2437
30 Ga0070706_100273028 3300005467 Bacteria 1578
31 Ga0070706_100369274 3300005467 Unclassified 1337
32 Ga0070707_100009619 3300005468 Bacteria 8980
33 Ga0070707_100116309 3300005468 Bacteria 2595
34 Ga0070707_100314544 3300005468 Bacteria 1522
35 Ga0070707_101496529 3300005468 Bacteria 642
36 Ga0070698_100010268 3300005471 Bacteria 10002
37 Ga0070698_100020249 3300005471 Bacteria 6974
38 Ga0070698_100076253 3300005471 Bacteria 3355
39 Ga0070699_100019210 3300005518 Bacteria 5880
40 Ga0070699_100036457 3300005518 Bacteria 4254
41 Ga0070699_100084848 3300005518 Bacteria 2764
42 Ga0070699_100396806 3300005518 Bacteria 1247
43 Ga0070699_100931587 3300005518 Bacteria 796
44 Ga0070679_100396597 3300005530 Bacteria 1326
45 Ga0070684_100759767 3300005535 Bacteria 905
46 Ga0070697_100019335 3300005536 Bacteria 5380
47 Ga0070697_100205403 3300005536 Bacteria 1675
48 Ga0070697_100277780 3300005536 Bacteria 1437
49 Ga0070697_101058768 3300005536 Bacteria 722
50 Ga0070686_100299320 3300005544 Unclassified 1192
51 Ga0070695_100018988 3300005545 Bacteria 4180
52 Ga0070695_100397930 3300005545 Unclassified 1043
53 Ga0070695_100459143 3300005545 Bacteria 978
54 Ga0070696_100001227 3300005546 Bacteria 16650
55 Ga0070696_100006828 3300005546 Bacteria 7618
56 Ga0070696_100009844 3300005546 Bacteria 6393
57 Ga0070696_100441251 3300005546 Bacteria 1025
58 Ga0070696_100672271 3300005546 Unclassified 841
59 Ga0070693_100068226 3300005547 Bacteria 2087
60 Ga0070693_100332887 3300005547 Unclassified 1034
61 Ga0070704_100030959 3300005549 Unclassified 3592
62 Ga0070704_100039011 3300005549 Bacteria 3258
63 Ga0070704_100067156 3300005549 Unclassified 2588
64 Ga0070704_100361913 3300005549 Unclassified 1227
65 Ga0070704_100621218 3300005549 Unclassified 951
66 Ga0068855_100396150 3300005563 Unclassified 1514
67 Ga0068855_101747662 3300005563 Bacteria 633
68 Ga0068857_100684806 3300005577 Bacteria 973
69 Ga0068854_100016634 3300005578 Bacteria 4908
70 Ga0068854_100565627 3300005578 Bacteria 966
71 Ga0068856_101672389 3300005614 Bacteria 649
72 Ga0070702_100037759 3300005615 Bacteria 2684
73 Ga0070702_100808378 3300005615 Bacteria 726
74 Ga0068852_100411584 3300005616 Bacteria 1332
75 Ga0068859_100171116 3300005617 Bacteria 2253
76 Ga0068864_100008744 3300005618 Bacteria 8350
77 Ga0068861_100023534 3300005719 Bacteria 4444
78 Ga0068861_100310868 3300005719 Unclassified 1369
79 Ga0068861_101297705 3300005719 Unclassified 708
80 Ga0068861_102015722 3300005719 Unclassified 576
81 Ga0068863_100110111 3300005841 Bacteria 2622
82 Ga0068858_100328180 3300005842 Bacteria 1463
83 Ga0068860_100021120 3300005843 Bacteria 6304
84 Ga0068860_101161099 3300005843 Bacteria 792
85 Ga0068862_100044471 3300005844 Unclassified 3788
86 Ga0081538_10148860 3300005981 Bacteria 1064
87 Ga0081539_10325293 3300005985 Bacteria 653
88 Ga0068871_100927175 3300006358 Bacteria 808
89 Ga0068871_101128103 3300006358 Bacteria 734
90 Ga0075428_100000259 3300006844 Bacteria 52057
91 Ga0075428_100438656 3300006844 Bacteria 1399
92 Ga0075431_100218239 3300006847 Bacteria 1946
93 Ga0075433_10075192 3300006852 Bacteria 2972
94 Ga0075433_10146421 3300006852 Bacteria 2100
95 Ga0075433_10174493 3300006852 Unclassified 1912
96 Ga0075433_10651956 3300006852 Bacteria 923
97 Ga0075434_100184260 3300006871 Bacteria 2108
98 Ga0075434_100521173 3300006871 Bacteria 1209
99 Ga0097620_100171117 3300006931 Bacteria 2253
100 Ga0075435_100841189 3300007076 Bacteria 799
101 Ga0111539_10106073 3300009094 Bacteria 3296
102 Ga0111539_11639136 3300009094 Bacteria 746
103 Ga0111539_11639137 3300009094 Bacteria 746
104 Ga0105245_10056547 3300009098 Bacteria 3526
105 Ga0105245_10159430 3300009098 Bacteria 2140
106 Ga0105245_10211443 3300009098 Bacteria 1867
107 Ga0105245_10283798 3300009098 Bacteria 1619
108 Ga0105245_10661124 3300009098 Bacteria 1076
109 Ga0105245_10725150 3300009098 Bacteria 1029
110 Ga0105245_11702852 3300009098 Bacteria 683
111 Ga0105247_10190290 3300009101 Unclassified 1373
112 Ga0114129_10207413 3300009147 Bacteria 2651
113 Ga0114129_10651918 3300009147 Bacteria 1359
114 Ga0114129_11212085 3300009147 Bacteria 940
115 Ga0114129_12424105 3300009147 Unclassified 628
116 Ga0105243_10132369 3300009148 Unclassified 2117
117 Ga0105243_10593585 3300009148 Bacteria 1065
118 Ga0105242_10143513 3300009176 Bacteria 2074
119 Ga0105242_11652346 3300009176 Unclassified 676
120 Ga0105248_10980270 3300009177 Unclassified 955
121 Ga0105249_10792404 3300009553 Bacteria 1011
122 Ga0105249_10806610 3300009553 Bacteria 1003
123 Ga0105249_10844715 3300009553 Unclassified 981
124 Ga0105249_10953370 3300009553 Unclassified 926
125 Ga0105239_10085897 3300010375 Bacteria 3468
126 Ga0105239_11933632 3300010375 Unclassified 684
127 Ga0105239_11996710 3300010375 Bacteria 673
128 Ga0105246_10201505 3300011119 Bacteria 1547
129 Ga0105246_10907608 3300011119 Unclassified 790
130 Ga0157335_1041839 3300012492 Bacteria 520
131 Ga0157370_10616045 3300013104 Bacteria 993
132 Ga0157378_10097642 3300013297 Bacteria 2678
133 Ga0157378_10123217 3300013297 Bacteria 2392
134 Ga0157378_10876057 3300013297 Unclassified 927
135 Ga0157378_12465837 3300013297 Unclassified 572
136 Ga0163162_10327580 3300013306 Bacteria 1664
137 Ga0157372_10805374 3300013307 Bacteria 1091
138 Ga0157375_10093563 3300013308 Unclassified 3072
139 Ga0163163_10185944 3300014325 Bacteria 2125
140 Ga0163163_10684698 3300014325 Bacteria 1089
141 Ga0182008_10319889 3300014497 Bacteria 816
142 Ga0182008_10421628 3300014497 Bacteria 720
143 Ga0157377_10114929 3300014745 Bacteria 1623
144 Ga0157377_11096317 3300014745 Bacteria 610
145 Ga0157379_10248430 3300014968 Bacteria 1615
146 Ga0157379_10491479 3300014968 Bacteria 1137
147 Ga0163161_10234027 3300017792 Bacteria 1426
148 Ga0163161_10289897 3300017792 Bacteria 1286
149 Ga0163161_10681813 3300017792 Unclassified 854
150 Ga0207653_10141234 3300025885 Unclassified 881
151 Ga0207688_10106071 3300025901 Bacteria 1627
152 Ga0207680_10771085 3300025903 Unclassified 689
153 Ga0207645_10154332 3300025907 Unclassified 1500
154 Ga0207684_10065008 3300025910 Bacteria 3097
155 Ga0207684_10339891 3300025910 Unclassified 1293
156 Ga0207654_11002175 3300025911 Unclassified 607
157 Ga0207707_10589570 3300025912 Bacteria 942
158 Ga0207663_10705412 3300025916 Bacteria 799
159 Ga0207660_10000002 3300025917 Bacteria 883566
160 Ga0207662_10326716 3300025918 Unclassified 1025
161 Ga0207662_10505946 3300025918 Bacteria 832
162 Ga0207649_11273478 3300025920 Unclassified 581
163 Ga0207646_10013141 3300025922 Bacteria 7925
164 Ga0207646_10032773 3300025922 Bacteria 4700
165 Ga0207646_10168860 3300025922 Bacteria 1975
166 Ga0207646_10418273 3300025922 Bacteria 1210
167 Ga0207646_10985064 3300025922 Bacteria 745
168 Ga0207646_11458057 3300025922 Bacteria 594
169 Ga0207659_10195500 3300025926 Bacteria 1612
170 Ga0207687_10096914 3300025927 Bacteria 2162
171 Ga0207687_10097723 3300025927 Unclassified 2154
172 Ga0207687_10176854 3300025927 Bacteria 1650
173 Ga0207687_10181776 3300025927 Bacteria 1630
174 Ga0207687_10276974 3300025927 Bacteria 1343
175 Ga0207687_10813343 3300025927 Bacteria 797
176 Ga0207687_11739769 3300025927 Bacteria 534
177 Ga0207644_10451898 3300025931 Unclassified 1056
178 Ga0207706_10080636 3300025933 Bacteria 2861
179 Ga0207706_10161839 3300025933 Bacteria 1967
180 Ga0207686_10105260 3300025934 Bacteria 1892
181 Ga0207709_10359730 3300025935 Bacteria 1101
182 Ga0207669_11275107 3300025937 Unclassified 624
183 Ga0207711_11249208 3300025941 Unclassified 685
184 Ga0207651_11263021 3300025960 Unclassified 664
185 Ga0207712_10418888 3300025961 Bacteria 1129
186 Ga0207712_10789241 3300025961 Bacteria 834
187 Ga0207668_10562733 3300025972 Bacteria 989
188 Ga0207640_10310616 3300025981 Bacteria 1251
189 Ga0207658_10896824 3300025986 Bacteria 807
190 Ga0207677_10220740 3300026023 Bacteria 1520
191 Ga0207703_10180891 3300026035 Bacteria 1861
192 Ga0207708_10082591 3300026075 Unclassified 2470
193 Ga0207708_10125650 3300026075 Bacteria 2001
194 Ga0207708_10527479 3300026075 Bacteria 993
195 Ga0207708_10780649 3300026075 Unclassified 821
196 Ga0207641_10182108 3300026088 Bacteria 1925
197 Ga0207648_10592376 3300026089 Bacteria 1021
198 Ga0207676_10044588 3300026095 Bacteria 3422
199 Ga0207676_11139575 3300026095 Unclassified 772
200 Ga0207676_11724659 3300026095 Unclassified 625
201 Ga0207675_100031119 3300026118 Bacteria 4969
202 Ga0207675_100238851 3300026118 Bacteria 1755
203 Ga0207675_100562968 3300026118 Unclassified 1140
204 Ga0207675_101576692 3300026118 Unclassified 677
205 Ga0207683_10146023 3300026121 Bacteria 2133
206 Ga0207683_11212874 3300026121 Unclassified 699
207 Ga0209983_1052338 3300027665 Bacteria 895
208 Ga0209974_10033021 3300027876 Bacteria 1716
209 Ga0268265_10167883 3300028380 Unclassified 1872
210 Ga0268264_10209094 3300028381 Bacteria 1790
211 Ga0268264_10678441 3300028381 Unclassified 1022
212 Ga0307405_11013409 3300031731 Bacteria 709
213 Ga0307413_10148365 3300031824 Bacteria 1631
214 Ga0307409_100367333 3300031995 Bacteria 1363
215 Ga0307415_101845921 3300032126 Bacteria 586
216 Ga0316583_10044840 3300032133 Bacteria 1562
217 Ga0316574_0627940 3300035398 Bacteria 662
218 Ga0373937_0105570 3300036401 Unclassified 2618
219 Ga0373937_0430526 3300036401 Unclassified 1252
220 Ga0373937_0788698 3300036401 Bacteria 898
221 Ga0451807_1075610 3300041486 Bacteria 906
222 Ga0439456_143339 3300042013 Unclassified 555
223 Ga0439446_0316301 3300042156 Bacteria 551
224 Ga0439434_0033857 3300042435 Bacteria 1559
225 Ga0439459_0094391 3300042438 Bacteria 724
226 Ga0439460_0151765 3300042461 Unclassified 773
227 Ga0451577_0169010 3300042876 Bacteria 1970
228 Ga0451577_0274678 3300042876 Bacteria 1526
229 Ga0451577_0915583 3300042876 Bacteria 789
230 Ga0453683_0035973 3300044673 Bacteria 3118
231 Ga0453684_0262675 3300044712 Bacteria 1977
232 Ga0453684_0301585 3300044712 Bacteria 1821
233 Ga0451576_0052628 3300045051 Bacteria 4267
234 Ga0451576_0414257 3300045051 Bacteria 1413
235 Ga0495641_0261405 3300046461 Bacteria 779
236 Ga0495651_0008848 3300046462 Bacteria 7727
237 Ga0495664_0333549 3300046477 Bacteria 914
238 Ga0495618_0055322 3300046514 Unclassified 2512
239 Ga0495628_0494436 3300046516 Bacteria 884
240 Ga0495628_0899704 3300046516 Bacteria 614
241 Ga0495642_0217369 3300046528 Bacteria 834
242 Ga0495640_0359565 3300046533 Bacteria 898
243 Ga0495587_0327161 3300046536 Bacteria 856
244 Ga0495634_0332967 3300046642 Bacteria 912
245 Ga0495635_1014230 3300046663 Unclassified 528
246 Ga0495599_0180164 3300046678 Bacteria 1303
247 Ga0495599_0255911 3300046678 Bacteria 1065
248 Ga0495623_0102067 3300046679 Unclassified 1747
249 Ga0495658_0445679 3300046683 Bacteria 827
250 Ga0495624_0436779 3300046690 Bacteria 785
251 Ga0495674_0114531 3300047319 Unclassified 2283
252 Ga0495674_0306440 3300047319 Unclassified 1296
253 Ga0495680_0372786 3300047322 Bacteria 990
254 Ga0495602_0645813 3300048088 Bacteria 723
255 Ga0496100_1416549 3300048903 Bacteria 549
256 Ga0496101_1175377 3300048904 Unclassified 601
257 Ga0496103_0791179 3300048906 Unclassified 598
258 Ga0496104_0104867 3300048907 Unclassified 2709
259 Ga0496104_0432061 3300048907 Bacteria 1229
260 Ga0496105_0058520 3300048908 Bacteria 3181
261 Ga0496105_0637432 3300048908 Bacteria 823
262 Ga0496106_0257849 3300048909 Bacteria 1395
263 Ga0496106_0320866 3300048909 Bacteria 1243
264 Ga0496107_0455286 3300048910 Unclassified 950
265 Ga0496107_0482103 3300048910 Unclassified 920
266 Ga0496108_0145104 3300048911 Bacteria 2046
267 Ga0496108_0381670 3300048911 Bacteria 1230
268 Ga0496108_0598477 3300048911 Bacteria 961
269 Ga0496109_0018038 3300048912 Bacteria 6195
270 Ga0496109_0052838 3300048912 Bacteria 3704
271 Ga0496109_0067175 3300048912 Archaea 3284
272 Ga0496109_0357235 3300048912 Bacteria 1380
273 Ga0496109_0864557 3300048912 Bacteria 842
274 Ga0496110_0546471 3300048913 Unclassified 1053
275 Ga0496110_0880672 3300048913 Bacteria 801
276 Ga0496111_0147274 3300048914 Bacteria 1746
277 Ga0496112_0000001 3300048915 Bacteria 1346031
278 Ga0496112_0034348 3300048915 Bacteria 4935
279 Ga0496112_0778062 3300048915 Bacteria 882
280 Ga0496112_1012796 3300048915 Bacteria 750
281 Ga0496112_1117273 3300048915 Bacteria 706
282 Ga0496113_0215464 3300048916 Bacteria 1529
283 Ga0496113_0471817 3300048916 Bacteria 1008
284 Ga0501031_0015234 3300049568 Bacteria 4992
285 Ga0501032_0382040 3300049569 Bacteria 906
286 Ga0501036_0123937 3300049572 Bacteria 2182
287 Ga0501036_0140303 3300049572 Bacteria 2040
288 Ga0501036_0196527 3300049572 Bacteria 1697
289 Ga0501036_0525682 3300049572 Unclassified 984
290 Ga0501037_0087796 3300049573 Bacteria 2251
291 Ga0501038_0485428 3300049574 Unclassified 946
292 Ga0501038_0614002 3300049574 Bacteria 822
293 Ga0501040_0177863 3300049576 Unclassified 1507
294 Ga0501040_0666811 3300049576 Bacteria 752
295 Ga0501041_0192835 3300049577 Bacteria 1277
296 Ga0501042_0057757 3300049578 Unclassified 2769
297 Ga0501042_0077134 3300049578 Bacteria 2386
298 Ga0501043_0184286 3300049579 Bacteria 1626
299 Ga0501046_0056682 3300049580 Unclassified 3075
300 Ga0501048_0632337 3300049582 Bacteria 768
301 Ga0501048_1276938 3300049582 Bacteria 528
302 Ga0501067_0107707 3300049583 Unclassified 1549
303 Ga0501068_0049620 3300049584 Bacteria 2535
304 Ga0501068_0173338 3300049584 Unclassified 1362
305 Ga0501068_0749598 3300049584 Bacteria 639
306 Ga0501071_0050672 3300049587 Bacteria 2991
307 Ga0501071_0090471 3300049587 Unclassified 2247
308 Ga0501071_0372445 3300049587 Bacteria 1088
309 Ga0501072_0131041 3300049588 Unclassified 1998
310 Ga0501072_0250898 3300049588 Bacteria 1409
311 Ga0501072_0569331 3300049588 Unclassified 894
312 Ga0501074_0074041 3300049590 Unclassified 2446
313 Ga0501075_0025587 3300049591 Bacteria 4336
314 Ga0501075_0204358 3300049591 Unclassified 1507
315 Ga0501075_0499282 3300049591 Bacteria 928
316 Ga0501075_0993495 3300049591 Unclassified 638
317 Ga0501076_0030849 3300049592 Bacteria 4176
318 Ga0501076_0054944 3300049592 Unclassified 3157
319 Ga0501076_0069137 3300049592 Unclassified 2822
320 Ga0501079_0142991 3300049741 Bacteria 1864
321 Ga0501079_0145295 3300049741 Unclassified 1848
322 Ga0501079_0341010 3300049741 Bacteria 1174
323 Ga0501079_0464631 3300049741 Unclassified 994
324 Ga0501080_0189324 3300049742 Unclassified 1891
325 Ga0501081_0246245 3300049743 Bacteria 1304
326 Ga0501083_0068472 3300049744 Bacteria 2362
327 Ga0501035_0450303 3300049822 Bacteria 1065
328 Ga0501045_0044403 3300049824 Unclassified 3237
329 Ga0501045_0307551 3300049824 Unclassified 1180
330 nmdc:mga05p37_32978_c1 3300050507 Bacteria 6341
331 nmdc:mga05p37_572185_c1 3300050507 Unclassified 1281
332 nmdc:mga09592_84370_c1 3300050508 Bacteria 2708
333 nmdc:mga06r32_25214_c1 3300050510 Bacteria 5529
334 nmdc:mga08y16_230440_c1 3300050511 Bacteria 1916
335 nmdc:mga0n895_167202_c1 3300050512 Bacteria 2231
336 nmdc:mga0rr50_220352_c1 3300050513 Bacteria 1566
337 nmdc:mga0rr50_416633_c1 3300050513 Bacteria 1136
338 nmdc:mga0a205_147715_c1 3300050515 Bacteria 2251
339 nmdc:mga0a205_728751_c1 3300050515 Bacteria 841
340 Ga0495601_0022682 3300053077 Bacteria 3857
341 Ga0495601_0220027 3300053077 Bacteria 1240
342 Ga0495612_0137169 3300053078 Bacteria 1060
343 Ga0495595_0241618 3300053084 Bacteria 903
344 Ga0495619_0070348 3300053085 Bacteria 2340
345 Ga0495619_0414844 3300053085 Unclassified 929
346 Ga0501084_0124074 3300054114 Unclassified 2172
347 Ga0501084_0550458 3300054114 Bacteria 975
348 Ga0501084_0571707 3300054114 Bacteria 955
349 Ga0501082_0029420 3300060353 Bacteria 4733
350 Ga0501082_0057041 3300060353 Bacteria 3365

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0432061 Ga0496104_0432061_58_507 119
2 3300048908 Ga0496105_0058520 Ga0496105_0058520_2647_3066 119
3 3300048911 Ga0496108_0598477 Ga0496108_0598477_299_718 119
4 3300048912 Ga0496109_0357235 Ga0496109_0357235_318_737 119
5 3300048913 Ga0496110_0880672 Ga0496110_0880672_284_700 119
6 3300048915 Ga0496112_0000001 Ga0496112_0000001_174615_175067 119
7 3300005439 Ga0070711_100394469 Ga0070711_1003944692 120
8 3300009147 Ga0114129_12424105 Ga0114129_124241051 120
9 3300013104 Ga0157370_10616045 Ga0157370_106160452 120
10 3300017792 Ga0163161_10234027 Ga0163161_102340272 120
11 3300025916 Ga0207663_10705412 Ga0207663_107054121 120
12 3300025920 Ga0207649_11273478 Ga0207649_112734781 120
13 3300025926 Ga0207659_10195500 Ga0207659_101955002 120
14 3300026095 Ga0207676_11724659 Ga0207676_117246591 120
15 3300026121 Ga0207683_10146023 Ga0207683_101460232 120
16 3300041486 Ga0451807_1075610 Ga0451807_1075610_174_632 120
17 3300042876 Ga0451577_0169010 Ga0451577_0169010_449_913 120
18 3300044673 Ga0453683_0035973 Ga0453683_0035973_976_1440 120
19 3300044712 Ga0453684_0262675 Ga0453684_0262675_194_658 120
20 3300044712 Ga0453684_0301585 Ga0453684_0301585_232_756 120
21 3300045051 Ga0451576_0414257 Ga0451576_0414257_715_1179 120
22 3300046663 Ga0495635_1014230 Ga0495635_1014230_74_487 120
23 3300048915 Ga0496112_0778062 Ga0496112_0778062_32_394 120
24 3300048915 Ga0496112_1117273 Ga0496112_1117273_102_542 120
25 3300005330 Ga0070690_100057315 Ga0070690_1000573152 121
26 3300005457 Ga0070662_100409487 Ga0070662_1004094872 121
27 3300005578 Ga0068854_100016634 Ga0068854_1000166347 121
28 3300005719 Ga0068861_100310868 Ga0068861_1003108682 121
29 3300009098 Ga0105245_10661124 Ga0105245_106611242 121
30 3300013307 Ga0157372_10805374 Ga0157372_108053742 121
31 3300025927 Ga0207687_10181776 Ga0207687_101817762 121
32 3300025933 Ga0207706_10080636 Ga0207706_100806366 121
33 3300025981 Ga0207640_10310616 Ga0207640_103106163 121
34 3300026075 Ga0207708_10527479 Ga0207708_105274792 121
35 3300026118 Ga0207675_100238851 Ga0207675_1002388513 121
36 3300005366 Ga0070659_101468545 Ga0070659_1014685451 123
37 3300005441 Ga0070700_100671796 Ga0070700_1006717961 123
38 3300005719 Ga0068861_101297705 Ga0068861_1012977052 123
39 3300005719 Ga0068861_102015722 Ga0068861_1020157221 123
40 3300009094 Ga0111539_10106073 Ga0111539_101060732 123
41 3300009553 Ga0105249_10792404 Ga0105249_107924042 123
42 3300025961 Ga0207712_10789241 Ga0207712_107892411 123
43 3300026075 Ga0207708_10780649 Ga0207708_107806492 123
44 3300026118 Ga0207675_101576692 Ga0207675_1015766921 123
45 3300027665 Ga0209983_1052338 Ga0209983_10523382 123
46 3300031731 Ga0307405_11013409 Ga0307405_110134092 123
47 3300042156 Ga0439446_0316301 Ga0439446_0316301_102_521 123
48 3300042435 Ga0439434_0033857 Ga0439434_0033857_824_1243 123
49 3300035398 Ga0316574_0627940 Ga0316574_0627940_224_607 124
50 3300046528 Ga0495642_0217369 Ga0495642_0217369_372_815 124
51 3300005338 Ga0068868_100115183 Ga0068868_1001151834 125
52 3300005343 Ga0070687_100522883 Ga0070687_1005228832 125
53 3300005345 Ga0070692_11066413 Ga0070692_110664131 125
54 3300005364 Ga0070673_101467791 Ga0070673_1014677911 125
55 3300005440 Ga0070705_100363031 Ga0070705_1003630311 125
56 3300005440 Ga0070705_100479431 Ga0070705_1004794311 125
57 3300005518 Ga0070699_100084848 Ga0070699_1000848483 125
58 3300005545 Ga0070695_100459143 Ga0070695_1004591432 125
59 3300005615 Ga0070702_100037759 Ga0070702_1000377592 125
60 3300005615 Ga0070702_100808378 Ga0070702_1008083781 125
61 3300009098 Ga0105245_10056547 Ga0105245_100565472 125
62 3300009098 Ga0105245_10725150 Ga0105245_107251502 125
63 3300009148 Ga0105243_10132369 Ga0105243_101323691 125
64 3300013297 Ga0157378_10123217 Ga0157378_101232174 125
65 3300014745 Ga0157377_11096317 Ga0157377_110963171 125
66 3300017792 Ga0163161_10681813 Ga0163161_106818132 125
67 3300025907 Ga0207645_10154332 Ga0207645_101543322 125
68 3300025918 Ga0207662_10505946 Ga0207662_105059461 125
69 3300025927 Ga0207687_10176854 Ga0207687_101768542 125
70 3300025927 Ga0207687_10813343 Ga0207687_108133431 125
71 3300025937 Ga0207669_11275107 Ga0207669_112751071 125
72 3300025941 Ga0207711_11249208 Ga0207711_112492081 125
73 3300025972 Ga0207668_10562733 Ga0207668_105627331 125
74 3300026075 Ga0207708_10125650 Ga0207708_101256502 125
75 3300026089 Ga0207648_10592376 Ga0207648_105923761 125
76 3300048909 Ga0496106_0320866 Ga0496106_0320866_338_775 125
77 3300048912 Ga0496109_0864557 Ga0496109_0864557_378_815 125
78 3300049591 Ga0501075_0204358 Ga0501075_0204358_107_520 125
79 3300049592 Ga0501076_0069137 Ga0501076_0069137_2079_2492 125
80 3300049741 Ga0501079_0464631 Ga0501079_0464631_546_959 125
81 3300005546 Ga0070696_100441251 Ga0070696_1004412512 126
82 3300014497 Ga0182008_10319889 Ga0182008_103198891 126
83 3300005364 Ga0070673_101805803 Ga0070673_1018058031 127
84 3300005445 Ga0070708_100134001 Ga0070708_1001340012 127
85 3300006852 Ga0075433_10146421 Ga0075433_101464212 127
86 3300006871 Ga0075434_100184260 Ga0075434_1001842601 127
87 3300007076 Ga0075435_100841189 Ga0075435_1008411892 127
88 3300025960 Ga0207651_11263021 Ga0207651_112630212 127
89 3300036401 Ga0373937_0105570 Ga0373937_0105570_10_453 127
90 3300042876 Ga0451577_0915583 Ga0451577_0915583_291_731 127
91 3300049587 Ga0501071_0372445 Ga0501071_0372445_506_940 127
92 3300050512 nmdc:mga0n895_167202_c1 nmdc:mga0n895_167202_c1_222_653 127
93 3300050513 nmdc:mga0rr50_220352_c1 nmdc:mga0rr50_220352_c1_384_815 127
94 3300050515 nmdc:mga0a205_147715_c1 nmdc:mga0a205_147715_c1_28_459 127
95 3300011119 Ga0105246_10907608 Ga0105246_109076082 128
96 3300005468 Ga0070707_100009619 Ga0070707_1000096193 129
97 3300005536 Ga0070697_100019335 Ga0070697_1000193358 129
98 3300005549 Ga0070704_100039011 Ga0070704_1000390111 129
99 3300005985 Ga0081539_10325293 Ga0081539_103252931 129
100 3300025922 Ga0207646_10013141 Ga0207646_100131413 129
101 3300042876 Ga0451577_0274678 Ga0451577_0274678_652_1098 129
102 3300053085 Ga0495619_0414844 Ga0495619_0414844_327_815 129
103 3300009101 Ga0105247_10190290 Ga0105247_101902901 130
104 3300046462 Ga0495651_0008848 Ga0495651_0008848_915_1340 130
105 3300048088 Ga0495602_0645813 Ga0495602_0645813_130_555 130
106 3300053084 Ga0495595_0241618 Ga0495595_0241618_273_698 130
107 3300005468 Ga0070707_100116309 Ga0070707_1001163092 131
108 3300025922 Ga0207646_10032773 Ga0207646_100327733 131
109 3300005467 Ga0070706_100121235 Ga0070706_1001212354 132
110 3300005471 Ga0070698_100010268 Ga0070698_10001026810 132
111 3300005518 Ga0070699_100019210 Ga0070699_1000192109 132
112 3300006852 Ga0075433_10651956 Ga0075433_106519562 132
113 3300006871 Ga0075434_100521173 Ga0075434_1005211732 132
114 3300009147 Ga0114129_10651918 Ga0114129_106519182 132
115 3300025910 Ga0207684_10065008 Ga0207684_100650082 132
116 3300027876 Ga0209974_10033021 Ga0209974_100330211 132
117 3300036401 Ga0373937_0430526 Ga0373937_0430526_161_586 132
118 3300048912 Ga0496109_0052838 Ga0496109_0052838_223_690 132
119 3300050507 nmdc:mga05p37_32978_c1 nmdc:mga05p37_32978_c1_5459_5902 132
120 3300005353 Ga0070669_100287867 Ga0070669_1002878671 133
121 3300005563 Ga0068855_101747662 Ga0068855_1017476622 133
122 3300005719 Ga0068861_100023534 Ga0068861_1000235344 133
123 3300005981 Ga0081538_10148860 Ga0081538_101488601 133
124 3300006844 Ga0075428_100438656 Ga0075428_1004386562 133
125 3300009094 Ga0111539_11639136 Ga0111539_116391362 133
126 3300009094 Ga0111539_11639137 Ga0111539_116391372 133
127 3300009098 Ga0105245_10211443 Ga0105245_102114432 133
128 3300009147 Ga0114129_10207413 Ga0114129_102074135 133
129 3300009148 Ga0105243_10593585 Ga0105243_105935852 133
130 3300009553 Ga0105249_10806610 Ga0105249_108066101 133
131 3300012492 Ga0157335_1041839 Ga0157335_10418391 133
132 3300014745 Ga0157377_10114929 Ga0157377_101149293 133
133 3300017792 Ga0163161_10289897 Ga0163161_102898972 133
134 3300025901 Ga0207688_10106071 Ga0207688_101060712 133
135 3300025927 Ga0207687_10097723 Ga0207687_100977232 133
136 3300025931 Ga0207644_10451898 Ga0207644_104518982 133
137 3300025935 Ga0207709_10359730 Ga0207709_103597302 133
138 3300025961 Ga0207712_10418888 Ga0207712_104188881 133
139 3300026075 Ga0207708_10082591 Ga0207708_100825912 133
140 3300026118 Ga0207675_100031119 Ga0207675_1000311195 133
141 3300028381 Ga0268264_10678441 Ga0268264_106784412 133
142 3300031824 Ga0307413_10148365 Ga0307413_101483652 133
143 3300031995 Ga0307409_100367333 Ga0307409_1003673332 133
144 3300042013 Ga0439456_143339 Ga0439456_143339_76_480 133
145 3300042461 Ga0439460_0151765 Ga0439460_0151765_103_531 133
146 3300049568 Ga0501031_0015234 Ga0501031_0015234_4548_4952 133
147 3300049572 Ga0501036_0123937 Ga0501036_0123937_1759_2163 133
148 3300049573 Ga0501037_0087796 Ga0501037_0087796_924_1328 133
149 3300049579 Ga0501043_0184286 Ga0501043_0184286_557_961 133
150 3300049584 Ga0501068_0173338 Ga0501068_0173338_159_563 133
151 3300049592 Ga0501076_0030849 Ga0501076_0030849_3106_3510 133
152 3300049744 Ga0501083_0068472 Ga0501083_0068472_20_424 133
153 3300050511 nmdc:mga08y16_230440_c1 nmdc:mga08y16_230440_c1_1186_1590 133
154 3300060353 Ga0501082_0029420 Ga0501082_0029420_2786_3190 133
155 3300010375 Ga0105239_11933632 Ga0105239_119336321 134
156 3300026118 Ga0207675_100562968 Ga0207675_1005629681 134
157 3300005440 Ga0070705_100139267 Ga0070705_1001392672 136
158 3300005445 Ga0070708_101444669 Ga0070708_1014446691 136
159 3300005458 Ga0070681_10193255 Ga0070681_101932552 136
160 3300005467 Ga0070706_100273028 Ga0070706_1002730282 136
161 3300005467 Ga0070706_100369274 Ga0070706_1003692741 136
162 3300005518 Ga0070699_100396806 Ga0070699_1003968061 136
163 3300005536 Ga0070697_101058768 Ga0070697_1010587682 136
164 3300005545 Ga0070695_100018988 Ga0070695_1000189885 136
165 3300005545 Ga0070695_100397930 Ga0070695_1003979302 136
166 3300005546 Ga0070696_100006828 Ga0070696_1000068284 136
167 3300005546 Ga0070696_100009844 Ga0070696_1000098445 136
168 3300005547 Ga0070693_100332887 Ga0070693_1003328872 136
169 3300005549 Ga0070704_100067156 Ga0070704_1000671562 136
170 3300005549 Ga0070704_100621218 Ga0070704_1006212182 136
171 3300005577 Ga0068857_100684806 Ga0068857_1006848062 136
172 3300005578 Ga0068854_100565627 Ga0068854_1005656272 136
173 3300005617 Ga0068859_100171116 Ga0068859_1001711162 136
174 3300006844 Ga0075428_100000259 Ga0075428_10000025923 136
175 3300006847 Ga0075431_100218239 Ga0075431_1002182392 136
176 3300006852 Ga0075433_10174493 Ga0075433_101744932 136
177 3300006931 Ga0097620_100171117 Ga0097620_1001711172 136
178 3300009147 Ga0114129_11212085 Ga0114129_112120852 136
179 3300025910 Ga0207684_10339891 Ga0207684_103398911 136
180 3300025927 Ga0207687_11739769 Ga0207687_117397691 136
181 3300042438 Ga0439459_0094391 Ga0439459_0094391_118_531 136
182 3300046514 Ga0495618_0055322 Ga0495618_0055322_853_1371 136
183 3300046690 Ga0495624_0436779 Ga0495624_0436779_229_639 136
184 3300047319 Ga0495674_0114531 Ga0495674_0114531_721_1239 136
185 3300048906 Ga0496103_0791179 Ga0496103_0791179_125_538 136
186 3300049569 Ga0501032_0382040 Ga0501032_0382040_327_740 136
187 3300049572 Ga0501036_0140303 Ga0501036_0140303_886_1299 136
188 3300049574 Ga0501038_0614002 Ga0501038_0614002_101_514 136
189 3300049576 Ga0501040_0666811 Ga0501040_0666811_302_715 136
190 3300049577 Ga0501041_0192835 Ga0501041_0192835_408_821 136
191 3300049578 Ga0501042_0077134 Ga0501042_0077134_1816_2229 136
192 3300049583 Ga0501067_0107707 Ga0501067_0107707_995_1408 136
193 3300049584 Ga0501068_0749598 Ga0501068_0749598_147_560 136
194 3300049588 Ga0501072_0250898 Ga0501072_0250898_982_1395 136
195 3300049591 Ga0501075_0499282 Ga0501075_0499282_369_782 136
196 3300049741 Ga0501079_0341010 Ga0501079_0341010_474_887 136
197 3300049743 Ga0501081_0246245 Ga0501081_0246245_322_735 136
198 3300050508 nmdc:mga09592_84370_c1 nmdc:mga09592_84370_c1_544_987 136
199 3300050510 nmdc:mga06r32_25214_c1 nmdc:mga06r32_25214_c1_653_1096 136
200 3300054114 Ga0501084_0550458 Ga0501084_0550458_459_872 136
201 3300005355 Ga0070671_101184579 Ga0070671_1011845792 137
202 3300005367 Ga0070667_100454871 Ga0070667_1004548712 137
203 3300005616 Ga0068852_100411584 Ga0068852_1004115842 137
204 3300005842 Ga0068858_100328180 Ga0068858_1003281802 137
205 3300006358 Ga0068871_100927175 Ga0068871_1009271752 137
206 3300009098 Ga0105245_10159430 Ga0105245_101594304 137
207 3300009098 Ga0105245_10283798 Ga0105245_102837982 137
208 3300013297 Ga0157378_12465837 Ga0157378_124658371 137
209 3300013306 Ga0163162_10327580 Ga0163162_103275802 137
210 3300013308 Ga0157375_10093563 Ga0157375_100935635 137
211 3300014325 Ga0163163_10185944 Ga0163163_101859442 137
212 3300014497 Ga0182008_10421628 Ga0182008_104216281 137
213 3300014968 Ga0157379_10491479 Ga0157379_104914792 137
214 3300025927 Ga0207687_10096914 Ga0207687_100969142 137
215 3300025927 Ga0207687_10276974 Ga0207687_102769742 137
216 3300025986 Ga0207658_10896824 Ga0207658_108968242 137
217 3300026023 Ga0207677_10220740 Ga0207677_102207402 137
218 3300026035 Ga0207703_10180891 Ga0207703_101808914 137
219 3300046461 Ga0495641_0261405 Ga0495641_0261405_220_636 137
220 3300046516 Ga0495628_0899704 Ga0495628_0899704_191_604 137
221 3300046642 Ga0495634_0332967 Ga0495634_0332967_463_879 137
222 3300046678 Ga0495599_0180164 Ga0495599_0180164_766_1227 137
223 3300046683 Ga0495658_0445679 Ga0495658_0445679_287_703 137
224 3300048903 Ga0496100_1416549 Ga0496100_1416549_29_442 137
225 3300048904 Ga0496101_1175377 Ga0496101_1175377_26_487 137
226 3300048907 Ga0496104_0104867 Ga0496104_0104867_1884_2300 137
227 3300048908 Ga0496105_0637432 Ga0496105_0637432_199_615 137
228 3300048909 Ga0496106_0257849 Ga0496106_0257849_410_826 137
229 3300048910 Ga0496107_0482103 Ga0496107_0482103_172_588 137
230 3300048911 Ga0496108_0145104 Ga0496108_0145104_303_716 137
231 3300048911 Ga0496108_0381670 Ga0496108_0381670_637_1053 137
232 3300048912 Ga0496109_0018038 Ga0496109_0018038_5731_6144 137
233 3300048912 Ga0496109_0067175 Ga0496109_0067175_674_1090 137
234 3300048913 Ga0496110_0546471 Ga0496110_0546471_552_968 137
235 3300048914 Ga0496111_0147274 Ga0496111_0147274_1150_1563 137
236 3300048915 Ga0496112_0034348 Ga0496112_0034348_71_484 137
237 3300048915 Ga0496112_1012796 Ga0496112_1012796_299_715 137
238 3300048916 Ga0496113_0215464 Ga0496113_0215464_538_954 137
239 3300048916 Ga0496113_0471817 Ga0496113_0471817_302_715 137
240 3300053077 Ga0495601_0220027 Ga0495601_0220027_636_1049 137
241 3300053085 Ga0495619_0070348 Ga0495619_0070348_959_1372 137
242 3300005334 Ga0068869_101797854 Ga0068869_1017978541 138
243 3300005444 Ga0070694_100023351 Ga0070694_1000233512 138
244 3300005455 Ga0070663_101175319 Ga0070663_1011753191 138
245 3300005471 Ga0070698_100076253 Ga0070698_1000762535 138
246 3300005549 Ga0070704_100030959 Ga0070704_1000309592 138
247 3300005563 Ga0068855_100396150 Ga0068855_1003961502 138
248 3300005614 Ga0068856_101672389 Ga0068856_1016723891 138
249 3300005843 Ga0068860_100021120 Ga0068860_1000211202 138
250 3300005844 Ga0068862_100044471 Ga0068862_1000444712 138
251 3300009098 Ga0105245_11702852 Ga0105245_117028521 138
252 3300009176 Ga0105242_11652346 Ga0105242_116523461 138
253 3300009553 Ga0105249_10953370 Ga0105249_109533703 138
254 3300025912 Ga0207707_10589570 Ga0207707_105895702 138
255 3300025922 Ga0207646_10418273 Ga0207646_104182731 138
256 3300026121 Ga0207683_11212874 Ga0207683_112128742 138
257 3300028380 Ga0268265_10167883 Ga0268265_101678832 138
258 3300028381 Ga0268264_10209094 Ga0268264_102090942 138
259 3300045051 Ga0451576_0052628 Ga0451576_0052628_1336_1755 138
260 3300049582 Ga0501048_1276938 Ga0501048_1276938_86_508 138
261 3300049588 Ga0501072_0569331 Ga0501072_0569331_413_835 138
262 3300005843 Ga0068860_101161099 Ga0068860_1011610992 139
263 3300032126 Ga0307415_101845921 Ga0307415_1018459212 139
264 3300036401 Ga0373937_0788698 Ga0373937_0788698_219_641 139
265 3300046477 Ga0495664_0333549 Ga0495664_0333549_235_660 139
266 3300046516 Ga0495628_0494436 Ga0495628_0494436_66_491 139
267 3300046533 Ga0495640_0359565 Ga0495640_0359565_53_478 139
268 3300046536 Ga0495587_0327161 Ga0495587_0327161_276_701 139
269 3300046678 Ga0495599_0255911 Ga0495599_0255911_317_742 139
270 3300046679 Ga0495623_0102067 Ga0495623_0102067_87_512 139
271 3300047319 Ga0495674_0306440 Ga0495674_0306440_371_796 139
272 3300047322 Ga0495680_0372786 Ga0495680_0372786_235_660 139
273 3300049572 Ga0501036_0196527 Ga0501036_0196527_1142_1567 139
274 3300049572 Ga0501036_0525682 Ga0501036_0525682_188_610 139
275 3300049574 Ga0501038_0485428 Ga0501038_0485428_455_880 139
276 3300049576 Ga0501040_0177863 Ga0501040_0177863_129_554 139
277 3300049578 Ga0501042_0057757 Ga0501042_0057757_65_490 139
278 3300049580 Ga0501046_0056682 Ga0501046_0056682_1156_1581 139
279 3300049582 Ga0501048_0632337 Ga0501048_0632337_171_596 139
280 3300049587 Ga0501071_0090471 Ga0501071_0090471_330_755 139
281 3300049588 Ga0501072_0131041 Ga0501072_0131041_1213_1638 139
282 3300049590 Ga0501074_0074041 Ga0501074_0074041_1506_1931 139
283 3300049591 Ga0501075_0025587 Ga0501075_0025587_3162_3587 139
284 3300049591 Ga0501075_0993495 Ga0501075_0993495_45_467 139
285 3300049592 Ga0501076_0054944 Ga0501076_0054944_1740_2165 139
286 3300049741 Ga0501079_0142991 Ga0501079_0142991_474_899 139
287 3300049741 Ga0501079_0145295 Ga0501079_0145295_1138_1563 139
288 3300049742 Ga0501080_0189324 Ga0501080_0189324_512_937 139
289 3300049822 Ga0501035_0450303 Ga0501035_0450303_222_647 139
290 3300049824 Ga0501045_0044403 Ga0501045_0044403_246_671 139
291 3300049824 Ga0501045_0307551 Ga0501045_0307551_389_814 139
292 3300050507 nmdc:mga05p37_572185_c1 nmdc:mga05p37_572185_c1_509_928 139
293 3300053077 Ga0495601_0022682 Ga0495601_0022682_3173_3598 139
294 3300053078 Ga0495612_0137169 Ga0495612_0137169_467_892 139
295 3300054114 Ga0501084_0124074 Ga0501084_0124074_929_1354 139
296 3300054114 Ga0501084_0571707 Ga0501084_0571707_432_857 139
297 3300060353 Ga0501082_0057041 Ga0501082_0057041_2528_2953 139
298 3300005445 Ga0070708_100762679 Ga0070708_1007626792 140
299 3300005468 Ga0070707_100314544 Ga0070707_1003145442 140
300 3300005535 Ga0070684_100759767 Ga0070684_1007597671 140
301 3300005536 Ga0070697_100205403 Ga0070697_1002054032 140
302 3300005536 Ga0070697_100277780 Ga0070697_1002777802 140
303 3300005618 Ga0068864_100008744 Ga0068864_1000087446 140
304 3300005841 Ga0068863_100110111 Ga0068863_1001101113 140
305 3300006358 Ga0068871_101128103 Ga0068871_1011281032 140
306 3300013297 Ga0157378_10876057 Ga0157378_108760572 140
307 3300014325 Ga0163163_10684698 Ga0163163_106846982 140
308 3300014968 Ga0157379_10248430 Ga0157379_102484302 140
309 3300025922 Ga0207646_10985064 Ga0207646_109850642 140
310 3300026088 Ga0207641_10182108 Ga0207641_101821083 140
311 3300026095 Ga0207676_10044588 Ga0207676_100445883 140
312 3300049584 Ga0501068_0049620 Ga0501068_0049620_1942_2364 140
313 3300049587 Ga0501071_0050672 Ga0501071_0050672_642_1064 140
314 3300005336 Ga0070680_100000002 Ga0070680_10000000222 141
315 3300005356 Ga0070674_100769605 Ga0070674_1007696051 141
316 3300025917 Ga0207660_10000002 Ga0207660_10000002630 141
317 3300032133 Ga0316583_10044840 Ga0316583_100448402 141
318 3300005341 Ga0070691_10371900 Ga0070691_103719002 142
319 3300005343 Ga0070687_100233304 Ga0070687_1002333042 142
320 3300005468 Ga0070707_101496529 Ga0070707_1014965291 142
321 3300005530 Ga0070679_100396597 Ga0070679_1003965971 142
322 3300005544 Ga0070686_100299320 Ga0070686_1002993202 142
323 3300005547 Ga0070693_100068226 Ga0070693_1000682264 142
324 3300005549 Ga0070704_100361913 Ga0070704_1003619131 142
325 3300006852 Ga0075433_10075192 Ga0075433_100751923 142
326 3300009177 Ga0105248_10980270 Ga0105248_109802701 142
327 3300009553 Ga0105249_10844715 Ga0105249_108447151 142
328 3300010375 Ga0105239_10085897 Ga0105239_100858974 142
329 3300010375 Ga0105239_11996710 Ga0105239_119967102 142
330 3300011119 Ga0105246_10201505 Ga0105246_102015051 142
331 3300013297 Ga0157378_10097642 Ga0157378_100976422 142
332 3300025885 Ga0207653_10141234 Ga0207653_101412341 142
333 3300025903 Ga0207680_10771085 Ga0207680_107710851 142
334 3300025911 Ga0207654_11002175 Ga0207654_110021752 142
335 3300025918 Ga0207662_10326716 Ga0207662_103267162 142
336 3300025922 Ga0207646_11458057 Ga0207646_114580571 142
337 3300025933 Ga0207706_10161839 Ga0207706_101618392 142
338 3300026095 Ga0207676_11139575 Ga0207676_111395752 142
339 3300048910 Ga0496107_0455286 Ga0496107_0455286_165_593 142
340 3300050513 nmdc:mga0rr50_416633_c1 nmdc:mga0rr50_416633_c1_583_1011 142
341 3300050515 nmdc:mga0a205_728751_c1 nmdc:mga0a205_728751_c1_236_664 142
342 3300003320 rootH2_10220741 rootH2_102207413 143
343 3300005471 Ga0070698_100020249 Ga0070698_1000202499 143
344 3300005518 Ga0070699_100036457 Ga0070699_1000364576 143
345 3300005518 Ga0070699_100931587 Ga0070699_1009315871 143
346 3300005546 Ga0070696_100001227 Ga0070696_1000012272 143
347 3300005546 Ga0070696_100672271 Ga0070696_1006722711 143
348 3300009176 Ga0105242_10143513 Ga0105242_101435133 143
349 3300025922 Ga0207646_10168860 Ga0207646_101688603 143
350 3300025934 Ga0207686_10105260 Ga0207686_101052602 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09862

DUF2089

Domain of unknown function (DUF2089)-HTH

42

88

0.98

PF22747

DUF2089_Zn_ribbon

DUF2089 zinc ribbon

9

40

0.98

Feature Viewer

pLDDT pTM Quality
61.8 0.3 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map