F418260

General Info

Members Datasets Scaffolds Average Seq Length
350 243 700 357

Family's Representative Sequence

Representative Sequence 3300025909|Ga0207705_10142306|Ga0207705_101423062
Length 425
Sequence MTFGITRPRTLFEKIWDAHVVRPATAEEAGGDDWHDGSILRCASPGLRWTRSPGPAGLWWSMTAVNLGLPLRASAPAVVPGAVPELAGRPAHPGLIDRFGRVARDLRVSVTEKCSLRCTYCMPAEGLPAIPRDDLLSAAEIARLVGIGVRELGVREVRFTGGEPLMRADLAEIVGRSAAVAPGVDLSITTNGIGLDHRIHSLVEAGLTRVNVSLDTVDREHFARLTRRDRLPAVLAGIRAAHDAGLTPLKLNAVMMRETLHDAPSLLAWALENGCRLRFIEQMPLDADRSWLRENMVPADELLAVLGERFTLTEAGRDDPHAPAEEWLVDGWMLNGAPATVGIIASVTRSFCAACDRTRITAEGTVRSCLFGDDETDLRGLLRGGADDDEIAQWWRAAMWGKQAGHGMDAAGFAPPKRSMGAIGG

Samples

Sample ID Description Type Environment
1 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
49 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
50 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
88 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
89 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
90 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
91 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
92 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
93 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
94 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
95 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
96 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
97 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
98 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
119 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
155 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
179 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
180 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
181 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
182 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
183 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
184 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
186 2547132424 Nocardia nova SH22a Isolate Unclassified
187 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
188 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
189 2643221613 Oerskovia sp. Root22 Isolate Unclassified
190 2643221721 Oerskovia sp. Root918 Isolate Unclassified
191 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
192 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
193 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
194 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
195 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
196 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
197 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
198 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
199 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
200 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
201 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
202 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
203 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
204 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
205 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
206 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
207 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
208 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
209 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
210 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
211 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
212 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
213 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
214 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
215 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
216 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
217 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
218 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
219 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
220 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
221 2920879853 Kocuria salina CV6 Isolate Unclassified
222 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
223 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
224 2928153084 Leifsonia sp. 563 Isolate Unclassified
225 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
226 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
227 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
228 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
229 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
230 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
231 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
232 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
233 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
234 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
235 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
236 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
237 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
238 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
239 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
240 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
241 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
242 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
243 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 81.71
Metatranscriptomes 0.57
Isolates 17.71

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 8
Nodule 0
Rhizoplane 7.71
Rhizosphere 72.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207705_10142306 3300025909 Bacteria 1792
2 JGI25151J46595_10023795 3300003187 Bacteria 2516
3 Ga0055533_1000001 3300003756 Bacteria 1863437
4 Ga0055525_1000231 3300003759 Bacteria 59489
5 Ga0055527_1000005 3300003760 Bacteria 504776
6 Ga0055542_1000006 3300003762 Bacteria 504776
7 Ga0055529_1000334 3300003763 Bacteria 52660
8 Ga0055541_1001020 3300003841 Bacteria 6523
9 Ga0065714_10094882 3300005288 Bacteria 1803
10 Ga0070658_10068806 3300005327 Bacteria 2895
11 Ga0070670_100153049 3300005331 Bacteria 1996
12 Ga0070677_10080443 3300005333 Bacteria 1393
13 Ga0070666_10104898 3300005335 Bacteria 1952
14 Ga0068868_100230761 3300005338 Bacteria 1553
15 Ga0070661_100287255 3300005344 Bacteria 1277
16 Ga0070669_100007805 3300005353 Bacteria 7646
17 Ga0070675_100046770 3300005354 Bacteria 3545
18 Ga0070671_100017698 3300005355 Bacteria 5776
19 Ga0070674_100049682 3300005356 Bacteria 2885
20 Ga0070673_100058345 3300005364 Bacteria 3051
21 Ga0070659_100040518 3300005366 Bacteria 3640
22 Ga0070667_100015098 3300005367 Bacteria 6379
23 Ga0070667_100120518 3300005367 Bacteria 2281
24 Ga0070714_100163368 3300005435 Bacteria 2016
25 Ga0070672_100024157 3300005543 Bacteria 4487
26 Ga0070665_100334579 3300005548 Bacteria 1519
27 Ga0068855_100072194 3300005563 Bacteria 4013
28 Ga0068855_100189308 3300005563 Bacteria 2322
29 Ga0068859_100021225 3300005617 Bacteria 6517
30 Ga0068858_100001687 3300005842 Bacteria 22569
31 Ga0075432_10009526 3300006058 Bacteria 3309
32 Ga0075370_10034142 3300006353 Bacteria 2851
33 Ga0097620_100021225 3300006931 Bacteria 6517
34 Ga0105244_10004039 3300009036 Bacteria 10247
35 Ga0105243_10005694 3300009148 Bacteria 9691
36 Ga0105243_10046385 3300009148 Bacteria 3418
37 Ga0105248_10127188 3300009177 Bacteria 2874
38 Ga0105238_10119202 3300009551 Bacteria 2619
39 Ga0157369_10153616 3300013105 Bacteria 2432
40 Ga0157375_10270237 3300013308 Bacteria 1862
41 Ga0157375_10330523 3300013308 Bacteria 1689
42 Ga0157379_10005574 3300014968 Bacteria 10817
43 Ga0206354_10019886 3300020081 Bacteria 4525
44 Ga0206353_11171241 3300020082 Bacteria 3872
45 Ga0209566_100055 3300025225 Bacteria 210307
46 Ga0209674_100001 3300025226 Bacteria 4013750
47 Ga0209672_100003 3300025228 Bacteria 1560476
48 Ga0209563_100001 3300025230 Bacteria 4013775
49 Ga0207425_1003276 3300025245 Bacteria 5272
50 Ga0209677_100001 3300025253 Bacteria 4013787
51 Ga0209677_100673 3300025253 Bacteria 17620
52 Ga0209148_1000004 3300025254 Bacteria 1844481
53 Ga0209129_1000079 3300025258 Bacteria 187308
54 Ga0209233_1026154 3300025261 Bacteria 1431
55 Ga0209455_1000022 3300025272 Bacteria 688910
56 Ga0209455_1001707 3300025272 Bacteria 9400
57 Ga0209025_1000458 3300025294 Bacteria 79809
58 Ga0207655_1034329 3300025728 Bacteria 2282
59 Ga0207713_1052097 3300025735 Bacteria 1623
60 Ga0207645_10012935 3300025907 Bacteria 5645
61 Ga0207705_10017697 3300025909 Bacteria 5098
62 Ga0207681_10040590 3300025923 Bacteria 3098
63 Ga0207659_10345546 3300025926 Bacteria 1233
64 Ga0207664_10140901 3300025929 Bacteria 2040
65 Ga0207644_10082726 3300025931 Bacteria 2376
66 Ga0207690_10011784 3300025932 Bacteria 5228
67 Ga0207709_10009117 3300025935 Bacteria 5468
68 Ga0207691_10004181 3300025940 Bacteria 14020
69 Ga0207667_10012146 3300025949 Bacteria 9946
70 Ga0207667_10059136 3300025949 Bacteria 4016
71 Ga0207651_10064828 3300025960 Bacteria 2559
72 Ga0207677_10046299 3300026023 Bacteria 2911
73 Ga0207703_10000168 3300026035 Bacteria 76234
74 Ga0207639_10001513 3300026041 Bacteria 15626
75 Ga0207683_10002349 3300026121 Bacteria 16575
76 Ga0207428_10002426 3300027907 Bacteria 18605
77 Ga0314311_1070805 3300030733 Bacteria 2054
78 Ga0307408_100053580 3300031548 Bacteria 2913
79 Ga0307408_100082559 3300031548 Bacteria 2405
80 Ga0307408_100112188 3300031548 Bacteria 2096
81 Ga0307408_100162964 3300031548 Bacteria 1772
82 Ga0307408_100265768 3300031548 Bacteria 1422
83 Ga0307408_100364081 3300031548 Bacteria 1231
84 Ga0307405_10031033 3300031731 Bacteria 3141
85 Ga0307405_10066356 3300031731 Bacteria 2300
86 Ga0307405_10086332 3300031731 Bacteria 2065
87 Ga0307405_10160480 3300031731 Bacteria 1592
88 Ga0307413_10059384 3300031824 Bacteria 2349
89 Ga0307413_10198776 3300031824 Bacteria 1446
90 Ga0307410_10014668 3300031852 Bacteria 4620
91 Ga0307410_10062105 3300031852 Bacteria 2558
92 Ga0307410_10103937 3300031852 Bacteria 2041
93 Ga0307410_10131425 3300031852 Bacteria 1839
94 Ga0307410_10231470 3300031852 Bacteria 1427
95 Ga0307410_10330937 3300031852 Bacteria 1211
96 Ga0307406_10098372 3300031901 Bacteria 1986
97 Ga0307407_10050675 3300031903 Bacteria 2376
98 Ga0307412_10020370 3300031911 Bacteria 4036
99 Ga0307412_10062391 3300031911 Bacteria 2509
100 Ga0307412_10332840 3300031911 Bacteria 1212
101 Ga0307409_100062998 3300031995 Bacteria 2906
102 Ga0307409_100073915 3300031995 Bacteria 2721
103 Ga0307409_100178665 3300031995 Bacteria 1876
104 Ga0307416_100007848 3300032002 Bacteria 6823
105 Ga0307416_100049591 3300032002 Bacteria 3339
106 Ga0307416_100051571 3300032002 Bacteria 3287
107 Ga0307416_100086893 3300032002 Bacteria 2667
108 Ga0307416_100096625 3300032002 Bacteria 2555
109 Ga0307416_100256475 3300032002 Bacteria 1706
110 Ga0307416_100269492 3300032002 Bacteria 1670
111 Ga0307416_100370287 3300032002 Bacteria 1458
112 Ga0307414_10045184 3300032004 Bacteria 3015
113 Ga0307414_10096370 3300032004 Bacteria 2213
114 Ga0307411_10016473 3300032005 Bacteria 4184
115 Ga0307411_10175753 3300032005 Bacteria 1620
116 Ga0307415_100006900 3300032126 Bacteria 6166
117 Ga0307415_100025474 3300032126 Bacteria 3713
118 Ga0307415_100046996 3300032126 Bacteria 2903
119 Ga0307415_100059996 3300032126 Bacteria 2626
120 Ga0307415_100122705 3300032126 Bacteria 1951
121 Ga0395899_0003594 3300037312 Bacteria 12264
122 Ga0395899_0178636 3300037312 Bacteria 1491
123 Ga0395900_0013120 3300037418 Bacteria 8467
124 Ga0395900_0019582 3300037418 Bacteria 6900
125 Ga0395900_0030021 3300037418 Bacteria 5580
126 Ga0395900_0040872 3300037418 Bacteria 4780
127 Ga0395900_0074651 3300037418 Bacteria 3486
128 Ga0395900_0096752 3300037418 Bacteria 3033
129 Ga0395898_0000246 3300037466 Bacteria 135487
130 Ga0395898_0031251 3300037466 Bacteria 5322
131 Ga0395898_0052083 3300037466 Bacteria 3999
132 Ga0395898_0089077 3300037466 Bacteria 2970
133 Ga0395898_0103680 3300037466 Bacteria 2728
134 Ga0395898_0310398 3300037466 Bacteria 1504
135 Ga0395905_0178567 3300037471 Bacteria 1993
136 Ga0395901_0047597 3300038443 Bacteria 4452
137 Ga0395901_0120171 3300038443 Bacteria 2761
138 Ga0395901_0136727 3300038443 Bacteria 2575
139 Ga0395901_0173814 3300038443 Bacteria 2260
140 Ga0439436_0012538 3300041404 Bacteria 2571
141 Ga0439436_0017751 3300041404 Bacteria 2129
142 Ga0439436_0029426 3300041404 Bacteria 1600
143 Ga0439436_0032986 3300041404 Bacteria 1500
144 Ga0439438_030070 3300041405 Bacteria 1450
145 Ga0439466_0007329 3300041411 Bacteria 4179
146 Ga0439466_0010672 3300041411 Bacteria 3413
147 Ga0439466_0039439 3300041411 Bacteria 1583
148 Ga0439465_0024869 3300041413 Bacteria 1888
149 Ga0439465_0109911 3300041413 Bacteria 959
150 Ga0439433_0006072 3300041999 Bacteria 2595
151 Ga0439442_000462 3300042002 Bacteria 9278
152 Ga0439442_001525 3300042002 Bacteria 4542
153 Ga0439442_023504 3300042002 Bacteria 1281
154 Ga0439449_0000825 3300042007 Bacteria 11992
155 Ga0439449_0003162 3300042007 Bacteria 6411
156 Ga0439449_0031246 3300042007 Bacteria 1985
157 Ga0439462_0009956 3300042015 Bacteria 2406
158 Ga0439462_0017359 3300042015 Bacteria 1864
159 Ga0450920_001133 3300042122 Bacteria 4370
160 Ga0450920_001563 3300042122 Bacteria 3809
161 Ga0450907_000350 3300042146 Bacteria 14354
162 Ga0439434_0001022 3300042435 Bacteria 8082
163 Ga0450918_009976 3300042531 Bacteria 1659
164 Ga0466972_0028378 3300044658 Bacteria 2761
165 Ga0466972_0030524 3300044658 Bacteria 2652
166 Ga0466972_0078352 3300044658 Bacteria 1574
167 Ga0466965_0028372 3300044683 Bacteria 2720
168 Ga0466966_0090180 3300044684 Bacteria 1903
169 Ga0466961_0179896 3300044693 Bacteria 1313
170 Ga0466971_0073057 3300044719 Bacteria 1559
171 Ga0466970_0019411 3300044765 Bacteria 3524
172 Ga0466970_0019712 3300044765 Bacteria 3498
173 Ga0466957_0044197 3300044842 Bacteria 2700
174 Ga0466960_0020401 3300044901 Bacteria 2935
175 Ga0466959_0023078 3300045049 Bacteria 4602
176 Ga0495627_009931 3300046453 Bacteria 3484
177 Ga0495629_0074668 3300046459 Bacteria 2367
178 Ga0495653_0004126 3300046463 Bacteria 11751
179 Ga0495580_0004189 3300046472 Bacteria 12137
180 Ga0495639_0011556 3300046475 Bacteria 3809
181 Ga0495662_0010092 3300046476 Bacteria 4632
182 Ga0495664_0030122 3300046477 Bacteria 3178
183 Ga0495594_0012865 3300046499 Bacteria 4364
184 Ga0495607_0027965 3300046501 Bacteria 3482
185 Ga0495630_0064153 3300046517 Bacteria 2759
186 Ga0495642_0004830 3300046528 Bacteria 5207
187 Ga0495665_0009676 3300046531 Bacteria 5219
188 Ga0495665_0017480 3300046531 Bacteria 3857
189 Ga0495587_0006004 3300046536 Bacteria 7915
190 Ga0495645_0020246 3300046543 Bacteria 4797
191 Ga0495656_0022608 3300046615 Bacteria 2465
192 Ga0495635_0040692 3300046663 Bacteria 3212
193 Ga0495588_0008681 3300046674 Bacteria 4669
194 Ga0495588_0019511 3300046674 Bacteria 3321
195 Ga0495657_0015836 3300046675 Bacteria 5507
196 Ga0495623_0011111 3300046679 Bacteria 5828
197 Ga0495670_0005585 3300046691 Bacteria 6170
198 Ga0495600_0000445 3300046809 Bacteria 21337
199 Ga0495581_0003897 3300047315 Bacteria 8583
200 Ga0495581_0080244 3300047315 Bacteria 1888
201 Ga0495604_0095551 3300047317 Bacteria 2195
202 Ga0495636_0008512 3300047318 Bacteria 4049
203 Ga0495636_0097197 3300047318 Bacteria 1284
204 Ga0495672_0035933 3300047320 Bacteria 3047
205 Ga0495680_0013588 3300047322 Bacteria 7094
206 Ga0495683_0000772 3300047323 Bacteria 23032
207 Ga0495675_0009083 3300047444 Bacteria 6177
208 Ga0495684_0040162 3300047471 Bacteria 3587
209 Ga0496100_0166392 3300048903 Bacteria 1584
210 Ga0496100_0382861 3300048903 Bacteria 1068
211 Ga0496101_0027393 3300048904 Bacteria 3970
212 Ga0496101_0038660 3300048904 Bacteria 3389
213 Ga0496101_0207547 3300048904 Bacteria 1516
214 Ga0496101_0409482 3300048904 Bacteria 1068
215 Ga0496102_0088316 3300048905 Bacteria 2865
216 Ga0496102_0117299 3300048905 Bacteria 2484
217 Ga0496102_0186602 3300048905 Bacteria 1954
218 Ga0496103_0055142 3300048906 Bacteria 2464
219 Ga0496104_0162141 3300048907 Bacteria 2144
220 Ga0496105_0100407 3300048908 Bacteria 2389
221 Ga0496105_0162685 3300048908 Bacteria 1832
222 Ga0496106_0024601 3300048909 Bacteria 4478
223 Ga0496106_0119035 3300048909 Bacteria 2063
224 Ga0496106_0197986 3300048909 Bacteria 1598
225 Ga0496107_0036954 3300048910 Bacteria 3504
226 Ga0496109_0351936 3300048912 Bacteria 1391
227 Ga0496110_0023136 3300048913 Bacteria 5284
228 Ga0496111_0052728 3300048914 Bacteria 2937
229 Ga0496111_0172812 3300048914 Bacteria 1605
230 Ga0496112_0020858 3300048915 Bacteria 6219
231 Ga0496113_0049487 3300048916 Bacteria 3129
232 Ga0496114_0038861 3300048917 Bacteria 3938
233 Ga0496114_0105938 3300048917 Bacteria 2405
234 Ga0496114_0246052 3300048917 Bacteria 1573
235 Ga0496115_0034085 3300048918 Bacteria 4023
236 Ga0496117_0008407 3300048920 Bacteria 9810
237 Ga0496117_0011773 3300048920 Bacteria 7796
238 Ga0496117_0062646 3300048920 Bacteria 2547
239 Ga0496118_0005994 3300048921 Bacteria 13564
240 Ga0496119_0004529 3300048922 Bacteria 13790
241 Ga0496120_0001093 3300048923 Bacteria 35422
242 Ga0496124_0123734 3300048927 Bacteria 2063
243 Ga0496125_0043406 3300048928 Bacteria 3816
244 Ga0496125_0147403 3300048928 Bacteria 1624
245 Ga0496126_0004562 3300048929 Bacteria 16454
246 Ga0496126_0350024 3300048929 Bacteria 1208
247 Ga0501031_0004323 3300049568 Bacteria 9194
248 Ga0501032_0000360 3300049569 Bacteria 37966
249 Ga0501032_0008920 3300049569 Bacteria 7291
250 Ga0501032_0012342 3300049569 Bacteria 6107
251 Ga0501033_0055356 3300049570 Bacteria 2932
252 Ga0501033_0067452 3300049570 Bacteria 2630
253 Ga0501034_0000015 3300049571 Bacteria 296163
254 Ga0501034_0036877 3300049571 Bacteria 4950
255 Ga0501036_0008708 3300049572 Bacteria 8322
256 Ga0501036_0212521 3300049572 Bacteria 1625
257 Ga0501037_0023258 3300049573 Bacteria 4582
258 Ga0501037_0037206 3300049573 Bacteria 3587
259 Ga0501038_0028087 3300049574 Bacteria 4999
260 Ga0501038_0055279 3300049574 Bacteria 3410
261 Ga0501038_0064109 3300049574 Bacteria 3134
262 Ga0501039_0058838 3300049575 Bacteria 2977
263 Ga0501042_0004516 3300049578 Bacteria 8880
264 Ga0501043_0002592 3300049579 Bacteria 15270
265 Ga0501043_0108657 3300049579 Bacteria 2178
266 Ga0501046_0001917 3300049580 Bacteria 19745
267 Ga0501047_0052131 3300049581 Bacteria 3954
268 Ga0501047_0090742 3300049581 Bacteria 2932
269 Ga0501048_0013751 3300049582 Bacteria 6004
270 Ga0501070_0102519 3300049586 Bacteria 2367
271 Ga0501083_0013892 3300049744 Bacteria 5630
272 Ga0501083_0091034 3300049744 Bacteria 2014
273 Ga0501035_0002180 3300049822 Bacteria 19423
274 Ga0501035_0060567 3300049822 Bacteria 3369
275 Ga0501044_0068539 3300049823 Bacteria 3613
276 Ga0501044_0176515 3300049823 Bacteria 2105
277 Ga0501044_0288377 3300049823 Bacteria 1573
278 Ga0501044_0384209 3300049823 Bacteria 1319
279 Ga0501045_0085312 3300049824 Bacteria 2330
280 nmdc:mga00v17_134739_c1 3300050491 Bacteria 1580
281 Ga0495655_0011422 3300053083 Bacteria 1784
282 Ga0500650_0108592 3300053098 Bacteria 1295
283 Ga0500556_0000001 3300053104 Bacteria 1135060
284 Ga0500568_0000003 3300053139 Bacteria 863587
285 Ga0500573_0028272 3300053140 Bacteria 3229
286 Ga0500573_0082409 3300053140 Bacteria 1827
287 Ga0500577_0001521 3300053142 Bacteria 5905
288 Ga0590075_008500 3300059424 Bacteria 2453
289 2537898607 2537561592 Bacteria 4348607
290 2548694218 2547132424 Bacteria 8348532
291 2552109768 2551306166 Bacteria 9731570
292 2566994305 2565956761 Bacteria 6601618
293 2644082171 2643221613 Bacteria 4622396
294 2644664730 2643221721 Bacteria 4486924
295 2691513443 2690315906 Bacteria 4517044
296 2738693484 2738541272 Bacteria 6848551
297 2738887109 2738541308 Bacteria 7020677
298 2739239808 2738543011 Bacteria 5731169
299 2739323100 2738543027 Bacteria 6409078
300 2739367284 2738543034 Bacteria 6084756
301 2739607708 2739367654 Bacteria 6049412
302 2744958018 2744054611 Bacteria 5611514
303 2760304272 2758568522 Bacteria 5953541
304 2760621776 2758568621 Bacteria 5967089
305 2808830694 2808606357 Bacteria 4466944
306 2808879804 2808606366 Bacteria 4415912
307 2808894948 2808606370 Bacteria 4942454
308 2808895901 2808606371 Bacteria 4251511
309 2810363469 2808606700 Bacteria 3482157
310 2839988433 2839986021 Bacteria 3685650
311 2844841843 2844841374 Bacteria 3917147
312 2852646128 2852643534 Bacteria 3013378
313 2857730993 2857729791 Bacteria 4040535
314 2857743738 2857740372 Bacteria 4782044
315 2889300819 2889300758 Bacteria 5690814
316 2904499640 2904497146 Bacteria 4731781
317 2904780296 2904776348 Bacteria 4658726
318 2905930225 2905926851 Bacteria 4423176
319 2910811689 2910809715 Bacteria 4982797
320 2919036090 2919034639 Bacteria 4763403
321 2919053234 2919051321 Bacteria 4210889
322 2919059032 2919055335 Bacteria 3875751
323 2919523891 2919523602 Bacteria 3788128
324 2919716406 2919713450 Bacteria 7431245
325 2920879974 2920879853 Bacteria 4216831
326 2920880642 2920879853 Bacteria 4216831
327 2920883217 2920879853 Bacteria 4216831
328 2928122446 2928121344 Bacteria 3972376
329 2928142638 2928142448 Bacteria 5288925
330 2928153120 2928153084 Bacteria 4020257
331 2932399870 2932398195 Bacteria 3847976
332 2932431038 2932426870 Bacteria 4547726
333 2932432382 2932431166 Bacteria 4215299
334 2933419120 2933418574 Bacteria 4476724
335 2935894297 2935890801 Bacteria 4593001
336 2939600006 2939598168 Bacteria 4687164
337 2939647933 2939647034 Bacteria 4681660
338 2939660052 2939657138 Bacteria 3740283
339 2939678484 2939674588 Bacteria 4844420
340 2939744329 2939743619 Bacteria 5762299
341 2945919622 2945916053 Bacteria 4555517
342 2945924467 2945920336 Bacteria 4501603
343 2946004012 2946003308 Bacteria 3857229
344 2946039765 2946037020 Bacteria 4900426
345 2946063347 2946059875 Bacteria 4386623
346 2954000990 2953998280 Bacteria 4812144
347 2974303269 2974302888 Bacteria 4369871
348 2974317130 2974315732 Bacteria 4602776
349 2984525336 2984523437 Bacteria 4508481
350 2984527273 2984523437 Bacteria 4508481
351 Ga0207705_10142306
352 JGI25151J46595_10023795
353 Ga0055533_1000001
354 Ga0055525_1000231
355 Ga0055527_1000005
356 Ga0055542_1000006
357 Ga0055529_1000334
358 Ga0055541_1001020
359 Ga0065714_10094882
360 Ga0070658_10068806
361 Ga0070670_100153049
362 Ga0070677_10080443
363 Ga0070666_10104898
364 Ga0068868_100230761
365 Ga0070661_100287255
366 Ga0070669_100007805
367 Ga0070675_100046770
368 Ga0070671_100017698
369 Ga0070674_100049682
370 Ga0070673_100058345
371 Ga0070659_100040518
372 Ga0070667_100015098
373 Ga0070667_100120518
374 Ga0070714_100163368
375 Ga0070672_100024157
376 Ga0070665_100334579
377 Ga0068855_100072194
378 Ga0068855_100189308
379 Ga0068859_100021225
380 Ga0068858_100001687
381 Ga0075432_10009526
382 Ga0075370_10034142
383 Ga0097620_100021225
384 Ga0105244_10004039
385 Ga0105243_10005694
386 Ga0105243_10046385
387 Ga0105248_10127188
388 Ga0105238_10119202
389 Ga0157369_10153616
390 Ga0157375_10270237
391 Ga0157375_10330523
392 Ga0157379_10005574
393 Ga0206354_10019886
394 Ga0206353_11171241
395 Ga0209566_100055
396 Ga0209674_100001
397 Ga0209672_100003
398 Ga0209563_100001
399 Ga0207425_1003276
400 Ga0209677_100001
401 Ga0209677_100673
402 Ga0209148_1000004
403 Ga0209129_1000079
404 Ga0209233_1026154
405 Ga0209455_1000022
406 Ga0209455_1001707
407 Ga0209025_1000458
408 Ga0207655_1034329
409 Ga0207713_1052097
410 Ga0207645_10012935
411 Ga0207705_10017697
412 Ga0207681_10040590
413 Ga0207659_10345546
414 Ga0207664_10140901
415 Ga0207644_10082726
416 Ga0207690_10011784
417 Ga0207709_10009117
418 Ga0207691_10004181
419 Ga0207667_10012146
420 Ga0207667_10059136
421 Ga0207651_10064828
422 Ga0207677_10046299
423 Ga0207703_10000168
424 Ga0207639_10001513
425 Ga0207683_10002349
426 Ga0207428_10002426
427 Ga0314311_1070805
428 Ga0307408_100053580
429 Ga0307408_100082559
430 Ga0307408_100112188
431 Ga0307408_100162964
432 Ga0307408_100265768
433 Ga0307408_100364081
434 Ga0307405_10031033
435 Ga0307405_10066356
436 Ga0307405_10086332
437 Ga0307405_10160480
438 Ga0307413_10059384
439 Ga0307413_10198776
440 Ga0307410_10014668
441 Ga0307410_10062105
442 Ga0307410_10103937
443 Ga0307410_10131425
444 Ga0307410_10231470
445 Ga0307410_10330937
446 Ga0307406_10098372
447 Ga0307407_10050675
448 Ga0307412_10020370
449 Ga0307412_10062391
450 Ga0307412_10332840
451 Ga0307409_100062998
452 Ga0307409_100073915
453 Ga0307409_100178665
454 Ga0307416_100007848
455 Ga0307416_100049591
456 Ga0307416_100051571
457 Ga0307416_100086893
458 Ga0307416_100096625
459 Ga0307416_100256475
460 Ga0307416_100269492
461 Ga0307416_100370287
462 Ga0307414_10045184
463 Ga0307414_10096370
464 Ga0307411_10016473
465 Ga0307411_10175753
466 Ga0307415_100006900
467 Ga0307415_100025474
468 Ga0307415_100046996
469 Ga0307415_100059996
470 Ga0307415_100122705
471 Ga0395899_0003594
472 Ga0395899_0178636
473 Ga0395900_0013120
474 Ga0395900_0019582
475 Ga0395900_0030021
476 Ga0395900_0040872
477 Ga0395900_0074651
478 Ga0395900_0096752
479 Ga0395898_0000246
480 Ga0395898_0031251
481 Ga0395898_0052083
482 Ga0395898_0089077
483 Ga0395898_0103680
484 Ga0395898_0310398
485 Ga0395905_0178567
486 Ga0395901_0047597
487 Ga0395901_0120171
488 Ga0395901_0136727
489 Ga0395901_0173814
490 Ga0439436_0012538
491 Ga0439436_0017751
492 Ga0439436_0029426
493 Ga0439436_0032986
494 Ga0439438_030070
495 Ga0439466_0007329
496 Ga0439466_0010672
497 Ga0439466_0039439
498 Ga0439465_0024869
499 Ga0439465_0109911
500 Ga0439433_0006072
501 Ga0439442_000462
502 Ga0439442_001525
503 Ga0439442_023504
504 Ga0439449_0000825
505 Ga0439449_0003162
506 Ga0439449_0031246
507 Ga0439462_0009956
508 Ga0439462_0017359
509 Ga0450920_001133
510 Ga0450920_001563
511 Ga0450907_000350
512 Ga0439434_0001022
513 Ga0450918_009976
514 Ga0466972_0028378
515 Ga0466972_0030524
516 Ga0466972_0078352
517 Ga0466965_0028372
518 Ga0466966_0090180
519 Ga0466961_0179896
520 Ga0466971_0073057
521 Ga0466970_0019411
522 Ga0466970_0019712
523 Ga0466957_0044197
524 Ga0466960_0020401
525 Ga0466959_0023078
526 Ga0495627_009931
527 Ga0495629_0074668
528 Ga0495653_0004126
529 Ga0495580_0004189
530 Ga0495639_0011556
531 Ga0495662_0010092
532 Ga0495664_0030122
533 Ga0495594_0012865
534 Ga0495607_0027965
535 Ga0495630_0064153
536 Ga0495642_0004830
537 Ga0495665_0009676
538 Ga0495665_0017480
539 Ga0495587_0006004
540 Ga0495645_0020246
541 Ga0495656_0022608
542 Ga0495635_0040692
543 Ga0495588_0008681
544 Ga0495588_0019511
545 Ga0495657_0015836
546 Ga0495623_0011111
547 Ga0495670_0005585
548 Ga0495600_0000445
549 Ga0495581_0003897
550 Ga0495581_0080244
551 Ga0495604_0095551
552 Ga0495636_0008512
553 Ga0495636_0097197
554 Ga0495672_0035933
555 Ga0495680_0013588
556 Ga0495683_0000772
557 Ga0495675_0009083
558 Ga0495684_0040162
559 Ga0496100_0166392
560 Ga0496100_0382861
561 Ga0496101_0027393
562 Ga0496101_0038660
563 Ga0496101_0207547
564 Ga0496101_0409482
565 Ga0496102_0088316
566 Ga0496102_0117299
567 Ga0496102_0186602
568 Ga0496103_0055142
569 Ga0496104_0162141
570 Ga0496105_0100407
571 Ga0496105_0162685
572 Ga0496106_0024601
573 Ga0496106_0119035
574 Ga0496106_0197986
575 Ga0496107_0036954
576 Ga0496109_0351936
577 Ga0496110_0023136
578 Ga0496111_0052728
579 Ga0496111_0172812
580 Ga0496112_0020858
581 Ga0496113_0049487
582 Ga0496114_0038861
583 Ga0496114_0105938
584 Ga0496114_0246052
585 Ga0496115_0034085
586 Ga0496117_0008407
587 Ga0496117_0011773
588 Ga0496117_0062646
589 Ga0496118_0005994
590 Ga0496119_0004529
591 Ga0496120_0001093
592 Ga0496124_0123734
593 Ga0496125_0043406
594 Ga0496125_0147403
595 Ga0496126_0004562
596 Ga0496126_0350024
597 Ga0501031_0004323
598 Ga0501032_0000360
599 Ga0501032_0008920
600 Ga0501032_0012342
601 Ga0501033_0055356
602 Ga0501033_0067452
603 Ga0501034_0000015
604 Ga0501034_0036877
605 Ga0501036_0008708
606 Ga0501036_0212521
607 Ga0501037_0023258
608 Ga0501037_0037206
609 Ga0501038_0028087
610 Ga0501038_0055279
611 Ga0501038_0064109
612 Ga0501039_0058838
613 Ga0501042_0004516
614 Ga0501043_0002592
615 Ga0501043_0108657
616 Ga0501046_0001917
617 Ga0501047_0052131
618 Ga0501047_0090742
619 Ga0501048_0013751
620 Ga0501070_0102519
621 Ga0501083_0013892
622 Ga0501083_0091034
623 Ga0501035_0002180
624 Ga0501035_0060567
625 Ga0501044_0068539
626 Ga0501044_0176515
627 Ga0501044_0288377
628 Ga0501044_0384209
629 Ga0501045_0085312
630 nmdc:mga00v17_134739_c1
631 Ga0495655_0011422
632 Ga0500650_0108592
633 Ga0500556_0000001
634 Ga0500568_0000003
635 Ga0500573_0028272
636 Ga0500573_0082409
637 Ga0500577_0001521
638 Ga0590075_008500
639 2537898607
640 2548694218
641 2552109768
642 2566994305
643 2644082171
644 2644664730
645 2691513443
646 2738693484
647 2738887109
648 2739239808
649 2739323100
650 2739367284
651 2739607708
652 2744958018
653 2760304272
654 2760621776
655 2808830694
656 2808879804
657 2808894948
658 2808895901
659 2810363469
660 2839988433
661 2844841843
662 2852646128
663 2857730993
664 2857743738
665 2889300819
666 2904499640
667 2904780296
668 2905930225
669 2910811689
670 2919036090
671 2919053234
672 2919059032
673 2919523891
674 2919716406
675 2920879974
676 2920880642
677 2920883217
678 2928122446
679 2928142638
680 2928153120
681 2932399870
682 2932431038
683 2932432382
684 2933419120
685 2935894297
686 2939600006
687 2939647933
688 2939660052
689 2939678484
690 2939744329
691 2945919622
692 2945924467
693 2946004012
694 2946039765
695 2946063347
696 2954000990
697 2974303269
698 2974317130
699 2984525336
700 2984527273

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

108

270

0.97

PF06463

Mob_synth_C

Molybdenum Cofactor Synthesis C

275

408

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.9017 33 351
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.9017 33 351
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.8433 33 351
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.8408 33 351
5v1t-assembly1.cif.gz_A crystal structure of streptococcus suis suib bound to precursor peptide suia 0.8217 37 247
ID Description Score Start End Superfamily
af_P9WJS1_27_360_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9421 30 381 3.20.20.70
af_P9WJS1_27_360_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9394 30 381 3.20.20.70
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9174 33 381 3.20.20.70
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.904 33 381 3.20.20.70
1tv8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9017 33 351 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2P7P2C6-F1-model_v4 deleted 0.9908 96 184
AF-A0A3D5GIT7-F1-model_v4 GTP 3',8-cyclase MoaA 0.9761 33 225 GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A4R8H3R1-F1-model_v4 deleted 0.9729 33 205
AF-A0A3D5GIT7-F1-model_v4 GTP 3',8-cyclase MoaA 0.9711 33 225 GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A2P7P2C6-F1-model_v4 deleted 0.9692 96 184

Map