F418248
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 350 | 198 | 350 | 135 |
Family's Representative Sequence
| Representative Sequence | 3300014497|Ga0182008_10421628|Ga0182008_104216281 |
| Length | 156 |
| Sequence | MTRDVIATCPVCEGELQVSRLRCTTCGTAIEGQFSVGRFGRLSREQMYLLESFLRARGNLRDMERELGISYPTVRNRVEGLVRALGLGDGEAPSAAEPEPPAQAAPHIAAHRREVLERLARHDITAEQAAAELKGEVAAGAISSDAKPEAIHDQSD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 75 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 116 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 117 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 118 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 119 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 120 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 121 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 123 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 124 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 125 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 126 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 127 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 128 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 129 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 130 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 131 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 132 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 152 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 153 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 154 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 155 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 156 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 159 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 160 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 161 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 162 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.57 |
| Rhizosphere | 91.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10220741 | 3300003320 | Bacteria | 3555 |
| 2 | Ga0070690_100057315 | 3300005330 | Bacteria | 2500 |
| 3 | Ga0068869_101797854 | 3300005334 | Bacteria | 548 |
| 4 | Ga0070680_100000002 | 3300005336 | Bacteria | 211003 |
| 5 | Ga0068868_100115183 | 3300005338 | Bacteria | 2188 |
| 6 | Ga0070691_10371900 | 3300005341 | Unclassified | 799 |
| 7 | Ga0070687_100233304 | 3300005343 | Unclassified | 1133 |
| 8 | Ga0070687_100522883 | 3300005343 | Bacteria | 803 |
| 9 | Ga0070692_11066413 | 3300005345 | Bacteria | 569 |
| 10 | Ga0070669_100287867 | 3300005353 | Bacteria | 1318 |
| 11 | Ga0070671_101184579 | 3300005355 | Unclassified | 672 |
| 12 | Ga0070674_100769605 | 3300005356 | Bacteria | 829 |
| 13 | Ga0070673_101467791 | 3300005364 | Bacteria | 643 |
| 14 | Ga0070673_101805803 | 3300005364 | Unclassified | 579 |
| 15 | Ga0070659_101468545 | 3300005366 | Bacteria | 607 |
| 16 | Ga0070667_100454871 | 3300005367 | Bacteria | 1170 |
| 17 | Ga0070711_100394469 | 3300005439 | Bacteria | 1122 |
| 18 | Ga0070705_100139267 | 3300005440 | Unclassified | 1595 |
| 19 | Ga0070705_100363031 | 3300005440 | Bacteria | 1060 |
| 20 | Ga0070705_100479431 | 3300005440 | Bacteria | 940 |
| 21 | Ga0070700_100671796 | 3300005441 | Unclassified | 820 |
| 22 | Ga0070694_100023351 | 3300005444 | Bacteria | 3976 |
| 23 | Ga0070708_100134001 | 3300005445 | Bacteria | 2294 |
| 24 | Ga0070708_100762679 | 3300005445 | Bacteria | 910 |
| 25 | Ga0070708_101444669 | 3300005445 | Unclassified | 641 |
| 26 | Ga0070663_101175319 | 3300005455 | Bacteria | 673 |
| 27 | Ga0070662_100409487 | 3300005457 | Bacteria | 1120 |
| 28 | Ga0070681_10193255 | 3300005458 | Unclassified | 1955 |
| 29 | Ga0070706_100121235 | 3300005467 | Bacteria | 2437 |
| 30 | Ga0070706_100273028 | 3300005467 | Bacteria | 1578 |
| 31 | Ga0070706_100369274 | 3300005467 | Unclassified | 1337 |
| 32 | Ga0070707_100009619 | 3300005468 | Bacteria | 8980 |
| 33 | Ga0070707_100116309 | 3300005468 | Bacteria | 2595 |
| 34 | Ga0070707_100314544 | 3300005468 | Bacteria | 1522 |
| 35 | Ga0070707_101496529 | 3300005468 | Bacteria | 642 |
| 36 | Ga0070698_100010268 | 3300005471 | Bacteria | 10002 |
| 37 | Ga0070698_100020249 | 3300005471 | Bacteria | 6974 |
| 38 | Ga0070698_100076253 | 3300005471 | Bacteria | 3355 |
| 39 | Ga0070699_100019210 | 3300005518 | Bacteria | 5880 |
| 40 | Ga0070699_100036457 | 3300005518 | Bacteria | 4254 |
| 41 | Ga0070699_100084848 | 3300005518 | Bacteria | 2764 |
| 42 | Ga0070699_100396806 | 3300005518 | Bacteria | 1247 |
| 43 | Ga0070699_100931587 | 3300005518 | Bacteria | 796 |
| 44 | Ga0070679_100396597 | 3300005530 | Bacteria | 1326 |
| 45 | Ga0070684_100759767 | 3300005535 | Bacteria | 905 |
| 46 | Ga0070697_100019335 | 3300005536 | Bacteria | 5380 |
| 47 | Ga0070697_100205403 | 3300005536 | Bacteria | 1675 |
| 48 | Ga0070697_100277780 | 3300005536 | Bacteria | 1437 |
| 49 | Ga0070697_101058768 | 3300005536 | Bacteria | 722 |
| 50 | Ga0070686_100299320 | 3300005544 | Unclassified | 1192 |
| 51 | Ga0070695_100018988 | 3300005545 | Bacteria | 4180 |
| 52 | Ga0070695_100397930 | 3300005545 | Unclassified | 1043 |
| 53 | Ga0070695_100459143 | 3300005545 | Bacteria | 978 |
| 54 | Ga0070696_100001227 | 3300005546 | Bacteria | 16650 |
| 55 | Ga0070696_100006828 | 3300005546 | Bacteria | 7618 |
| 56 | Ga0070696_100009844 | 3300005546 | Bacteria | 6393 |
| 57 | Ga0070696_100441251 | 3300005546 | Bacteria | 1025 |
| 58 | Ga0070696_100672271 | 3300005546 | Unclassified | 841 |
| 59 | Ga0070693_100068226 | 3300005547 | Bacteria | 2087 |
| 60 | Ga0070693_100332887 | 3300005547 | Unclassified | 1034 |
| 61 | Ga0070704_100030959 | 3300005549 | Unclassified | 3592 |
| 62 | Ga0070704_100039011 | 3300005549 | Bacteria | 3258 |
| 63 | Ga0070704_100067156 | 3300005549 | Unclassified | 2588 |
| 64 | Ga0070704_100361913 | 3300005549 | Unclassified | 1227 |
| 65 | Ga0070704_100621218 | 3300005549 | Unclassified | 951 |
| 66 | Ga0068855_100396150 | 3300005563 | Unclassified | 1514 |
| 67 | Ga0068855_101747662 | 3300005563 | Bacteria | 633 |
| 68 | Ga0068857_100684806 | 3300005577 | Bacteria | 973 |
| 69 | Ga0068854_100016634 | 3300005578 | Bacteria | 4908 |
| 70 | Ga0068854_100565627 | 3300005578 | Bacteria | 966 |
| 71 | Ga0068856_101672389 | 3300005614 | Bacteria | 649 |
| 72 | Ga0070702_100037759 | 3300005615 | Bacteria | 2684 |
| 73 | Ga0070702_100808378 | 3300005615 | Bacteria | 726 |
| 74 | Ga0068852_100411584 | 3300005616 | Bacteria | 1332 |
| 75 | Ga0068859_100171116 | 3300005617 | Bacteria | 2253 |
| 76 | Ga0068864_100008744 | 3300005618 | Bacteria | 8350 |
| 77 | Ga0068861_100023534 | 3300005719 | Bacteria | 4444 |
| 78 | Ga0068861_100310868 | 3300005719 | Unclassified | 1369 |
| 79 | Ga0068861_101297705 | 3300005719 | Unclassified | 708 |
| 80 | Ga0068861_102015722 | 3300005719 | Unclassified | 576 |
| 81 | Ga0068863_100110111 | 3300005841 | Bacteria | 2622 |
| 82 | Ga0068858_100328180 | 3300005842 | Bacteria | 1463 |
| 83 | Ga0068860_100021120 | 3300005843 | Bacteria | 6304 |
| 84 | Ga0068860_101161099 | 3300005843 | Bacteria | 792 |
| 85 | Ga0068862_100044471 | 3300005844 | Unclassified | 3788 |
| 86 | Ga0081538_10148860 | 3300005981 | Bacteria | 1064 |
| 87 | Ga0081539_10325293 | 3300005985 | Bacteria | 653 |
| 88 | Ga0068871_100927175 | 3300006358 | Bacteria | 808 |
| 89 | Ga0068871_101128103 | 3300006358 | Bacteria | 734 |
| 90 | Ga0075428_100000259 | 3300006844 | Bacteria | 52057 |
| 91 | Ga0075428_100438656 | 3300006844 | Bacteria | 1399 |
| 92 | Ga0075431_100218239 | 3300006847 | Bacteria | 1946 |
| 93 | Ga0075433_10075192 | 3300006852 | Bacteria | 2972 |
| 94 | Ga0075433_10146421 | 3300006852 | Bacteria | 2100 |
| 95 | Ga0075433_10174493 | 3300006852 | Unclassified | 1912 |
| 96 | Ga0075433_10651956 | 3300006852 | Bacteria | 923 |
| 97 | Ga0075434_100184260 | 3300006871 | Bacteria | 2108 |
| 98 | Ga0075434_100521173 | 3300006871 | Bacteria | 1209 |
| 99 | Ga0097620_100171117 | 3300006931 | Bacteria | 2253 |
| 100 | Ga0075435_100841189 | 3300007076 | Bacteria | 799 |
| 101 | Ga0111539_10106073 | 3300009094 | Bacteria | 3296 |
| 102 | Ga0111539_11639136 | 3300009094 | Bacteria | 746 |
| 103 | Ga0111539_11639137 | 3300009094 | Bacteria | 746 |
| 104 | Ga0105245_10056547 | 3300009098 | Bacteria | 3526 |
| 105 | Ga0105245_10159430 | 3300009098 | Bacteria | 2140 |
| 106 | Ga0105245_10211443 | 3300009098 | Bacteria | 1867 |
| 107 | Ga0105245_10283798 | 3300009098 | Bacteria | 1619 |
| 108 | Ga0105245_10661124 | 3300009098 | Bacteria | 1076 |
| 109 | Ga0105245_10725150 | 3300009098 | Bacteria | 1029 |
| 110 | Ga0105245_11702852 | 3300009098 | Bacteria | 683 |
| 111 | Ga0105247_10190290 | 3300009101 | Unclassified | 1373 |
| 112 | Ga0114129_10207413 | 3300009147 | Bacteria | 2651 |
| 113 | Ga0114129_10651918 | 3300009147 | Bacteria | 1359 |
| 114 | Ga0114129_11212085 | 3300009147 | Bacteria | 940 |
| 115 | Ga0114129_12424105 | 3300009147 | Unclassified | 628 |
| 116 | Ga0105243_10132369 | 3300009148 | Unclassified | 2117 |
| 117 | Ga0105243_10593585 | 3300009148 | Bacteria | 1065 |
| 118 | Ga0105242_10143513 | 3300009176 | Bacteria | 2074 |
| 119 | Ga0105242_11652346 | 3300009176 | Unclassified | 676 |
| 120 | Ga0105248_10980270 | 3300009177 | Unclassified | 955 |
| 121 | Ga0105249_10792404 | 3300009553 | Bacteria | 1011 |
| 122 | Ga0105249_10806610 | 3300009553 | Bacteria | 1003 |
| 123 | Ga0105249_10844715 | 3300009553 | Unclassified | 981 |
| 124 | Ga0105249_10953370 | 3300009553 | Unclassified | 926 |
| 125 | Ga0105239_10085897 | 3300010375 | Bacteria | 3468 |
| 126 | Ga0105239_11933632 | 3300010375 | Unclassified | 684 |
| 127 | Ga0105239_11996710 | 3300010375 | Bacteria | 673 |
| 128 | Ga0105246_10201505 | 3300011119 | Bacteria | 1547 |
| 129 | Ga0105246_10907608 | 3300011119 | Unclassified | 790 |
| 130 | Ga0157335_1041839 | 3300012492 | Bacteria | 520 |
| 131 | Ga0157370_10616045 | 3300013104 | Bacteria | 993 |
| 132 | Ga0157378_10097642 | 3300013297 | Bacteria | 2678 |
| 133 | Ga0157378_10123217 | 3300013297 | Bacteria | 2392 |
| 134 | Ga0157378_10876057 | 3300013297 | Unclassified | 927 |
| 135 | Ga0157378_12465837 | 3300013297 | Unclassified | 572 |
| 136 | Ga0163162_10327580 | 3300013306 | Bacteria | 1664 |
| 137 | Ga0157372_10805374 | 3300013307 | Bacteria | 1091 |
| 138 | Ga0157375_10093563 | 3300013308 | Unclassified | 3072 |
| 139 | Ga0163163_10185944 | 3300014325 | Bacteria | 2125 |
| 140 | Ga0163163_10684698 | 3300014325 | Bacteria | 1089 |
| 141 | Ga0182008_10319889 | 3300014497 | Bacteria | 816 |
| 142 | Ga0182008_10421628 | 3300014497 | Bacteria | 720 |
| 143 | Ga0157377_10114929 | 3300014745 | Bacteria | 1623 |
| 144 | Ga0157377_11096317 | 3300014745 | Bacteria | 610 |
| 145 | Ga0157379_10248430 | 3300014968 | Bacteria | 1615 |
| 146 | Ga0157379_10491479 | 3300014968 | Bacteria | 1137 |
| 147 | Ga0163161_10234027 | 3300017792 | Bacteria | 1426 |
| 148 | Ga0163161_10289897 | 3300017792 | Bacteria | 1286 |
| 149 | Ga0163161_10681813 | 3300017792 | Unclassified | 854 |
| 150 | Ga0207653_10141234 | 3300025885 | Unclassified | 881 |
| 151 | Ga0207688_10106071 | 3300025901 | Bacteria | 1627 |
| 152 | Ga0207680_10771085 | 3300025903 | Unclassified | 689 |
| 153 | Ga0207645_10154332 | 3300025907 | Unclassified | 1500 |
| 154 | Ga0207684_10065008 | 3300025910 | Bacteria | 3097 |
| 155 | Ga0207684_10339891 | 3300025910 | Unclassified | 1293 |
| 156 | Ga0207654_11002175 | 3300025911 | Unclassified | 607 |
| 157 | Ga0207707_10589570 | 3300025912 | Bacteria | 942 |
| 158 | Ga0207663_10705412 | 3300025916 | Bacteria | 799 |
| 159 | Ga0207660_10000002 | 3300025917 | Bacteria | 883566 |
| 160 | Ga0207662_10326716 | 3300025918 | Unclassified | 1025 |
| 161 | Ga0207662_10505946 | 3300025918 | Bacteria | 832 |
| 162 | Ga0207649_11273478 | 3300025920 | Unclassified | 581 |
| 163 | Ga0207646_10013141 | 3300025922 | Bacteria | 7925 |
| 164 | Ga0207646_10032773 | 3300025922 | Bacteria | 4700 |
| 165 | Ga0207646_10168860 | 3300025922 | Bacteria | 1975 |
| 166 | Ga0207646_10418273 | 3300025922 | Bacteria | 1210 |
| 167 | Ga0207646_10985064 | 3300025922 | Bacteria | 745 |
| 168 | Ga0207646_11458057 | 3300025922 | Bacteria | 594 |
| 169 | Ga0207659_10195500 | 3300025926 | Bacteria | 1612 |
| 170 | Ga0207687_10096914 | 3300025927 | Bacteria | 2162 |
| 171 | Ga0207687_10097723 | 3300025927 | Unclassified | 2154 |
| 172 | Ga0207687_10176854 | 3300025927 | Bacteria | 1650 |
| 173 | Ga0207687_10181776 | 3300025927 | Bacteria | 1630 |
| 174 | Ga0207687_10276974 | 3300025927 | Bacteria | 1343 |
| 175 | Ga0207687_10813343 | 3300025927 | Bacteria | 797 |
| 176 | Ga0207687_11739769 | 3300025927 | Bacteria | 534 |
| 177 | Ga0207644_10451898 | 3300025931 | Unclassified | 1056 |
| 178 | Ga0207706_10080636 | 3300025933 | Bacteria | 2861 |
| 179 | Ga0207706_10161839 | 3300025933 | Bacteria | 1967 |
| 180 | Ga0207686_10105260 | 3300025934 | Bacteria | 1892 |
| 181 | Ga0207709_10359730 | 3300025935 | Bacteria | 1101 |
| 182 | Ga0207669_11275107 | 3300025937 | Unclassified | 624 |
| 183 | Ga0207711_11249208 | 3300025941 | Unclassified | 685 |
| 184 | Ga0207651_11263021 | 3300025960 | Unclassified | 664 |
| 185 | Ga0207712_10418888 | 3300025961 | Bacteria | 1129 |
| 186 | Ga0207712_10789241 | 3300025961 | Bacteria | 834 |
| 187 | Ga0207668_10562733 | 3300025972 | Bacteria | 989 |
| 188 | Ga0207640_10310616 | 3300025981 | Bacteria | 1251 |
| 189 | Ga0207658_10896824 | 3300025986 | Bacteria | 807 |
| 190 | Ga0207677_10220740 | 3300026023 | Bacteria | 1520 |
| 191 | Ga0207703_10180891 | 3300026035 | Bacteria | 1861 |
| 192 | Ga0207708_10082591 | 3300026075 | Unclassified | 2470 |
| 193 | Ga0207708_10125650 | 3300026075 | Bacteria | 2001 |
| 194 | Ga0207708_10527479 | 3300026075 | Bacteria | 993 |
| 195 | Ga0207708_10780649 | 3300026075 | Unclassified | 821 |
| 196 | Ga0207641_10182108 | 3300026088 | Bacteria | 1925 |
| 197 | Ga0207648_10592376 | 3300026089 | Bacteria | 1021 |
| 198 | Ga0207676_10044588 | 3300026095 | Bacteria | 3422 |
| 199 | Ga0207676_11139575 | 3300026095 | Unclassified | 772 |
| 200 | Ga0207676_11724659 | 3300026095 | Unclassified | 625 |
| 201 | Ga0207675_100031119 | 3300026118 | Bacteria | 4969 |
| 202 | Ga0207675_100238851 | 3300026118 | Bacteria | 1755 |
| 203 | Ga0207675_100562968 | 3300026118 | Unclassified | 1140 |
| 204 | Ga0207675_101576692 | 3300026118 | Unclassified | 677 |
| 205 | Ga0207683_10146023 | 3300026121 | Bacteria | 2133 |
| 206 | Ga0207683_11212874 | 3300026121 | Unclassified | 699 |
| 207 | Ga0209983_1052338 | 3300027665 | Bacteria | 895 |
| 208 | Ga0209974_10033021 | 3300027876 | Bacteria | 1716 |
| 209 | Ga0268265_10167883 | 3300028380 | Unclassified | 1872 |
| 210 | Ga0268264_10209094 | 3300028381 | Bacteria | 1790 |
| 211 | Ga0268264_10678441 | 3300028381 | Unclassified | 1022 |
| 212 | Ga0307405_11013409 | 3300031731 | Bacteria | 709 |
| 213 | Ga0307413_10148365 | 3300031824 | Bacteria | 1631 |
| 214 | Ga0307409_100367333 | 3300031995 | Bacteria | 1363 |
| 215 | Ga0307415_101845921 | 3300032126 | Bacteria | 586 |
| 216 | Ga0316583_10044840 | 3300032133 | Bacteria | 1562 |
| 217 | Ga0316574_0627940 | 3300035398 | Bacteria | 662 |
| 218 | Ga0373937_0105570 | 3300036401 | Unclassified | 2618 |
| 219 | Ga0373937_0430526 | 3300036401 | Unclassified | 1252 |
| 220 | Ga0373937_0788698 | 3300036401 | Bacteria | 898 |
| 221 | Ga0451807_1075610 | 3300041486 | Bacteria | 906 |
| 222 | Ga0439456_143339 | 3300042013 | Unclassified | 555 |
| 223 | Ga0439446_0316301 | 3300042156 | Bacteria | 551 |
| 224 | Ga0439434_0033857 | 3300042435 | Bacteria | 1559 |
| 225 | Ga0439459_0094391 | 3300042438 | Bacteria | 724 |
| 226 | Ga0439460_0151765 | 3300042461 | Unclassified | 773 |
| 227 | Ga0451577_0169010 | 3300042876 | Bacteria | 1970 |
| 228 | Ga0451577_0274678 | 3300042876 | Bacteria | 1526 |
| 229 | Ga0451577_0915583 | 3300042876 | Bacteria | 789 |
| 230 | Ga0453683_0035973 | 3300044673 | Bacteria | 3118 |
| 231 | Ga0453684_0262675 | 3300044712 | Bacteria | 1977 |
| 232 | Ga0453684_0301585 | 3300044712 | Bacteria | 1821 |
| 233 | Ga0451576_0052628 | 3300045051 | Bacteria | 4267 |
| 234 | Ga0451576_0414257 | 3300045051 | Bacteria | 1413 |
| 235 | Ga0495641_0261405 | 3300046461 | Bacteria | 779 |
| 236 | Ga0495651_0008848 | 3300046462 | Bacteria | 7727 |
| 237 | Ga0495664_0333549 | 3300046477 | Bacteria | 914 |
| 238 | Ga0495618_0055322 | 3300046514 | Unclassified | 2512 |
| 239 | Ga0495628_0494436 | 3300046516 | Bacteria | 884 |
| 240 | Ga0495628_0899704 | 3300046516 | Bacteria | 614 |
| 241 | Ga0495642_0217369 | 3300046528 | Bacteria | 834 |
| 242 | Ga0495640_0359565 | 3300046533 | Bacteria | 898 |
| 243 | Ga0495587_0327161 | 3300046536 | Bacteria | 856 |
| 244 | Ga0495634_0332967 | 3300046642 | Bacteria | 912 |
| 245 | Ga0495635_1014230 | 3300046663 | Unclassified | 528 |
| 246 | Ga0495599_0180164 | 3300046678 | Bacteria | 1303 |
| 247 | Ga0495599_0255911 | 3300046678 | Bacteria | 1065 |
| 248 | Ga0495623_0102067 | 3300046679 | Unclassified | 1747 |
| 249 | Ga0495658_0445679 | 3300046683 | Bacteria | 827 |
| 250 | Ga0495624_0436779 | 3300046690 | Bacteria | 785 |
| 251 | Ga0495674_0114531 | 3300047319 | Unclassified | 2283 |
| 252 | Ga0495674_0306440 | 3300047319 | Unclassified | 1296 |
| 253 | Ga0495680_0372786 | 3300047322 | Bacteria | 990 |
| 254 | Ga0495602_0645813 | 3300048088 | Bacteria | 723 |
| 255 | Ga0496100_1416549 | 3300048903 | Bacteria | 549 |
| 256 | Ga0496101_1175377 | 3300048904 | Unclassified | 601 |
| 257 | Ga0496103_0791179 | 3300048906 | Unclassified | 598 |
| 258 | Ga0496104_0104867 | 3300048907 | Unclassified | 2709 |
| 259 | Ga0496104_0432061 | 3300048907 | Bacteria | 1229 |
| 260 | Ga0496105_0058520 | 3300048908 | Bacteria | 3181 |
| 261 | Ga0496105_0637432 | 3300048908 | Bacteria | 823 |
| 262 | Ga0496106_0257849 | 3300048909 | Bacteria | 1395 |
| 263 | Ga0496106_0320866 | 3300048909 | Bacteria | 1243 |
| 264 | Ga0496107_0455286 | 3300048910 | Unclassified | 950 |
| 265 | Ga0496107_0482103 | 3300048910 | Unclassified | 920 |
| 266 | Ga0496108_0145104 | 3300048911 | Bacteria | 2046 |
| 267 | Ga0496108_0381670 | 3300048911 | Bacteria | 1230 |
| 268 | Ga0496108_0598477 | 3300048911 | Bacteria | 961 |
| 269 | Ga0496109_0018038 | 3300048912 | Bacteria | 6195 |
| 270 | Ga0496109_0052838 | 3300048912 | Bacteria | 3704 |
| 271 | Ga0496109_0067175 | 3300048912 | Archaea | 3284 |
| 272 | Ga0496109_0357235 | 3300048912 | Bacteria | 1380 |
| 273 | Ga0496109_0864557 | 3300048912 | Bacteria | 842 |
| 274 | Ga0496110_0546471 | 3300048913 | Unclassified | 1053 |
| 275 | Ga0496110_0880672 | 3300048913 | Bacteria | 801 |
| 276 | Ga0496111_0147274 | 3300048914 | Bacteria | 1746 |
| 277 | Ga0496112_0000001 | 3300048915 | Bacteria | 1346031 |
| 278 | Ga0496112_0034348 | 3300048915 | Bacteria | 4935 |
| 279 | Ga0496112_0778062 | 3300048915 | Bacteria | 882 |
| 280 | Ga0496112_1012796 | 3300048915 | Bacteria | 750 |
| 281 | Ga0496112_1117273 | 3300048915 | Bacteria | 706 |
| 282 | Ga0496113_0215464 | 3300048916 | Bacteria | 1529 |
| 283 | Ga0496113_0471817 | 3300048916 | Bacteria | 1008 |
| 284 | Ga0501031_0015234 | 3300049568 | Bacteria | 4992 |
| 285 | Ga0501032_0382040 | 3300049569 | Bacteria | 906 |
| 286 | Ga0501036_0123937 | 3300049572 | Bacteria | 2182 |
| 287 | Ga0501036_0140303 | 3300049572 | Bacteria | 2040 |
| 288 | Ga0501036_0196527 | 3300049572 | Bacteria | 1697 |
| 289 | Ga0501036_0525682 | 3300049572 | Unclassified | 984 |
| 290 | Ga0501037_0087796 | 3300049573 | Bacteria | 2251 |
| 291 | Ga0501038_0485428 | 3300049574 | Unclassified | 946 |
| 292 | Ga0501038_0614002 | 3300049574 | Bacteria | 822 |
| 293 | Ga0501040_0177863 | 3300049576 | Unclassified | 1507 |
| 294 | Ga0501040_0666811 | 3300049576 | Bacteria | 752 |
| 295 | Ga0501041_0192835 | 3300049577 | Bacteria | 1277 |
| 296 | Ga0501042_0057757 | 3300049578 | Unclassified | 2769 |
| 297 | Ga0501042_0077134 | 3300049578 | Bacteria | 2386 |
| 298 | Ga0501043_0184286 | 3300049579 | Bacteria | 1626 |
| 299 | Ga0501046_0056682 | 3300049580 | Unclassified | 3075 |
| 300 | Ga0501048_0632337 | 3300049582 | Bacteria | 768 |
| 301 | Ga0501048_1276938 | 3300049582 | Bacteria | 528 |
| 302 | Ga0501067_0107707 | 3300049583 | Unclassified | 1549 |
| 303 | Ga0501068_0049620 | 3300049584 | Bacteria | 2535 |
| 304 | Ga0501068_0173338 | 3300049584 | Unclassified | 1362 |
| 305 | Ga0501068_0749598 | 3300049584 | Bacteria | 639 |
| 306 | Ga0501071_0050672 | 3300049587 | Bacteria | 2991 |
| 307 | Ga0501071_0090471 | 3300049587 | Unclassified | 2247 |
| 308 | Ga0501071_0372445 | 3300049587 | Bacteria | 1088 |
| 309 | Ga0501072_0131041 | 3300049588 | Unclassified | 1998 |
| 310 | Ga0501072_0250898 | 3300049588 | Bacteria | 1409 |
| 311 | Ga0501072_0569331 | 3300049588 | Unclassified | 894 |
| 312 | Ga0501074_0074041 | 3300049590 | Unclassified | 2446 |
| 313 | Ga0501075_0025587 | 3300049591 | Bacteria | 4336 |
| 314 | Ga0501075_0204358 | 3300049591 | Unclassified | 1507 |
| 315 | Ga0501075_0499282 | 3300049591 | Bacteria | 928 |
| 316 | Ga0501075_0993495 | 3300049591 | Unclassified | 638 |
| 317 | Ga0501076_0030849 | 3300049592 | Bacteria | 4176 |
| 318 | Ga0501076_0054944 | 3300049592 | Unclassified | 3157 |
| 319 | Ga0501076_0069137 | 3300049592 | Unclassified | 2822 |
| 320 | Ga0501079_0142991 | 3300049741 | Bacteria | 1864 |
| 321 | Ga0501079_0145295 | 3300049741 | Unclassified | 1848 |
| 322 | Ga0501079_0341010 | 3300049741 | Bacteria | 1174 |
| 323 | Ga0501079_0464631 | 3300049741 | Unclassified | 994 |
| 324 | Ga0501080_0189324 | 3300049742 | Unclassified | 1891 |
| 325 | Ga0501081_0246245 | 3300049743 | Bacteria | 1304 |
| 326 | Ga0501083_0068472 | 3300049744 | Bacteria | 2362 |
| 327 | Ga0501035_0450303 | 3300049822 | Bacteria | 1065 |
| 328 | Ga0501045_0044403 | 3300049824 | Unclassified | 3237 |
| 329 | Ga0501045_0307551 | 3300049824 | Unclassified | 1180 |
| 330 | nmdc:mga05p37_32978_c1 | 3300050507 | Bacteria | 6341 |
| 331 | nmdc:mga05p37_572185_c1 | 3300050507 | Unclassified | 1281 |
| 332 | nmdc:mga09592_84370_c1 | 3300050508 | Bacteria | 2708 |
| 333 | nmdc:mga06r32_25214_c1 | 3300050510 | Bacteria | 5529 |
| 334 | nmdc:mga08y16_230440_c1 | 3300050511 | Bacteria | 1916 |
| 335 | nmdc:mga0n895_167202_c1 | 3300050512 | Bacteria | 2231 |
| 336 | nmdc:mga0rr50_220352_c1 | 3300050513 | Bacteria | 1566 |
| 337 | nmdc:mga0rr50_416633_c1 | 3300050513 | Bacteria | 1136 |
| 338 | nmdc:mga0a205_147715_c1 | 3300050515 | Bacteria | 2251 |
| 339 | nmdc:mga0a205_728751_c1 | 3300050515 | Bacteria | 841 |
| 340 | Ga0495601_0022682 | 3300053077 | Bacteria | 3857 |
| 341 | Ga0495601_0220027 | 3300053077 | Bacteria | 1240 |
| 342 | Ga0495612_0137169 | 3300053078 | Bacteria | 1060 |
| 343 | Ga0495595_0241618 | 3300053084 | Bacteria | 903 |
| 344 | Ga0495619_0070348 | 3300053085 | Bacteria | 2340 |
| 345 | Ga0495619_0414844 | 3300053085 | Unclassified | 929 |
| 346 | Ga0501084_0124074 | 3300054114 | Unclassified | 2172 |
| 347 | Ga0501084_0550458 | 3300054114 | Bacteria | 975 |
| 348 | Ga0501084_0571707 | 3300054114 | Bacteria | 955 |
| 349 | Ga0501082_0029420 | 3300060353 | Bacteria | 4733 |
| 350 | Ga0501082_0057041 | 3300060353 | Bacteria | 3365 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048907 | Ga0496104_0432061 | Ga0496104_0432061_58_507 | 119 |
| 2 | 3300048908 | Ga0496105_0058520 | Ga0496105_0058520_2647_3066 | 119 |
| 3 | 3300048911 | Ga0496108_0598477 | Ga0496108_0598477_299_718 | 119 |
| 4 | 3300048912 | Ga0496109_0357235 | Ga0496109_0357235_318_737 | 119 |
| 5 | 3300048913 | Ga0496110_0880672 | Ga0496110_0880672_284_700 | 119 |
| 6 | 3300048915 | Ga0496112_0000001 | Ga0496112_0000001_174615_175067 | 119 |
| 7 | 3300005439 | Ga0070711_100394469 | Ga0070711_1003944692 | 120 |
| 8 | 3300009147 | Ga0114129_12424105 | Ga0114129_124241051 | 120 |
| 9 | 3300013104 | Ga0157370_10616045 | Ga0157370_106160452 | 120 |
| 10 | 3300017792 | Ga0163161_10234027 | Ga0163161_102340272 | 120 |
| 11 | 3300025916 | Ga0207663_10705412 | Ga0207663_107054121 | 120 |
| 12 | 3300025920 | Ga0207649_11273478 | Ga0207649_112734781 | 120 |
| 13 | 3300025926 | Ga0207659_10195500 | Ga0207659_101955002 | 120 |
| 14 | 3300026095 | Ga0207676_11724659 | Ga0207676_117246591 | 120 |
| 15 | 3300026121 | Ga0207683_10146023 | Ga0207683_101460232 | 120 |
| 16 | 3300041486 | Ga0451807_1075610 | Ga0451807_1075610_174_632 | 120 |
| 17 | 3300042876 | Ga0451577_0169010 | Ga0451577_0169010_449_913 | 120 |
| 18 | 3300044673 | Ga0453683_0035973 | Ga0453683_0035973_976_1440 | 120 |
| 19 | 3300044712 | Ga0453684_0262675 | Ga0453684_0262675_194_658 | 120 |
| 20 | 3300044712 | Ga0453684_0301585 | Ga0453684_0301585_232_756 | 120 |
| 21 | 3300045051 | Ga0451576_0414257 | Ga0451576_0414257_715_1179 | 120 |
| 22 | 3300046663 | Ga0495635_1014230 | Ga0495635_1014230_74_487 | 120 |
| 23 | 3300048915 | Ga0496112_0778062 | Ga0496112_0778062_32_394 | 120 |
| 24 | 3300048915 | Ga0496112_1117273 | Ga0496112_1117273_102_542 | 120 |
| 25 | 3300005330 | Ga0070690_100057315 | Ga0070690_1000573152 | 121 |
| 26 | 3300005457 | Ga0070662_100409487 | Ga0070662_1004094872 | 121 |
| 27 | 3300005578 | Ga0068854_100016634 | Ga0068854_1000166347 | 121 |
| 28 | 3300005719 | Ga0068861_100310868 | Ga0068861_1003108682 | 121 |
| 29 | 3300009098 | Ga0105245_10661124 | Ga0105245_106611242 | 121 |
| 30 | 3300013307 | Ga0157372_10805374 | Ga0157372_108053742 | 121 |
| 31 | 3300025927 | Ga0207687_10181776 | Ga0207687_101817762 | 121 |
| 32 | 3300025933 | Ga0207706_10080636 | Ga0207706_100806366 | 121 |
| 33 | 3300025981 | Ga0207640_10310616 | Ga0207640_103106163 | 121 |
| 34 | 3300026075 | Ga0207708_10527479 | Ga0207708_105274792 | 121 |
| 35 | 3300026118 | Ga0207675_100238851 | Ga0207675_1002388513 | 121 |
| 36 | 3300005366 | Ga0070659_101468545 | Ga0070659_1014685451 | 123 |
| 37 | 3300005441 | Ga0070700_100671796 | Ga0070700_1006717961 | 123 |
| 38 | 3300005719 | Ga0068861_101297705 | Ga0068861_1012977052 | 123 |
| 39 | 3300005719 | Ga0068861_102015722 | Ga0068861_1020157221 | 123 |
| 40 | 3300009094 | Ga0111539_10106073 | Ga0111539_101060732 | 123 |
| 41 | 3300009553 | Ga0105249_10792404 | Ga0105249_107924042 | 123 |
| 42 | 3300025961 | Ga0207712_10789241 | Ga0207712_107892411 | 123 |
| 43 | 3300026075 | Ga0207708_10780649 | Ga0207708_107806492 | 123 |
| 44 | 3300026118 | Ga0207675_101576692 | Ga0207675_1015766921 | 123 |
| 45 | 3300027665 | Ga0209983_1052338 | Ga0209983_10523382 | 123 |
| 46 | 3300031731 | Ga0307405_11013409 | Ga0307405_110134092 | 123 |
| 47 | 3300042156 | Ga0439446_0316301 | Ga0439446_0316301_102_521 | 123 |
| 48 | 3300042435 | Ga0439434_0033857 | Ga0439434_0033857_824_1243 | 123 |
| 49 | 3300035398 | Ga0316574_0627940 | Ga0316574_0627940_224_607 | 124 |
| 50 | 3300046528 | Ga0495642_0217369 | Ga0495642_0217369_372_815 | 124 |
| 51 | 3300005338 | Ga0068868_100115183 | Ga0068868_1001151834 | 125 |
| 52 | 3300005343 | Ga0070687_100522883 | Ga0070687_1005228832 | 125 |
| 53 | 3300005345 | Ga0070692_11066413 | Ga0070692_110664131 | 125 |
| 54 | 3300005364 | Ga0070673_101467791 | Ga0070673_1014677911 | 125 |
| 55 | 3300005440 | Ga0070705_100363031 | Ga0070705_1003630311 | 125 |
| 56 | 3300005440 | Ga0070705_100479431 | Ga0070705_1004794311 | 125 |
| 57 | 3300005518 | Ga0070699_100084848 | Ga0070699_1000848483 | 125 |
| 58 | 3300005545 | Ga0070695_100459143 | Ga0070695_1004591432 | 125 |
| 59 | 3300005615 | Ga0070702_100037759 | Ga0070702_1000377592 | 125 |
| 60 | 3300005615 | Ga0070702_100808378 | Ga0070702_1008083781 | 125 |
| 61 | 3300009098 | Ga0105245_10056547 | Ga0105245_100565472 | 125 |
| 62 | 3300009098 | Ga0105245_10725150 | Ga0105245_107251502 | 125 |
| 63 | 3300009148 | Ga0105243_10132369 | Ga0105243_101323691 | 125 |
| 64 | 3300013297 | Ga0157378_10123217 | Ga0157378_101232174 | 125 |
| 65 | 3300014745 | Ga0157377_11096317 | Ga0157377_110963171 | 125 |
| 66 | 3300017792 | Ga0163161_10681813 | Ga0163161_106818132 | 125 |
| 67 | 3300025907 | Ga0207645_10154332 | Ga0207645_101543322 | 125 |
| 68 | 3300025918 | Ga0207662_10505946 | Ga0207662_105059461 | 125 |
| 69 | 3300025927 | Ga0207687_10176854 | Ga0207687_101768542 | 125 |
| 70 | 3300025927 | Ga0207687_10813343 | Ga0207687_108133431 | 125 |
| 71 | 3300025937 | Ga0207669_11275107 | Ga0207669_112751071 | 125 |
| 72 | 3300025941 | Ga0207711_11249208 | Ga0207711_112492081 | 125 |
| 73 | 3300025972 | Ga0207668_10562733 | Ga0207668_105627331 | 125 |
| 74 | 3300026075 | Ga0207708_10125650 | Ga0207708_101256502 | 125 |
| 75 | 3300026089 | Ga0207648_10592376 | Ga0207648_105923761 | 125 |
| 76 | 3300048909 | Ga0496106_0320866 | Ga0496106_0320866_338_775 | 125 |
| 77 | 3300048912 | Ga0496109_0864557 | Ga0496109_0864557_378_815 | 125 |
| 78 | 3300049591 | Ga0501075_0204358 | Ga0501075_0204358_107_520 | 125 |
| 79 | 3300049592 | Ga0501076_0069137 | Ga0501076_0069137_2079_2492 | 125 |
| 80 | 3300049741 | Ga0501079_0464631 | Ga0501079_0464631_546_959 | 125 |
| 81 | 3300005546 | Ga0070696_100441251 | Ga0070696_1004412512 | 126 |
| 82 | 3300014497 | Ga0182008_10319889 | Ga0182008_103198891 | 126 |
| 83 | 3300005364 | Ga0070673_101805803 | Ga0070673_1018058031 | 127 |
| 84 | 3300005445 | Ga0070708_100134001 | Ga0070708_1001340012 | 127 |
| 85 | 3300006852 | Ga0075433_10146421 | Ga0075433_101464212 | 127 |
| 86 | 3300006871 | Ga0075434_100184260 | Ga0075434_1001842601 | 127 |
| 87 | 3300007076 | Ga0075435_100841189 | Ga0075435_1008411892 | 127 |
| 88 | 3300025960 | Ga0207651_11263021 | Ga0207651_112630212 | 127 |
| 89 | 3300036401 | Ga0373937_0105570 | Ga0373937_0105570_10_453 | 127 |
| 90 | 3300042876 | Ga0451577_0915583 | Ga0451577_0915583_291_731 | 127 |
| 91 | 3300049587 | Ga0501071_0372445 | Ga0501071_0372445_506_940 | 127 |
| 92 | 3300050512 | nmdc:mga0n895_167202_c1 | nmdc:mga0n895_167202_c1_222_653 | 127 |
| 93 | 3300050513 | nmdc:mga0rr50_220352_c1 | nmdc:mga0rr50_220352_c1_384_815 | 127 |
| 94 | 3300050515 | nmdc:mga0a205_147715_c1 | nmdc:mga0a205_147715_c1_28_459 | 127 |
| 95 | 3300011119 | Ga0105246_10907608 | Ga0105246_109076082 | 128 |
| 96 | 3300005468 | Ga0070707_100009619 | Ga0070707_1000096193 | 129 |
| 97 | 3300005536 | Ga0070697_100019335 | Ga0070697_1000193358 | 129 |
| 98 | 3300005549 | Ga0070704_100039011 | Ga0070704_1000390111 | 129 |
| 99 | 3300005985 | Ga0081539_10325293 | Ga0081539_103252931 | 129 |
| 100 | 3300025922 | Ga0207646_10013141 | Ga0207646_100131413 | 129 |
| 101 | 3300042876 | Ga0451577_0274678 | Ga0451577_0274678_652_1098 | 129 |
| 102 | 3300053085 | Ga0495619_0414844 | Ga0495619_0414844_327_815 | 129 |
| 103 | 3300009101 | Ga0105247_10190290 | Ga0105247_101902901 | 130 |
| 104 | 3300046462 | Ga0495651_0008848 | Ga0495651_0008848_915_1340 | 130 |
| 105 | 3300048088 | Ga0495602_0645813 | Ga0495602_0645813_130_555 | 130 |
| 106 | 3300053084 | Ga0495595_0241618 | Ga0495595_0241618_273_698 | 130 |
| 107 | 3300005468 | Ga0070707_100116309 | Ga0070707_1001163092 | 131 |
| 108 | 3300025922 | Ga0207646_10032773 | Ga0207646_100327733 | 131 |
| 109 | 3300005467 | Ga0070706_100121235 | Ga0070706_1001212354 | 132 |
| 110 | 3300005471 | Ga0070698_100010268 | Ga0070698_10001026810 | 132 |
| 111 | 3300005518 | Ga0070699_100019210 | Ga0070699_1000192109 | 132 |
| 112 | 3300006852 | Ga0075433_10651956 | Ga0075433_106519562 | 132 |
| 113 | 3300006871 | Ga0075434_100521173 | Ga0075434_1005211732 | 132 |
| 114 | 3300009147 | Ga0114129_10651918 | Ga0114129_106519182 | 132 |
| 115 | 3300025910 | Ga0207684_10065008 | Ga0207684_100650082 | 132 |
| 116 | 3300027876 | Ga0209974_10033021 | Ga0209974_100330211 | 132 |
| 117 | 3300036401 | Ga0373937_0430526 | Ga0373937_0430526_161_586 | 132 |
| 118 | 3300048912 | Ga0496109_0052838 | Ga0496109_0052838_223_690 | 132 |
| 119 | 3300050507 | nmdc:mga05p37_32978_c1 | nmdc:mga05p37_32978_c1_5459_5902 | 132 |
| 120 | 3300005353 | Ga0070669_100287867 | Ga0070669_1002878671 | 133 |
| 121 | 3300005563 | Ga0068855_101747662 | Ga0068855_1017476622 | 133 |
| 122 | 3300005719 | Ga0068861_100023534 | Ga0068861_1000235344 | 133 |
| 123 | 3300005981 | Ga0081538_10148860 | Ga0081538_101488601 | 133 |
| 124 | 3300006844 | Ga0075428_100438656 | Ga0075428_1004386562 | 133 |
| 125 | 3300009094 | Ga0111539_11639136 | Ga0111539_116391362 | 133 |
| 126 | 3300009094 | Ga0111539_11639137 | Ga0111539_116391372 | 133 |
| 127 | 3300009098 | Ga0105245_10211443 | Ga0105245_102114432 | 133 |
| 128 | 3300009147 | Ga0114129_10207413 | Ga0114129_102074135 | 133 |
| 129 | 3300009148 | Ga0105243_10593585 | Ga0105243_105935852 | 133 |
| 130 | 3300009553 | Ga0105249_10806610 | Ga0105249_108066101 | 133 |
| 131 | 3300012492 | Ga0157335_1041839 | Ga0157335_10418391 | 133 |
| 132 | 3300014745 | Ga0157377_10114929 | Ga0157377_101149293 | 133 |
| 133 | 3300017792 | Ga0163161_10289897 | Ga0163161_102898972 | 133 |
| 134 | 3300025901 | Ga0207688_10106071 | Ga0207688_101060712 | 133 |
| 135 | 3300025927 | Ga0207687_10097723 | Ga0207687_100977232 | 133 |
| 136 | 3300025931 | Ga0207644_10451898 | Ga0207644_104518982 | 133 |
| 137 | 3300025935 | Ga0207709_10359730 | Ga0207709_103597302 | 133 |
| 138 | 3300025961 | Ga0207712_10418888 | Ga0207712_104188881 | 133 |
| 139 | 3300026075 | Ga0207708_10082591 | Ga0207708_100825912 | 133 |
| 140 | 3300026118 | Ga0207675_100031119 | Ga0207675_1000311195 | 133 |
| 141 | 3300028381 | Ga0268264_10678441 | Ga0268264_106784412 | 133 |
| 142 | 3300031824 | Ga0307413_10148365 | Ga0307413_101483652 | 133 |
| 143 | 3300031995 | Ga0307409_100367333 | Ga0307409_1003673332 | 133 |
| 144 | 3300042013 | Ga0439456_143339 | Ga0439456_143339_76_480 | 133 |
| 145 | 3300042461 | Ga0439460_0151765 | Ga0439460_0151765_103_531 | 133 |
| 146 | 3300049568 | Ga0501031_0015234 | Ga0501031_0015234_4548_4952 | 133 |
| 147 | 3300049572 | Ga0501036_0123937 | Ga0501036_0123937_1759_2163 | 133 |
| 148 | 3300049573 | Ga0501037_0087796 | Ga0501037_0087796_924_1328 | 133 |
| 149 | 3300049579 | Ga0501043_0184286 | Ga0501043_0184286_557_961 | 133 |
| 150 | 3300049584 | Ga0501068_0173338 | Ga0501068_0173338_159_563 | 133 |
| 151 | 3300049592 | Ga0501076_0030849 | Ga0501076_0030849_3106_3510 | 133 |
| 152 | 3300049744 | Ga0501083_0068472 | Ga0501083_0068472_20_424 | 133 |
| 153 | 3300050511 | nmdc:mga08y16_230440_c1 | nmdc:mga08y16_230440_c1_1186_1590 | 133 |
| 154 | 3300060353 | Ga0501082_0029420 | Ga0501082_0029420_2786_3190 | 133 |
| 155 | 3300010375 | Ga0105239_11933632 | Ga0105239_119336321 | 134 |
| 156 | 3300026118 | Ga0207675_100562968 | Ga0207675_1005629681 | 134 |
| 157 | 3300005440 | Ga0070705_100139267 | Ga0070705_1001392672 | 136 |
| 158 | 3300005445 | Ga0070708_101444669 | Ga0070708_1014446691 | 136 |
| 159 | 3300005458 | Ga0070681_10193255 | Ga0070681_101932552 | 136 |
| 160 | 3300005467 | Ga0070706_100273028 | Ga0070706_1002730282 | 136 |
| 161 | 3300005467 | Ga0070706_100369274 | Ga0070706_1003692741 | 136 |
| 162 | 3300005518 | Ga0070699_100396806 | Ga0070699_1003968061 | 136 |
| 163 | 3300005536 | Ga0070697_101058768 | Ga0070697_1010587682 | 136 |
| 164 | 3300005545 | Ga0070695_100018988 | Ga0070695_1000189885 | 136 |
| 165 | 3300005545 | Ga0070695_100397930 | Ga0070695_1003979302 | 136 |
| 166 | 3300005546 | Ga0070696_100006828 | Ga0070696_1000068284 | 136 |
| 167 | 3300005546 | Ga0070696_100009844 | Ga0070696_1000098445 | 136 |
| 168 | 3300005547 | Ga0070693_100332887 | Ga0070693_1003328872 | 136 |
| 169 | 3300005549 | Ga0070704_100067156 | Ga0070704_1000671562 | 136 |
| 170 | 3300005549 | Ga0070704_100621218 | Ga0070704_1006212182 | 136 |
| 171 | 3300005577 | Ga0068857_100684806 | Ga0068857_1006848062 | 136 |
| 172 | 3300005578 | Ga0068854_100565627 | Ga0068854_1005656272 | 136 |
| 173 | 3300005617 | Ga0068859_100171116 | Ga0068859_1001711162 | 136 |
| 174 | 3300006844 | Ga0075428_100000259 | Ga0075428_10000025923 | 136 |
| 175 | 3300006847 | Ga0075431_100218239 | Ga0075431_1002182392 | 136 |
| 176 | 3300006852 | Ga0075433_10174493 | Ga0075433_101744932 | 136 |
| 177 | 3300006931 | Ga0097620_100171117 | Ga0097620_1001711172 | 136 |
| 178 | 3300009147 | Ga0114129_11212085 | Ga0114129_112120852 | 136 |
| 179 | 3300025910 | Ga0207684_10339891 | Ga0207684_103398911 | 136 |
| 180 | 3300025927 | Ga0207687_11739769 | Ga0207687_117397691 | 136 |
| 181 | 3300042438 | Ga0439459_0094391 | Ga0439459_0094391_118_531 | 136 |
| 182 | 3300046514 | Ga0495618_0055322 | Ga0495618_0055322_853_1371 | 136 |
| 183 | 3300046690 | Ga0495624_0436779 | Ga0495624_0436779_229_639 | 136 |
| 184 | 3300047319 | Ga0495674_0114531 | Ga0495674_0114531_721_1239 | 136 |
| 185 | 3300048906 | Ga0496103_0791179 | Ga0496103_0791179_125_538 | 136 |
| 186 | 3300049569 | Ga0501032_0382040 | Ga0501032_0382040_327_740 | 136 |
| 187 | 3300049572 | Ga0501036_0140303 | Ga0501036_0140303_886_1299 | 136 |
| 188 | 3300049574 | Ga0501038_0614002 | Ga0501038_0614002_101_514 | 136 |
| 189 | 3300049576 | Ga0501040_0666811 | Ga0501040_0666811_302_715 | 136 |
| 190 | 3300049577 | Ga0501041_0192835 | Ga0501041_0192835_408_821 | 136 |
| 191 | 3300049578 | Ga0501042_0077134 | Ga0501042_0077134_1816_2229 | 136 |
| 192 | 3300049583 | Ga0501067_0107707 | Ga0501067_0107707_995_1408 | 136 |
| 193 | 3300049584 | Ga0501068_0749598 | Ga0501068_0749598_147_560 | 136 |
| 194 | 3300049588 | Ga0501072_0250898 | Ga0501072_0250898_982_1395 | 136 |
| 195 | 3300049591 | Ga0501075_0499282 | Ga0501075_0499282_369_782 | 136 |
| 196 | 3300049741 | Ga0501079_0341010 | Ga0501079_0341010_474_887 | 136 |
| 197 | 3300049743 | Ga0501081_0246245 | Ga0501081_0246245_322_735 | 136 |
| 198 | 3300050508 | nmdc:mga09592_84370_c1 | nmdc:mga09592_84370_c1_544_987 | 136 |
| 199 | 3300050510 | nmdc:mga06r32_25214_c1 | nmdc:mga06r32_25214_c1_653_1096 | 136 |
| 200 | 3300054114 | Ga0501084_0550458 | Ga0501084_0550458_459_872 | 136 |
| 201 | 3300005355 | Ga0070671_101184579 | Ga0070671_1011845792 | 137 |
| 202 | 3300005367 | Ga0070667_100454871 | Ga0070667_1004548712 | 137 |
| 203 | 3300005616 | Ga0068852_100411584 | Ga0068852_1004115842 | 137 |
| 204 | 3300005842 | Ga0068858_100328180 | Ga0068858_1003281802 | 137 |
| 205 | 3300006358 | Ga0068871_100927175 | Ga0068871_1009271752 | 137 |
| 206 | 3300009098 | Ga0105245_10159430 | Ga0105245_101594304 | 137 |
| 207 | 3300009098 | Ga0105245_10283798 | Ga0105245_102837982 | 137 |
| 208 | 3300013297 | Ga0157378_12465837 | Ga0157378_124658371 | 137 |
| 209 | 3300013306 | Ga0163162_10327580 | Ga0163162_103275802 | 137 |
| 210 | 3300013308 | Ga0157375_10093563 | Ga0157375_100935635 | 137 |
| 211 | 3300014325 | Ga0163163_10185944 | Ga0163163_101859442 | 137 |
| 212 | 3300014497 | Ga0182008_10421628 | Ga0182008_104216281 | 137 |
| 213 | 3300014968 | Ga0157379_10491479 | Ga0157379_104914792 | 137 |
| 214 | 3300025927 | Ga0207687_10096914 | Ga0207687_100969142 | 137 |
| 215 | 3300025927 | Ga0207687_10276974 | Ga0207687_102769742 | 137 |
| 216 | 3300025986 | Ga0207658_10896824 | Ga0207658_108968242 | 137 |
| 217 | 3300026023 | Ga0207677_10220740 | Ga0207677_102207402 | 137 |
| 218 | 3300026035 | Ga0207703_10180891 | Ga0207703_101808914 | 137 |
| 219 | 3300046461 | Ga0495641_0261405 | Ga0495641_0261405_220_636 | 137 |
| 220 | 3300046516 | Ga0495628_0899704 | Ga0495628_0899704_191_604 | 137 |
| 221 | 3300046642 | Ga0495634_0332967 | Ga0495634_0332967_463_879 | 137 |
| 222 | 3300046678 | Ga0495599_0180164 | Ga0495599_0180164_766_1227 | 137 |
| 223 | 3300046683 | Ga0495658_0445679 | Ga0495658_0445679_287_703 | 137 |
| 224 | 3300048903 | Ga0496100_1416549 | Ga0496100_1416549_29_442 | 137 |
| 225 | 3300048904 | Ga0496101_1175377 | Ga0496101_1175377_26_487 | 137 |
| 226 | 3300048907 | Ga0496104_0104867 | Ga0496104_0104867_1884_2300 | 137 |
| 227 | 3300048908 | Ga0496105_0637432 | Ga0496105_0637432_199_615 | 137 |
| 228 | 3300048909 | Ga0496106_0257849 | Ga0496106_0257849_410_826 | 137 |
| 229 | 3300048910 | Ga0496107_0482103 | Ga0496107_0482103_172_588 | 137 |
| 230 | 3300048911 | Ga0496108_0145104 | Ga0496108_0145104_303_716 | 137 |
| 231 | 3300048911 | Ga0496108_0381670 | Ga0496108_0381670_637_1053 | 137 |
| 232 | 3300048912 | Ga0496109_0018038 | Ga0496109_0018038_5731_6144 | 137 |
| 233 | 3300048912 | Ga0496109_0067175 | Ga0496109_0067175_674_1090 | 137 |
| 234 | 3300048913 | Ga0496110_0546471 | Ga0496110_0546471_552_968 | 137 |
| 235 | 3300048914 | Ga0496111_0147274 | Ga0496111_0147274_1150_1563 | 137 |
| 236 | 3300048915 | Ga0496112_0034348 | Ga0496112_0034348_71_484 | 137 |
| 237 | 3300048915 | Ga0496112_1012796 | Ga0496112_1012796_299_715 | 137 |
| 238 | 3300048916 | Ga0496113_0215464 | Ga0496113_0215464_538_954 | 137 |
| 239 | 3300048916 | Ga0496113_0471817 | Ga0496113_0471817_302_715 | 137 |
| 240 | 3300053077 | Ga0495601_0220027 | Ga0495601_0220027_636_1049 | 137 |
| 241 | 3300053085 | Ga0495619_0070348 | Ga0495619_0070348_959_1372 | 137 |
| 242 | 3300005334 | Ga0068869_101797854 | Ga0068869_1017978541 | 138 |
| 243 | 3300005444 | Ga0070694_100023351 | Ga0070694_1000233512 | 138 |
| 244 | 3300005455 | Ga0070663_101175319 | Ga0070663_1011753191 | 138 |
| 245 | 3300005471 | Ga0070698_100076253 | Ga0070698_1000762535 | 138 |
| 246 | 3300005549 | Ga0070704_100030959 | Ga0070704_1000309592 | 138 |
| 247 | 3300005563 | Ga0068855_100396150 | Ga0068855_1003961502 | 138 |
| 248 | 3300005614 | Ga0068856_101672389 | Ga0068856_1016723891 | 138 |
| 249 | 3300005843 | Ga0068860_100021120 | Ga0068860_1000211202 | 138 |
| 250 | 3300005844 | Ga0068862_100044471 | Ga0068862_1000444712 | 138 |
| 251 | 3300009098 | Ga0105245_11702852 | Ga0105245_117028521 | 138 |
| 252 | 3300009176 | Ga0105242_11652346 | Ga0105242_116523461 | 138 |
| 253 | 3300009553 | Ga0105249_10953370 | Ga0105249_109533703 | 138 |
| 254 | 3300025912 | Ga0207707_10589570 | Ga0207707_105895702 | 138 |
| 255 | 3300025922 | Ga0207646_10418273 | Ga0207646_104182731 | 138 |
| 256 | 3300026121 | Ga0207683_11212874 | Ga0207683_112128742 | 138 |
| 257 | 3300028380 | Ga0268265_10167883 | Ga0268265_101678832 | 138 |
| 258 | 3300028381 | Ga0268264_10209094 | Ga0268264_102090942 | 138 |
| 259 | 3300045051 | Ga0451576_0052628 | Ga0451576_0052628_1336_1755 | 138 |
| 260 | 3300049582 | Ga0501048_1276938 | Ga0501048_1276938_86_508 | 138 |
| 261 | 3300049588 | Ga0501072_0569331 | Ga0501072_0569331_413_835 | 138 |
| 262 | 3300005843 | Ga0068860_101161099 | Ga0068860_1011610992 | 139 |
| 263 | 3300032126 | Ga0307415_101845921 | Ga0307415_1018459212 | 139 |
| 264 | 3300036401 | Ga0373937_0788698 | Ga0373937_0788698_219_641 | 139 |
| 265 | 3300046477 | Ga0495664_0333549 | Ga0495664_0333549_235_660 | 139 |
| 266 | 3300046516 | Ga0495628_0494436 | Ga0495628_0494436_66_491 | 139 |
| 267 | 3300046533 | Ga0495640_0359565 | Ga0495640_0359565_53_478 | 139 |
| 268 | 3300046536 | Ga0495587_0327161 | Ga0495587_0327161_276_701 | 139 |
| 269 | 3300046678 | Ga0495599_0255911 | Ga0495599_0255911_317_742 | 139 |
| 270 | 3300046679 | Ga0495623_0102067 | Ga0495623_0102067_87_512 | 139 |
| 271 | 3300047319 | Ga0495674_0306440 | Ga0495674_0306440_371_796 | 139 |
| 272 | 3300047322 | Ga0495680_0372786 | Ga0495680_0372786_235_660 | 139 |
| 273 | 3300049572 | Ga0501036_0196527 | Ga0501036_0196527_1142_1567 | 139 |
| 274 | 3300049572 | Ga0501036_0525682 | Ga0501036_0525682_188_610 | 139 |
| 275 | 3300049574 | Ga0501038_0485428 | Ga0501038_0485428_455_880 | 139 |
| 276 | 3300049576 | Ga0501040_0177863 | Ga0501040_0177863_129_554 | 139 |
| 277 | 3300049578 | Ga0501042_0057757 | Ga0501042_0057757_65_490 | 139 |
| 278 | 3300049580 | Ga0501046_0056682 | Ga0501046_0056682_1156_1581 | 139 |
| 279 | 3300049582 | Ga0501048_0632337 | Ga0501048_0632337_171_596 | 139 |
| 280 | 3300049587 | Ga0501071_0090471 | Ga0501071_0090471_330_755 | 139 |
| 281 | 3300049588 | Ga0501072_0131041 | Ga0501072_0131041_1213_1638 | 139 |
| 282 | 3300049590 | Ga0501074_0074041 | Ga0501074_0074041_1506_1931 | 139 |
| 283 | 3300049591 | Ga0501075_0025587 | Ga0501075_0025587_3162_3587 | 139 |
| 284 | 3300049591 | Ga0501075_0993495 | Ga0501075_0993495_45_467 | 139 |
| 285 | 3300049592 | Ga0501076_0054944 | Ga0501076_0054944_1740_2165 | 139 |
| 286 | 3300049741 | Ga0501079_0142991 | Ga0501079_0142991_474_899 | 139 |
| 287 | 3300049741 | Ga0501079_0145295 | Ga0501079_0145295_1138_1563 | 139 |
| 288 | 3300049742 | Ga0501080_0189324 | Ga0501080_0189324_512_937 | 139 |
| 289 | 3300049822 | Ga0501035_0450303 | Ga0501035_0450303_222_647 | 139 |
| 290 | 3300049824 | Ga0501045_0044403 | Ga0501045_0044403_246_671 | 139 |
| 291 | 3300049824 | Ga0501045_0307551 | Ga0501045_0307551_389_814 | 139 |
| 292 | 3300050507 | nmdc:mga05p37_572185_c1 | nmdc:mga05p37_572185_c1_509_928 | 139 |
| 293 | 3300053077 | Ga0495601_0022682 | Ga0495601_0022682_3173_3598 | 139 |
| 294 | 3300053078 | Ga0495612_0137169 | Ga0495612_0137169_467_892 | 139 |
| 295 | 3300054114 | Ga0501084_0124074 | Ga0501084_0124074_929_1354 | 139 |
| 296 | 3300054114 | Ga0501084_0571707 | Ga0501084_0571707_432_857 | 139 |
| 297 | 3300060353 | Ga0501082_0057041 | Ga0501082_0057041_2528_2953 | 139 |
| 298 | 3300005445 | Ga0070708_100762679 | Ga0070708_1007626792 | 140 |
| 299 | 3300005468 | Ga0070707_100314544 | Ga0070707_1003145442 | 140 |
| 300 | 3300005535 | Ga0070684_100759767 | Ga0070684_1007597671 | 140 |
| 301 | 3300005536 | Ga0070697_100205403 | Ga0070697_1002054032 | 140 |
| 302 | 3300005536 | Ga0070697_100277780 | Ga0070697_1002777802 | 140 |
| 303 | 3300005618 | Ga0068864_100008744 | Ga0068864_1000087446 | 140 |
| 304 | 3300005841 | Ga0068863_100110111 | Ga0068863_1001101113 | 140 |
| 305 | 3300006358 | Ga0068871_101128103 | Ga0068871_1011281032 | 140 |
| 306 | 3300013297 | Ga0157378_10876057 | Ga0157378_108760572 | 140 |
| 307 | 3300014325 | Ga0163163_10684698 | Ga0163163_106846982 | 140 |
| 308 | 3300014968 | Ga0157379_10248430 | Ga0157379_102484302 | 140 |
| 309 | 3300025922 | Ga0207646_10985064 | Ga0207646_109850642 | 140 |
| 310 | 3300026088 | Ga0207641_10182108 | Ga0207641_101821083 | 140 |
| 311 | 3300026095 | Ga0207676_10044588 | Ga0207676_100445883 | 140 |
| 312 | 3300049584 | Ga0501068_0049620 | Ga0501068_0049620_1942_2364 | 140 |
| 313 | 3300049587 | Ga0501071_0050672 | Ga0501071_0050672_642_1064 | 140 |
| 314 | 3300005336 | Ga0070680_100000002 | Ga0070680_10000000222 | 141 |
| 315 | 3300005356 | Ga0070674_100769605 | Ga0070674_1007696051 | 141 |
| 316 | 3300025917 | Ga0207660_10000002 | Ga0207660_10000002630 | 141 |
| 317 | 3300032133 | Ga0316583_10044840 | Ga0316583_100448402 | 141 |
| 318 | 3300005341 | Ga0070691_10371900 | Ga0070691_103719002 | 142 |
| 319 | 3300005343 | Ga0070687_100233304 | Ga0070687_1002333042 | 142 |
| 320 | 3300005468 | Ga0070707_101496529 | Ga0070707_1014965291 | 142 |
| 321 | 3300005530 | Ga0070679_100396597 | Ga0070679_1003965971 | 142 |
| 322 | 3300005544 | Ga0070686_100299320 | Ga0070686_1002993202 | 142 |
| 323 | 3300005547 | Ga0070693_100068226 | Ga0070693_1000682264 | 142 |
| 324 | 3300005549 | Ga0070704_100361913 | Ga0070704_1003619131 | 142 |
| 325 | 3300006852 | Ga0075433_10075192 | Ga0075433_100751923 | 142 |
| 326 | 3300009177 | Ga0105248_10980270 | Ga0105248_109802701 | 142 |
| 327 | 3300009553 | Ga0105249_10844715 | Ga0105249_108447151 | 142 |
| 328 | 3300010375 | Ga0105239_10085897 | Ga0105239_100858974 | 142 |
| 329 | 3300010375 | Ga0105239_11996710 | Ga0105239_119967102 | 142 |
| 330 | 3300011119 | Ga0105246_10201505 | Ga0105246_102015051 | 142 |
| 331 | 3300013297 | Ga0157378_10097642 | Ga0157378_100976422 | 142 |
| 332 | 3300025885 | Ga0207653_10141234 | Ga0207653_101412341 | 142 |
| 333 | 3300025903 | Ga0207680_10771085 | Ga0207680_107710851 | 142 |
| 334 | 3300025911 | Ga0207654_11002175 | Ga0207654_110021752 | 142 |
| 335 | 3300025918 | Ga0207662_10326716 | Ga0207662_103267162 | 142 |
| 336 | 3300025922 | Ga0207646_11458057 | Ga0207646_114580571 | 142 |
| 337 | 3300025933 | Ga0207706_10161839 | Ga0207706_101618392 | 142 |
| 338 | 3300026095 | Ga0207676_11139575 | Ga0207676_111395752 | 142 |
| 339 | 3300048910 | Ga0496107_0455286 | Ga0496107_0455286_165_593 | 142 |
| 340 | 3300050513 | nmdc:mga0rr50_416633_c1 | nmdc:mga0rr50_416633_c1_583_1011 | 142 |
| 341 | 3300050515 | nmdc:mga0a205_728751_c1 | nmdc:mga0a205_728751_c1_236_664 | 142 |
| 342 | 3300003320 | rootH2_10220741 | rootH2_102207413 | 143 |
| 343 | 3300005471 | Ga0070698_100020249 | Ga0070698_1000202499 | 143 |
| 344 | 3300005518 | Ga0070699_100036457 | Ga0070699_1000364576 | 143 |
| 345 | 3300005518 | Ga0070699_100931587 | Ga0070699_1009315871 | 143 |
| 346 | 3300005546 | Ga0070696_100001227 | Ga0070696_1000012272 | 143 |
| 347 | 3300005546 | Ga0070696_100672271 | Ga0070696_1006722711 | 143 |
| 348 | 3300009176 | Ga0105242_10143513 | Ga0105242_101435133 | 143 |
| 349 | 3300025922 | Ga0207646_10168860 | Ga0207646_101688603 | 143 |
| 350 | 3300025934 | Ga0207686_10105260 | Ga0207686_101052602 | 143 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar