F418268

General Info

Members Datasets Scaffolds Average Seq Length
350 174 350 225

Family's Representative Sequence

Representative Sequence 3300025925|Ga0207650_10583059|Ga0207650_105830592
Length 248
Sequence MAASPVGMKRFYGLLAAVAVIGIGLLGYQLSKPATVSIPANVQIGVKDTAGFHGYVKGDANAPVEITEYADYQCPFCQTFATLQMPTIEERLIRTGRLRWRYRDFPLQQHPFSRVAAHSAACADDQGKYWDQHQKIYDGQAEWAAARDAAPIFRQYAQADGLDLAKYDACMSGGVHAGRIQASYEEGVRVGVQSTPTLLIGGRLLHAYGVSQSPPIMRYRVYGMWLTFTSLGLAALVCLALSTLFLAV

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
90 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
91 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
92 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
93 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
94 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
95 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
100 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
101 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
102 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
103 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
146 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
147 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
148 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
149 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
150 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
151 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
152 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
158 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
159 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
172 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.29
Rhizosphere 85.14
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_8174435 2162886012 Bacteria 1333
2 rootL2_10084260 3300003322 Bacteria 2120
3 rootL2_10164352 3300003322 Bacteria 4423
4 Ga0065715_10322030 3300005293 Unclassified 1000
5 Ga0068869_100477202 3300005334 Bacteria 1038
6 Ga0070691_10092759 3300005341 Bacteria 1491
7 Ga0070691_10297281 3300005341 Bacteria 881
8 Ga0070668_100182963 3300005347 Bacteria 1713
9 Ga0070659_100047565 3300005366 Bacteria 3365
10 Ga0070659_100364145 3300005366 Bacteria 1215
11 Ga0070711_100014365 3300005439 Bacteria 4990
12 Ga0070705_100007321 3300005440 Bacteria 5431
13 Ga0070705_100151487 3300005440 Bacteria 1539
14 Ga0070700_100318887 3300005441 Bacteria 1141
15 Ga0070694_100029727 3300005444 Bacteria 3568
16 Ga0070694_100288634 3300005444 Bacteria 1253
17 Ga0070708_100001609 3300005445 Bacteria 17323
18 Ga0070708_100203581 3300005445 Bacteria 1853
19 Ga0070708_100616227 3300005445 Bacteria 1023
20 Ga0070662_100182981 3300005457 Bacteria 1653
21 Ga0070681_10010871 3300005458 Bacteria 8996
22 Ga0070681_10434567 3300005458 Bacteria 1225
23 Ga0070681_10556182 3300005458 Bacteria 1061
24 Ga0070706_100001152 3300005467 Bacteria 28450
25 Ga0070706_100089767 3300005467 Bacteria 2850
26 Ga0070707_100000281 3300005468 Bacteria 50088
27 Ga0070707_100447992 3300005468 Unclassified 1252
28 Ga0070707_100602526 3300005468 Unclassified 1061
29 Ga0070699_100001115 3300005518 Bacteria 25014
30 Ga0070699_100004735 3300005518 Bacteria 12027
31 Ga0070679_100485905 3300005530 Bacteria 1179
32 Ga0070697_100010131 3300005536 Bacteria 7354
33 Ga0070697_100205411 3300005536 Bacteria 1675
34 Ga0070697_100405833 3300005536 Bacteria 1183
35 Ga0068853_100456030 3300005539 Bacteria 1203
36 Ga0070695_100331683 3300005545 Bacteria 1134
37 Ga0070696_100000578 3300005546 Bacteria 23368
38 Ga0070696_100010046 3300005546 Bacteria 6333
39 Ga0070693_100068416 3300005547 Bacteria 2084
40 Ga0070704_100001630 3300005549 Bacteria 12162
41 Ga0070704_100081306 3300005549 Bacteria 2386
42 Ga0070664_100525485 3300005564 Bacteria 1092
43 Ga0068857_100262085 3300005577 Bacteria 1587
44 Ga0068854_100149674 3300005578 Unclassified 1799
45 Ga0068856_101039107 3300005614 Bacteria 837
46 Ga0070702_100053096 3300005615 Bacteria 2327
47 Ga0070702_100067868 3300005615 Bacteria 2097
48 Ga0068859_101530637 3300005617 Unclassified 736
49 Ga0068851_10339722 3300005834 Bacteria 871
50 Ga0081455_10006999 3300005937 Bacteria 11983
51 Ga0081538_10069787 3300005981 Bacteria 1944
52 Ga0070712_100110485 3300006175 Unclassified 2050
53 Ga0070712_100359243 3300006175 Bacteria 1194
54 Ga0075430_100079734 3300006846 Bacteria 2743
55 Ga0075430_100106415 3300006846 Bacteria 2340
56 Ga0075431_100007055 3300006847 Bacteria 11158
57 Ga0075433_10032059 3300006852 Bacteria 4498
58 Ga0075433_10054051 3300006852 Bacteria 3503
59 Ga0075434_100004228 3300006871 Bacteria 12870
60 Ga0075434_100073649 3300006871 Bacteria 3408
61 Ga0075434_100274509 3300006871 Bacteria 1705
62 Ga0075429_100025541 3300006880 Bacteria 5127
63 Ga0075436_100202707 3300006914 Bacteria 1405
64 Ga0097620_101530875 3300006931 Unclassified 736
65 Ga0111539_10604928 3300009094 Bacteria 1277
66 Ga0114129_10000646 3300009147 Bacteria 43522
67 Ga0114129_10088565 3300009147 Bacteria 4291
68 Ga0114129_10182128 3300009147 Bacteria 2858
69 Ga0114129_10261176 3300009147 Bacteria 2321
70 Ga0114129_10500889 3300009147 Bacteria 1586
71 Ga0114129_10659136 3300009147 Unclassified 1350
72 Ga0114129_10911255 3300009147 Bacteria 1113
73 Ga0105248_10388692 3300009177 Bacteria 1571
74 Ga0105237_10314858 3300009545 Unclassified 1568
75 Ga0105249_10130224 3300009553 Bacteria 2401
76 Ga0105239_10006189 3300010375 Bacteria 13926
77 Ga0105246_10212427 3300011119 Bacteria 1511
78 Ga0157374_11132989 3300013296 Bacteria 803
79 Ga0157378_11262625 3300013297 Bacteria 779
80 Ga0157380_10144826 3300014326 Unclassified 2046
81 Ga0182008_10238446 3300014497 Bacteria 935
82 Ga0207684_10004647 3300025910 Bacteria 12892
83 Ga0207684_10102711 3300025910 Bacteria 2445
84 Ga0207684_10814187 3300025910 Bacteria 789
85 Ga0207707_10045465 3300025912 Bacteria 3826
86 Ga0207707_10067195 3300025912 Bacteria 3123
87 Ga0207693_10049474 3300025915 Bacteria 3301
88 Ga0207649_10434908 3300025920 Bacteria 988
89 Ga0207652_10015029 3300025921 Bacteria 6278
90 Ga0207646_10004289 3300025922 Bacteria 15560
91 Ga0207646_10058526 3300025922 Bacteria 3442
92 Ga0207646_10165442 3300025922 Bacteria 1997
93 Ga0207650_10583059 3300025925 Bacteria 939
94 Ga0207687_10188976 3300025927 Bacteria 1601
95 Ga0207690_10242227 3300025932 Unclassified 1389
96 Ga0207690_10316819 3300025932 Bacteria 1225
97 Ga0207706_10075828 3300025933 Bacteria 2958
98 Ga0207706_10171343 3300025933 Bacteria 1907
99 Ga0207686_10509924 3300025934 Bacteria 935
100 Ga0207661_10467112 3300025944 Bacteria 1151
101 Ga0207679_10069495 3300025945 Bacteria 2650
102 Ga0207668_10417889 3300025972 Bacteria 1138
103 Ga0207708_10101086 3300026075 Archaea 2232
104 Ga0207708_10426999 3300026075 Bacteria 1100
105 Ga0207702_10910090 3300026078 Bacteria 872
106 Ga0207641_10039610 3300026088 Bacteria 3942
107 Ga0207648_10918918 3300026089 Unclassified 818
108 Ga0207676_10009558 3300026095 Bacteria 6904
109 Ga0207674_10379430 3300026116 Bacteria 1367
110 Ga0207683_10312316 3300026121 Bacteria 1439
111 Ga0209998_10047066 3300027717 Bacteria 991
112 Ga0209974_10025488 3300027876 Bacteria 1956
113 Ga0207428_10178916 3300027907 Bacteria 1603
114 Ga0307408_100024740 3300031548 Bacteria 4104
115 Ga0307408_100053512 3300031548 Bacteria 2915
116 Ga0307408_100073308 3300031548 Bacteria 2537
117 Ga0307405_10027768 3300031731 Bacteria 3287
118 Ga0307405_10031244 3300031731 Bacteria 3133
119 Ga0307405_10329018 3300031731 Unclassified 1170
120 Ga0307405_10371431 3300031731 Unclassified 1110
121 Ga0307413_10004487 3300031824 Bacteria 6080
122 Ga0307413_10009291 3300031824 Bacteria 4698
123 Ga0307413_10021899 3300031824 Bacteria 3432
124 Ga0307413_10026638 3300031824 Bacteria 3189
125 Ga0307413_10049720 3300031824 Bacteria 2514
126 Ga0307413_10063616 3300031824 Bacteria 2288
127 Ga0307413_10078320 3300031824 Unclassified 2108
128 Ga0307413_10351189 3300031824 Unclassified 1138
129 Ga0307410_10001421 3300031852 Bacteria 10773
130 Ga0307410_10013290 3300031852 Bacteria 4798
131 Ga0307410_10021912 3300031852 Bacteria 3939
132 Ga0307410_10027668 3300031852 Bacteria 3586
133 Ga0307410_10073192 3300031852 Bacteria 2382
134 Ga0307410_10096840 3300031852 Bacteria 2107
135 Ga0307410_10451225 3300031852 Unclassified 1049
136 Ga0307410_10595929 3300031852 Unclassified 921
137 Ga0307406_10025209 3300031901 Bacteria 3559
138 Ga0307406_10062737 3300031901 Unclassified 2405
139 Ga0307406_10152387 3300031901 Unclassified 1651
140 Ga0307406_10258917 3300031901 Bacteria 1315
141 Ga0307406_10453358 3300031901 Bacteria 1029
142 Ga0307407_10015225 3300031903 Bacteria 3793
143 Ga0307407_10024538 3300031903 Bacteria 3164
144 Ga0307412_10072644 3300031911 Bacteria 2352
145 Ga0307412_10074629 3300031911 Bacteria 2324
146 Ga0307409_100004650 3300031995 Bacteria 7756
147 Ga0307409_100058064 3300031995 Bacteria 3002
148 Ga0307409_100119825 3300031995 Bacteria 2226
149 Ga0307409_100171514 3300031995 Bacteria 1910
150 Ga0307409_100173367 3300031995 Bacteria 1901
151 Ga0307409_100220517 3300031995 Bacteria 1712
152 Ga0307409_100255206 3300031995 Bacteria 1605
153 Ga0307409_100262341 3300031995 Unclassified 1586
154 Ga0307416_100004439 3300032002 Bacteria 8456
155 Ga0307416_100005912 3300032002 Bacteria 7596
156 Ga0307416_100007825 3300032002 Bacteria 6832
157 Ga0307416_100015759 3300032002 Bacteria 5230
158 Ga0307416_100025794 3300032002 Bacteria 4317
159 Ga0307416_100044638 3300032002 Bacteria 3482
160 Ga0307416_100126257 3300032002 Bacteria 2292
161 Ga0307416_100466808 3300032002 Unclassified 1319
162 Ga0307416_100498792 3300032002 Unclassified 1281
163 Ga0307414_10022549 3300032004 Bacteria 3975
164 Ga0307414_10023515 3300032004 Bacteria 3910
165 Ga0307414_10035807 3300032004 Bacteria 3307
166 Ga0307414_10065054 3300032004 Unclassified 2600
167 Ga0307414_10157653 3300032004 Bacteria 1799
168 Ga0307414_10464365 3300032004 Unclassified 1113
169 Ga0307414_10688334 3300032004 Unclassified 925
170 Ga0307411_10005651 3300032005 Bacteria 6170
171 Ga0307411_10043368 3300032005 Bacteria 2877
172 Ga0307411_10079978 3300032005 Bacteria 2246
173 Ga0307415_100003520 3300032126 Bacteria 7986
174 Ga0307415_100005227 3300032126 Bacteria 6865
175 Ga0307415_100051029 3300032126 Bacteria 2805
176 Ga0307415_100079757 3300032126 Unclassified 2333
177 Ga0373938_0058724 3300034957 Unclassified 895
178 Ga0373929_0017851 3300035085 Bacteria 1405
179 Ga0373940_0006120 3300035088 Bacteria 2648
180 Ga0373940_0047316 3300035088 Bacteria 1199
181 Ga0373951_0026459 3300035091 Bacteria 1352
182 Ga0373932_0024694 3300035112 Bacteria 1620
183 Ga0373939_0086656 3300035114 Bacteria 1051
184 Ga0373960_0007828 3300035121 Bacteria 2542
185 Ga0373931_0129694 3300035691 Bacteria 1450
186 Ga0373925_0448196 3300037068 Unclassified 1057
187 Ga0395905_0081445 3300037471 Bacteria 3034
188 Ga0395905_0106490 3300037471 Bacteria 2633
189 Ga0395905_0369628 3300037471 Bacteria 1327
190 Ga0242420_023214 3300038996 Bacteria 1119
191 Ga0439455_0042794 3300042012 Bacteria 1164
192 Ga0439446_0082477 3300042156 Bacteria 997
193 Ga0439458_0015938 3300042157 Unclassified 1707
194 Ga0439435_0009195 3300042436 Bacteria 2313
195 Ga0439435_0103138 3300042436 Bacteria 879
196 Ga0453683_0024707 3300044673 Bacteria 3821
197 Ga0453683_0038089 3300044673 Bacteria 3024
198 Ga0466964_0036697 3300044706 Bacteria 1967
199 Ga0453684_0644022 3300044712 Bacteria 1157
200 Ga0466967_0827960 3300045976 Bacteria 919
201 Ga0495580_0044407 3300046472 Bacteria 3161
202 Ga0496100_0053068 3300048903 Bacteria 2639
203 Ga0496100_0216112 3300048903 Bacteria 1405
204 Ga0496101_0051495 3300048904 Bacteria 2967
205 Ga0496101_0154297 3300048904 Bacteria 1758
206 Ga0496102_0003209 3300048905 Bacteria 13871
207 Ga0496102_0183896 3300048905 Bacteria 1969
208 Ga0496102_0199806 3300048905 Bacteria 1884
209 Ga0496102_0389975 3300048905 Bacteria 1310
210 Ga0496102_0936044 3300048905 Bacteria 788
211 Ga0496103_0054506 3300048906 Bacteria 2478
212 Ga0496104_0017692 3300048907 Bacteria 6497
213 Ga0496104_0040471 3300048907 Bacteria 4368
214 Ga0496104_0151464 3300048907 Unclassified 2226
215 Ga0496104_0184571 3300048907 Bacteria 1996
216 Ga0496105_0062259 3300048908 Bacteria 3079
217 Ga0496106_0045699 3300048909 Bacteria 3290
218 Ga0496106_0116920 3300048909 Bacteria 2080
219 Ga0496107_0192362 3300048910 Bacteria 1516
220 Ga0496107_0413033 3300048910 Bacteria 1004
221 Ga0496107_0469292 3300048910 Unclassified 934
222 Ga0496107_0531512 3300048910 Bacteria 872
223 Ga0496107_0580375 3300048910 Unclassified 829
224 Ga0496108_0008066 3300048911 Bacteria 8544
225 Ga0496108_0038935 3300048911 Bacteria 3962
226 Ga0496108_0050523 3300048911 Bacteria 3480
227 Ga0496108_0125399 3300048911 Bacteria 2204
228 Ga0496108_0234084 3300048911 Bacteria 1597
229 Ga0496109_0003801 3300048912 Bacteria 12599
230 Ga0496109_0011717 3300048912 Bacteria 7543
231 Ga0496109_0015661 3300048912 Bacteria 6614
232 Ga0496109_0022447 3300048912 Bacteria 5589
233 Ga0496110_0003328 3300048913 Bacteria 12280
234 Ga0496110_0022202 3300048913 Bacteria 5386
235 Ga0496110_0053106 3300048913 Bacteria 3562
236 Ga0496110_0061037 3300048913 Bacteria 3326
237 Ga0496111_0010557 3300048914 Bacteria 6203
238 Ga0496111_0012699 3300048914 Bacteria 5710
239 Ga0496111_0057181 3300048914 Bacteria 2824
240 Ga0496111_0096516 3300048914 Bacteria 2169
241 Ga0496112_0018597 3300048915 Bacteria 6546
242 Ga0496112_0070512 3300048915 Bacteria 3454
243 Ga0496112_0129742 3300048915 Bacteria 2492
244 Ga0496112_0568971 3300048915 Bacteria 1066
245 Ga0496113_0005261 3300048916 Bacteria 8058
246 Ga0496113_0094112 3300048916 Bacteria 2314
247 Ga0496114_0060620 3300048917 Bacteria 3163
248 Ga0496114_0194927 3300048917 Bacteria 1773
249 Ga0496114_0204166 3300048917 Unclassified 1732
250 Ga0496115_0139066 3300048918 Bacteria 2003
251 Ga0496115_0720132 3300048918 Unclassified 783
252 Ga0501295_013026 3300049518 Bacteria 1371
253 Ga0501031_0118367 3300049568 Bacteria 1731
254 Ga0501033_0159004 3300049570 Bacteria 1627
255 Ga0501036_0172519 3300049572 Bacteria 1822
256 Ga0501036_0393474 3300049572 Bacteria 1156
257 Ga0501037_0279392 3300049573 Bacteria 1164
258 Ga0501038_0010210 3300049574 Bacteria 8593
259 Ga0501039_0167502 3300049575 Bacteria 1727
260 Ga0501039_0181169 3300049575 Bacteria 1657
261 Ga0501040_0080875 3300049576 Bacteria 2251
262 Ga0501040_0082340 3300049576 Bacteria 2231
263 Ga0501040_0144699 3300049576 Bacteria 1675
264 Ga0501041_0082844 3300049577 Bacteria 1977
265 Ga0501042_0047259 3300049578 Bacteria 3069
266 Ga0501042_0141375 3300049578 Bacteria 1736
267 Ga0501042_0322334 3300049578 Bacteria 1116
268 Ga0501046_0086411 3300049580 Bacteria 2418
269 Ga0501046_0117114 3300049580 Bacteria 2030
270 Ga0501046_0243880 3300049580 Bacteria 1324
271 Ga0501048_0163502 3300049582 Bacteria 1576
272 Ga0501048_0240238 3300049582 Bacteria 1285
273 Ga0501067_0024025 3300049583 Bacteria 3380
274 Ga0501067_0139400 3300049583 Unclassified 1350
275 Ga0501067_0392074 3300049583 Unclassified 774
276 Ga0501068_0058727 3300049584 Bacteria 2335
277 Ga0501068_0090624 3300049584 Bacteria 1886
278 Ga0501068_0213767 3300049584 Bacteria 1225
279 Ga0501069_0055094 3300049585 Unclassified 2215
280 Ga0501069_0098955 3300049585 Unclassified 1655
281 Ga0501069_0134101 3300049585 Bacteria 1419
282 Ga0501069_0173375 3300049585 Bacteria 1245
283 Ga0501072_0041067 3300049588 Bacteria 3633
284 Ga0501072_0151452 3300049588 Bacteria 1849
285 Ga0501072_0163593 3300049588 Bacteria 1775
286 Ga0501072_0208121 3300049588 Unclassified 1559
287 Ga0501074_0085609 3300049590 Bacteria 2259
288 Ga0501074_0295787 3300049590 Bacteria 1150
289 Ga0501075_0018035 3300049591 Bacteria 5102
290 Ga0501075_0067949 3300049591 Bacteria 2692
291 Ga0501076_0099624 3300049592 Bacteria 2341
292 Ga0501076_0154903 3300049592 Bacteria 1865
293 Ga0501077_0017742 3300049593 Bacteria 4496
294 Ga0501077_0071365 3300049593 Bacteria 2201
295 Ga0501209_116635 3300049656 Bacteria 790
296 Ga0501217_014123 3300049661 Bacteria 1800
297 Ga0501233_009060 3300049668 Bacteria 1935
298 Ga0501235_005721 3300049669 Bacteria 2704
299 Ga0501235_065438 3300049669 Unclassified 855
300 Ga0501247_013385 3300049677 Bacteria 1008
301 Ga0501249_015551 3300049679 Bacteria 1628
302 Ga0501257_050648 3300049686 Unclassified 1035
303 Ga0501229_003032 3300049706 Bacteria 1997
304 Ga0501079_0027259 3300049741 Bacteria 4380
305 Ga0501079_0069955 3300049741 Bacteria 2709
306 Ga0501079_0086663 3300049741 Bacteria 2424
307 Ga0501079_0150983 3300049741 Unclassified 1811
308 Ga0501080_0061473 3300049742 Bacteria 3497
309 Ga0501080_0171688 3300049742 Unclassified 2000
310 Ga0501081_0022691 3300049743 Bacteria 4201
311 Ga0501081_0044993 3300049743 Bacteria 3031
312 Ga0501081_0241337 3300049743 Bacteria 1318
313 Ga0501083_0173985 3300049744 Bacteria 1407
314 Ga0501267_014243 3300049764 Bacteria 833
315 Ga0501271_010429 3300049768 Unclassified 981
316 Ga0501272_005144 3300049769 Bacteria 1371
317 Ga0501045_0058490 3300049824 Bacteria 2823
318 Ga0501045_0085226 3300049824 Bacteria 2331
319 Ga0501045_0234094 3300049824 Bacteria 1367
320 Ga0501045_0636151 3300049824 Bacteria 789
321 nmdc:mga05p37_122333_c1 3300050507 Bacteria 3196
322 nmdc:mga05p37_12680_c1 3300050507 Bacteria 10070
323 nmdc:mga09592_19677_c1 3300050508 Bacteria 5544
324 nmdc:mga0qj67_142820_c1 3300050509 Unclassified 1941
325 nmdc:mga06r32_10243_c1 3300050510 Bacteria 8458
326 nmdc:mga08y16_46040_c1 3300050511 Bacteria 4568
327 nmdc:mga0n895_185974_c1 3300050512 Bacteria 2108
328 nmdc:mga0n895_45349_c1 3300050512 Bacteria 4290
329 nmdc:mga0n895_58213_c1 3300050512 Bacteria 3809
330 nmdc:mga0n895_60197_c1 3300050512 Bacteria 3747
331 nmdc:mga0n895_851963_c1 3300050512 Bacteria 899
332 nmdc:mga0rr50_153695_c1 3300050513 Bacteria 1862
333 nmdc:mga0rr50_229646_c1 3300050513 Bacteria 1535
334 nmdc:mga08x19_126870_c1 3300050514 Bacteria 1714
335 nmdc:mga08x19_172777_c1 3300050514 Bacteria 1472
336 nmdc:mga0a205_18174_c2 3300050515 Bacteria 5687
337 nmdc:mga0a205_245048_c1 3300050515 Unclassified 1673
338 nmdc:mga0a205_62792_c1 3300050515 Bacteria 3589
339 Ga0501084_0028070 3300054114 Bacteria 4703
340 Ga0501084_0124727 3300054114 Bacteria 2167
341 Ga0501084_0366389 3300054114 Bacteria 1217
342 Ga0590071_000666 3300059421 Bacteria 9718
343 Ga0590075_011415 3300059424 Bacteria 2147
344 Ga0501082_0083464 3300060353 Bacteria 2756
345 Ga0501082_0175686 3300060353 Bacteria 1862
346 Ga0530510_0106871 3300061734 Bacteria 2048
347 Ga0530510_0147487 3300061734 Bacteria 1736
348 Ga0530510_0171310 3300061734 Bacteria 1608
349 Ga0530510_0274167 3300061734 Unclassified 1259
350 Ga0530510_0393343 3300061734 Bacteria 1044

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10164352 rootL2_101643522 205
2 3300050512 nmdc:mga0n895_851963_c1 nmdc:mga0n895_851963_c1_17_700 206
3 3300049583 Ga0501067_0392074 Ga0501067_0392074_26_661 209
4 3300044673 Ga0453683_0024707 Ga0453683_0024707_2750_3424 210
5 3300049741 Ga0501079_0069955 Ga0501079_0069955_14_649 211
6 3300031901 Ga0307406_10062737 Ga0307406_100627373 212
7 3300032002 Ga0307416_100498792 Ga0307416_1004987922 212
8 3300005458 Ga0070681_10556182 Ga0070681_105561821 216
9 3300005834 Ga0068851_10339722 Ga0068851_103397221 216
10 3300005366 Ga0070659_100364145 Ga0070659_1003641452 217
11 3300005440 Ga0070705_100151487 Ga0070705_1001514873 217
12 3300005441 Ga0070700_100318887 Ga0070700_1003188872 217
13 3300005444 Ga0070694_100029727 Ga0070694_1000297273 217
14 3300005444 Ga0070694_100288634 Ga0070694_1002886342 217
15 3300005445 Ga0070708_100001609 Ga0070708_1000016097 217
16 3300005445 Ga0070708_100203581 Ga0070708_1002035812 217
17 3300005457 Ga0070662_100182981 Ga0070662_1001829812 217
18 3300005467 Ga0070706_100001152 Ga0070706_10000115223 217
19 3300005468 Ga0070707_100000281 Ga0070707_10000028129 217
20 3300005518 Ga0070699_100001115 Ga0070699_10000111525 217
21 3300005536 Ga0070697_100205411 Ga0070697_1002054112 217
22 3300005545 Ga0070695_100331683 Ga0070695_1003316832 217
23 3300005546 Ga0070696_100010046 Ga0070696_1000100463 217
24 3300005549 Ga0070704_100001630 Ga0070704_1000016306 217
25 3300005614 Ga0068856_101039107 Ga0068856_1010391071 217
26 3300005615 Ga0070702_100053096 Ga0070702_1000530962 217
27 3300005617 Ga0068859_101530637 Ga0068859_1015306371 217
28 3300006852 Ga0075433_10032059 Ga0075433_100320592 217
29 3300006871 Ga0075434_100004228 Ga0075434_10000422812 217
30 3300006871 Ga0075434_100073649 Ga0075434_1000736494 217
31 3300006880 Ga0075429_100025541 Ga0075429_1000255414 217
32 3300006931 Ga0097620_101530875 Ga0097620_1015308751 217
33 3300009147 Ga0114129_10000646 Ga0114129_1000064613 217
34 3300009177 Ga0105248_10388692 Ga0105248_103886922 217
35 3300009545 Ga0105237_10314858 Ga0105237_103148581 217
36 3300009553 Ga0105249_10130224 Ga0105249_101302242 217
37 3300010375 Ga0105239_10006189 Ga0105239_1000618914 217
38 3300013296 Ga0157374_11132989 Ga0157374_111329891 217
39 3300025910 Ga0207684_10004647 Ga0207684_1000464715 217
40 3300025922 Ga0207646_10004289 Ga0207646_1000428913 217
41 3300025932 Ga0207690_10316819 Ga0207690_103168192 217
42 3300025933 Ga0207706_10075828 Ga0207706_100758284 217
43 3300025934 Ga0207686_10509924 Ga0207686_105099241 217
44 3300026075 Ga0207708_10426999 Ga0207708_104269992 217
45 3300026078 Ga0207702_10910090 Ga0207702_109100901 217
46 3300042012 Ga0439455_0042794 Ga0439455_0042794_324_977 217
47 3300044673 Ga0453683_0038089 Ga0453683_0038089_1691_2365 217
48 3300046472 Ga0495580_0044407 Ga0495580_0044407_1716_2390 217
49 3300048903 Ga0496100_0216112 Ga0496100_0216112_707_1387 217
50 3300048905 Ga0496102_0003209 Ga0496102_0003209_1434_2114 217
51 3300048906 Ga0496103_0054506 Ga0496103_0054506_1387_2067 217
52 3300048907 Ga0496104_0017692 Ga0496104_0017692_992_1672 217
53 3300048909 Ga0496106_0116920 Ga0496106_0116920_1001_1681 217
54 3300048911 Ga0496108_0234084 Ga0496108_0234084_41_721 217
55 3300048912 Ga0496109_0003801 Ga0496109_0003801_11467_12147 217
56 3300048913 Ga0496110_0022202 Ga0496110_0022202_2131_2811 217
57 3300048914 Ga0496111_0012699 Ga0496111_0012699_2772_3452 217
58 3300048915 Ga0496112_0129742 Ga0496112_0129742_929_1609 217
59 3300048916 Ga0496113_0094112 Ga0496113_0094112_442_1122 217
60 3300050507 nmdc:mga05p37_12680_c1 nmdc:mga05p37_12680_c1_7582_8235 217
61 3300050508 nmdc:mga09592_19677_c1 nmdc:mga09592_19677_c1_3285_3938 217
62 3300050512 nmdc:mga0n895_58213_c1 nmdc:mga0n895_58213_c1_735_1388 217
63 3300050512 nmdc:mga0n895_60197_c1 nmdc:mga0n895_60197_c1_1354_2034 217
64 3300050513 nmdc:mga0rr50_153695_c1 nmdc:mga0rr50_153695_c1_727_1380 217
65 3300050513 nmdc:mga0rr50_229646_c1 nmdc:mga0rr50_229646_c1_365_1045 217
66 3300050514 nmdc:mga08x19_172777_c1 nmdc:mga08x19_172777_c1_533_1186 217
67 3300050515 nmdc:mga0a205_18174_c2 nmdc:mga0a205_18174_c2_3609_4283 217
68 3300005334 Ga0068869_100477202 Ga0068869_1004772022 218
69 3300005341 Ga0070691_10092759 Ga0070691_100927592 218
70 3300005347 Ga0070668_100182963 Ga0070668_1001829632 218
71 3300005458 Ga0070681_10434567 Ga0070681_104345672 218
72 3300005539 Ga0068853_100456030 Ga0068853_1004560302 218
73 3300005578 Ga0068854_100149674 Ga0068854_1001496742 218
74 3300005615 Ga0070702_100067868 Ga0070702_1000678683 218
75 3300013297 Ga0157378_11262625 Ga0157378_112626251 218
76 3300014326 Ga0157380_10144826 Ga0157380_101448262 218
77 3300025912 Ga0207707_10067195 Ga0207707_100671953 218
78 3300025927 Ga0207687_10188976 Ga0207687_101889764 218
79 3300025932 Ga0207690_10242227 Ga0207690_102422272 218
80 3300025933 Ga0207706_10171343 Ga0207706_101713433 218
81 3300025972 Ga0207668_10417889 Ga0207668_104178892 218
82 3300026075 Ga0207708_10101086 Ga0207708_101010862 218
83 3300026121 Ga0207683_10312316 Ga0207683_103123162 218
84 3300027907 Ga0207428_10178916 Ga0207428_101789162 218
85 3300031548 Ga0307408_100053512 Ga0307408_1000535125 218
86 3300031548 Ga0307408_100073308 Ga0307408_1000733083 218
87 3300031731 Ga0307405_10027768 Ga0307405_100277685 218
88 3300031824 Ga0307413_10026638 Ga0307413_100266383 218
89 3300031824 Ga0307413_10078320 Ga0307413_100783203 218
90 3300031852 Ga0307410_10001421 Ga0307410_1000142110 218
91 3300031852 Ga0307410_10451225 Ga0307410_104512251 218
92 3300031852 Ga0307410_10595929 Ga0307410_105959291 218
93 3300031901 Ga0307406_10025209 Ga0307406_100252093 218
94 3300031903 Ga0307407_10024538 Ga0307407_100245384 218
95 3300031911 Ga0307412_10074629 Ga0307412_100746293 218
96 3300031995 Ga0307409_100119825 Ga0307409_1001198253 218
97 3300031995 Ga0307409_100255206 Ga0307409_1002552062 218
98 3300032002 Ga0307416_100007825 Ga0307416_1000078255 218
99 3300032004 Ga0307414_10065054 Ga0307414_100650543 218
100 3300032004 Ga0307414_10157653 Ga0307414_101576532 218
101 3300032126 Ga0307415_100005227 Ga0307415_1000052279 218
102 3300032126 Ga0307415_100079757 Ga0307415_1000797572 218
103 3300048905 Ga0496102_0183896 Ga0496102_0183896_1031_1708 218
104 3300005981 Ga0081538_10069787 Ga0081538_100697872 219
105 3300006846 Ga0075430_100079734 Ga0075430_1000797343 219
106 3300006846 Ga0075430_100106415 Ga0075430_1001064153 219
107 3300006847 Ga0075431_100007055 Ga0075431_10000705511 219
108 3300009147 Ga0114129_10088565 Ga0114129_100885657 219
109 3300009147 Ga0114129_10182128 Ga0114129_101821282 219
110 3300009147 Ga0114129_10500889 Ga0114129_105008893 219
111 3300009147 Ga0114129_10659136 Ga0114129_106591363 219
112 3300014497 Ga0182008_10238446 Ga0182008_102384461 219
113 3300025925 Ga0207650_10583059 Ga0207650_105830592 219
114 3300026089 Ga0207648_10918918 Ga0207648_109189182 219
115 3300031548 Ga0307408_100024740 Ga0307408_1000247402 219
116 3300031731 Ga0307405_10329018 Ga0307405_103290181 219
117 3300031731 Ga0307405_10371431 Ga0307405_103714312 219
118 3300031824 Ga0307413_10004487 Ga0307413_100044879 219
119 3300031824 Ga0307413_10009291 Ga0307413_100092917 219
120 3300031824 Ga0307413_10021899 Ga0307413_100218993 219
121 3300031824 Ga0307413_10063616 Ga0307413_100636163 219
122 3300031852 Ga0307410_10013290 Ga0307410_100132903 219
123 3300031852 Ga0307410_10021912 Ga0307410_100219122 219
124 3300031852 Ga0307410_10027668 Ga0307410_100276686 219
125 3300031852 Ga0307410_10096840 Ga0307410_100968403 219
126 3300031903 Ga0307407_10015225 Ga0307407_100152254 219
127 3300031911 Ga0307412_10072644 Ga0307412_100726443 219
128 3300031995 Ga0307409_100004650 Ga0307409_1000046504 219
129 3300031995 Ga0307409_100058064 Ga0307409_1000580646 219
130 3300031995 Ga0307409_100220517 Ga0307409_1002205173 219
131 3300031995 Ga0307409_100262341 Ga0307409_1002623412 219
132 3300032002 Ga0307416_100004439 Ga0307416_1000044392 219
133 3300032002 Ga0307416_100005912 Ga0307416_1000059127 219
134 3300032002 Ga0307416_100015759 Ga0307416_1000157596 219
135 3300032002 Ga0307416_100025794 Ga0307416_1000257944 219
136 3300032002 Ga0307416_100466808 Ga0307416_1004668082 219
137 3300032004 Ga0307414_10022549 Ga0307414_100225493 219
138 3300032004 Ga0307414_10023515 Ga0307414_100235153 219
139 3300032004 Ga0307414_10035807 Ga0307414_100358071 219
140 3300032004 Ga0307414_10464365 Ga0307414_104643652 219
141 3300032004 Ga0307414_10688334 Ga0307414_106883342 219
142 3300032005 Ga0307411_10005651 Ga0307411_100056516 219
143 3300032005 Ga0307411_10043368 Ga0307411_100433686 219
144 3300032126 Ga0307415_100003520 Ga0307415_1000035205 219
145 3300032126 Ga0307415_100051029 Ga0307415_1000510293 219
146 3300042156 Ga0439446_0082477 Ga0439446_0082477_151_810 219
147 3300042436 Ga0439435_0009195 Ga0439435_0009195_227_904 219
148 3300042436 Ga0439435_0103138 Ga0439435_0103138_102_779 219
149 3300048904 Ga0496101_0051495 Ga0496101_0051495_611_1294 219
150 3300048907 Ga0496104_0151464 Ga0496104_0151464_203_886 219
151 3300048909 Ga0496106_0045699 Ga0496106_0045699_2012_2695 219
152 3300048910 Ga0496107_0192362 Ga0496107_0192362_727_1407 219
153 3300048910 Ga0496107_0469292 Ga0496107_0469292_175_858 219
154 3300048911 Ga0496108_0008066 Ga0496108_0008066_4036_4719 219
155 3300048912 Ga0496109_0015661 Ga0496109_0015661_4026_4709 219
156 3300048913 Ga0496110_0003328 Ga0496110_0003328_561_1244 219
157 3300048914 Ga0496111_0010557 Ga0496111_0010557_3901_4584 219
158 3300048915 Ga0496112_0568971 Ga0496112_0568971_104_784 219
159 3300048917 Ga0496114_0204166 Ga0496114_0204166_205_888 219
160 3300048918 Ga0496115_0720132 Ga0496115_0720132_21_704 219
161 3300049518 Ga0501295_013026 Ga0501295_013026_238_921 219
162 3300049568 Ga0501031_0118367 Ga0501031_0118367_567_1244 219
163 3300049570 Ga0501033_0159004 Ga0501033_0159004_552_1211 219
164 3300049572 Ga0501036_0172519 Ga0501036_0172519_840_1499 219
165 3300049572 Ga0501036_0393474 Ga0501036_0393474_394_1053 219
166 3300049573 Ga0501037_0279392 Ga0501037_0279392_34_693 219
167 3300049574 Ga0501038_0010210 Ga0501038_0010210_1833_2510 219
168 3300049575 Ga0501039_0167502 Ga0501039_0167502_258_917 219
169 3300049575 Ga0501039_0181169 Ga0501039_0181169_789_1448 219
170 3300049576 Ga0501040_0080875 Ga0501040_0080875_576_1253 219
171 3300049576 Ga0501040_0082340 Ga0501040_0082340_381_1040 219
172 3300049576 Ga0501040_0144699 Ga0501040_0144699_11_688 219
173 3300049577 Ga0501041_0082844 Ga0501041_0082844_391_1050 219
174 3300049578 Ga0501042_0047259 Ga0501042_0047259_688_1347 219
175 3300049578 Ga0501042_0141375 Ga0501042_0141375_269_949 219
176 3300049578 Ga0501042_0322334 Ga0501042_0322334_124_801 219
177 3300049580 Ga0501046_0086411 Ga0501046_0086411_1353_2012 219
178 3300049580 Ga0501046_0117114 Ga0501046_0117114_138_815 219
179 3300049580 Ga0501046_0243880 Ga0501046_0243880_67_726 219
180 3300049582 Ga0501048_0163502 Ga0501048_0163502_420_1079 219
181 3300049582 Ga0501048_0240238 Ga0501048_0240238_463_1140 219
182 3300049584 Ga0501068_0090624 Ga0501068_0090624_579_1238 219
183 3300049584 Ga0501068_0213767 Ga0501068_0213767_142_801 219
184 3300049585 Ga0501069_0173375 Ga0501069_0173375_530_1195 219
185 3300049588 Ga0501072_0041067 Ga0501072_0041067_2585_3265 219
186 3300049588 Ga0501072_0151452 Ga0501072_0151452_732_1391 219
187 3300049588 Ga0501072_0163593 Ga0501072_0163593_709_1386 219
188 3300049588 Ga0501072_0208121 Ga0501072_0208121_528_1187 219
189 3300049590 Ga0501074_0085609 Ga0501074_0085609_597_1256 219
190 3300049590 Ga0501074_0295787 Ga0501074_0295787_201_881 219
191 3300049591 Ga0501075_0018035 Ga0501075_0018035_1098_1757 219
192 3300049592 Ga0501076_0099624 Ga0501076_0099624_884_1543 219
193 3300049592 Ga0501076_0154903 Ga0501076_0154903_440_1120 219
194 3300049593 Ga0501077_0017742 Ga0501077_0017742_1786_2466 219
195 3300049593 Ga0501077_0071365 Ga0501077_0071365_855_1514 219
196 3300049656 Ga0501209_116635 Ga0501209_116635_73_756 219
197 3300049661 Ga0501217_014123 Ga0501217_014123_599_1282 219
198 3300049668 Ga0501233_009060 Ga0501233_009060_595_1278 219
199 3300049669 Ga0501235_005721 Ga0501235_005721_1029_1712 219
200 3300049669 Ga0501235_065438 Ga0501235_065438_52_735 219
201 3300049677 Ga0501247_013385 Ga0501247_013385_121_804 219
202 3300049679 Ga0501249_015551 Ga0501249_015551_861_1544 219
203 3300049686 Ga0501257_050648 Ga0501257_050648_295_978 219
204 3300049706 Ga0501229_003032 Ga0501229_003032_295_978 219
205 3300049741 Ga0501079_0086663 Ga0501079_0086663_1161_1820 219
206 3300049741 Ga0501079_0150983 Ga0501079_0150983_1051_1728 219
207 3300049742 Ga0501080_0061473 Ga0501080_0061473_2360_3019 219
208 3300049742 Ga0501080_0171688 Ga0501080_0171688_1214_1894 219
209 3300049743 Ga0501081_0022691 Ga0501081_0022691_2682_3362 219
210 3300049743 Ga0501081_0241337 Ga0501081_0241337_59_718 219
211 3300049744 Ga0501083_0173985 Ga0501083_0173985_245_904 219
212 3300049764 Ga0501267_014243 Ga0501267_014243_62_745 219
213 3300049768 Ga0501271_010429 Ga0501271_010429_95_778 219
214 3300049769 Ga0501272_005144 Ga0501272_005144_490_1173 219
215 3300049824 Ga0501045_0058490 Ga0501045_0058490_250_930 219
216 3300049824 Ga0501045_0085226 Ga0501045_0085226_879_1538 219
217 3300049824 Ga0501045_0234094 Ga0501045_0234094_392_1069 219
218 3300049824 Ga0501045_0636151 Ga0501045_0636151_55_735 219
219 3300050507 nmdc:mga05p37_122333_c1 nmdc:mga05p37_122333_c1_1831_2490 219
220 3300050509 nmdc:mga0qj67_142820_c1 nmdc:mga0qj67_142820_c1_136_816 219
221 3300050510 nmdc:mga06r32_10243_c1 nmdc:mga06r32_10243_c1_4941_5621 219
222 3300054114 Ga0501084_0028070 Ga0501084_0028070_193_852 219
223 3300054114 Ga0501084_0366389 Ga0501084_0366389_156_815 219
224 3300059421 Ga0590071_000666 Ga0590071_000666_5332_6009 219
225 3300059424 Ga0590075_011415 Ga0590075_011415_1424_2101 219
226 3300060353 Ga0501082_0083464 Ga0501082_0083464_417_1097 219
227 3300060353 Ga0501082_0175686 Ga0501082_0175686_688_1347 219
228 3300061734 Ga0530510_0106871 Ga0530510_0106871_569_1228 219
229 3300061734 Ga0530510_0147487 Ga0530510_0147487_216_875 219
230 3300061734 Ga0530510_0274167 Ga0530510_0274167_570_1247 219
231 2162886012 MBSR1b_contig_8174435 MBSR1b_0061.00003660 220
232 3300003322 rootL2_10084260 rootL2_100842602 220
233 3300005293 Ga0065715_10322030 Ga0065715_103220302 220
234 3300005341 Ga0070691_10297281 Ga0070691_102972811 220
235 3300005366 Ga0070659_100047565 Ga0070659_1000475657 220
236 3300005439 Ga0070711_100014365 Ga0070711_1000143653 220
237 3300005440 Ga0070705_100007321 Ga0070705_1000073213 220
238 3300005445 Ga0070708_100616227 Ga0070708_1006162271 220
239 3300005458 Ga0070681_10010871 Ga0070681_100108719 220
240 3300005467 Ga0070706_100089767 Ga0070706_1000897673 220
241 3300005468 Ga0070707_100447992 Ga0070707_1004479922 220
242 3300005468 Ga0070707_100602526 Ga0070707_1006025261 220
243 3300005518 Ga0070699_100004735 Ga0070699_1000047359 220
244 3300005530 Ga0070679_100485905 Ga0070679_1004859052 220
245 3300005536 Ga0070697_100010131 Ga0070697_1000101314 220
246 3300005536 Ga0070697_100405833 Ga0070697_1004058332 220
247 3300005546 Ga0070696_100000578 Ga0070696_10000057821 220
248 3300005547 Ga0070693_100068416 Ga0070693_1000684162 220
249 3300005549 Ga0070704_100081306 Ga0070704_1000813063 220
250 3300005564 Ga0070664_100525485 Ga0070664_1005254851 220
251 3300005577 Ga0068857_100262085 Ga0068857_1002620852 220
252 3300005937 Ga0081455_10006999 Ga0081455_1000699914 220
253 3300006175 Ga0070712_100110485 Ga0070712_1001104854 220
254 3300006175 Ga0070712_100359243 Ga0070712_1003592432 220
255 3300006852 Ga0075433_10054051 Ga0075433_100540512 220
256 3300006871 Ga0075434_100274509 Ga0075434_1002745093 220
257 3300006914 Ga0075436_100202707 Ga0075436_1002027072 220
258 3300009094 Ga0111539_10604928 Ga0111539_106049282 220
259 3300009147 Ga0114129_10261176 Ga0114129_102611762 220
260 3300009147 Ga0114129_10911255 Ga0114129_109112552 220
261 3300011119 Ga0105246_10212427 Ga0105246_102124272 220
262 3300025910 Ga0207684_10102711 Ga0207684_101027112 220
263 3300025910 Ga0207684_10814187 Ga0207684_108141871 220
264 3300025912 Ga0207707_10045465 Ga0207707_100454653 220
265 3300025915 Ga0207693_10049474 Ga0207693_100494744 220
266 3300025920 Ga0207649_10434908 Ga0207649_104349082 220
267 3300025921 Ga0207652_10015029 Ga0207652_100150293 220
268 3300025922 Ga0207646_10058526 Ga0207646_100585266 220
269 3300025922 Ga0207646_10165442 Ga0207646_101654422 220
270 3300025944 Ga0207661_10467112 Ga0207661_104671122 220
271 3300025945 Ga0207679_10069495 Ga0207679_100694952 220
272 3300026088 Ga0207641_10039610 Ga0207641_100396103 220
273 3300026095 Ga0207676_10009558 Ga0207676_100095583 220
274 3300026116 Ga0207674_10379430 Ga0207674_103794302 220
275 3300027717 Ga0209998_10047066 Ga0209998_100470662 220
276 3300027876 Ga0209974_10025488 Ga0209974_100254882 220
277 3300031731 Ga0307405_10031244 Ga0307405_100312444 220
278 3300031824 Ga0307413_10049720 Ga0307413_100497203 220
279 3300031824 Ga0307413_10351189 Ga0307413_103511892 220
280 3300031852 Ga0307410_10073192 Ga0307410_100731922 220
281 3300031901 Ga0307406_10152387 Ga0307406_101523873 220
282 3300031901 Ga0307406_10258917 Ga0307406_102589172 220
283 3300031901 Ga0307406_10453358 Ga0307406_104533582 220
284 3300031995 Ga0307409_100171514 Ga0307409_1001715143 220
285 3300031995 Ga0307409_100173367 Ga0307409_1001733672 220
286 3300032002 Ga0307416_100044638 Ga0307416_1000446383 220
287 3300032002 Ga0307416_100126257 Ga0307416_1001262572 220
288 3300032005 Ga0307411_10079978 Ga0307411_100799782 220
289 3300034957 Ga0373938_0058724 Ga0373938_0058724_120_809 220
290 3300035085 Ga0373929_0017851 Ga0373929_0017851_95_784 220
291 3300035088 Ga0373940_0006120 Ga0373940_0006120_1146_1814 220
292 3300035088 Ga0373940_0047316 Ga0373940_0047316_290_958 220
293 3300035091 Ga0373951_0026459 Ga0373951_0026459_250_918 220
294 3300035112 Ga0373932_0024694 Ga0373932_0024694_589_1278 220
295 3300035114 Ga0373939_0086656 Ga0373939_0086656_184_873 220
296 3300035121 Ga0373960_0007828 Ga0373960_0007828_1514_2182 220
297 3300035691 Ga0373931_0129694 Ga0373931_0129694_488_1177 220
298 3300037068 Ga0373925_0448196 Ga0373925_0448196_82_750 220
299 3300037471 Ga0395905_0081445 Ga0395905_0081445_2145_2831 220
300 3300037471 Ga0395905_0106490 Ga0395905_0106490_1434_2102 220
301 3300037471 Ga0395905_0369628 Ga0395905_0369628_26_691 220
302 3300038996 Ga0242420_023214 Ga0242420_023214_219_887 220
303 3300042157 Ga0439458_0015938 Ga0439458_0015938_961_1629 220
304 3300044706 Ga0466964_0036697 Ga0466964_0036697_750_1418 220
305 3300044712 Ga0453684_0644022 Ga0453684_0644022_138_806 220
306 3300045976 Ga0466967_0827960 Ga0466967_0827960_71_757 220
307 3300048903 Ga0496100_0053068 Ga0496100_0053068_1332_2021 220
308 3300048904 Ga0496101_0154297 Ga0496101_0154297_718_1407 220
309 3300048905 Ga0496102_0199806 Ga0496102_0199806_953_1621 220
310 3300048905 Ga0496102_0389975 Ga0496102_0389975_576_1265 220
311 3300048905 Ga0496102_0936044 Ga0496102_0936044_30_698 220
312 3300048907 Ga0496104_0040471 Ga0496104_0040471_2511_3179 220
313 3300048907 Ga0496104_0184571 Ga0496104_0184571_1309_1977 220
314 3300048908 Ga0496105_0062259 Ga0496105_0062259_698_1366 220
315 3300048910 Ga0496107_0413033 Ga0496107_0413033_309_977 220
316 3300048910 Ga0496107_0531512 Ga0496107_0531512_114_803 220
317 3300048910 Ga0496107_0580375 Ga0496107_0580375_12_680 220
318 3300048911 Ga0496108_0038935 Ga0496108_0038935_2704_3372 220
319 3300048911 Ga0496108_0050523 Ga0496108_0050523_2793_3461 220
320 3300048911 Ga0496108_0125399 Ga0496108_0125399_662_1345 220
321 3300048912 Ga0496109_0011717 Ga0496109_0011717_2119_2802 220
322 3300048912 Ga0496109_0022447 Ga0496109_0022447_2220_2888 220
323 3300048913 Ga0496110_0053106 Ga0496110_0053106_1325_1993 220
324 3300048913 Ga0496110_0061037 Ga0496110_0061037_2426_3094 220
325 3300048914 Ga0496111_0057181 Ga0496111_0057181_1291_1959 220
326 3300048914 Ga0496111_0096516 Ga0496111_0096516_1457_2146 220
327 3300048915 Ga0496112_0018597 Ga0496112_0018597_5859_6527 220
328 3300048915 Ga0496112_0070512 Ga0496112_0070512_2767_3435 220
329 3300048916 Ga0496113_0005261 Ga0496113_0005261_2694_3362 220
330 3300048917 Ga0496114_0060620 Ga0496114_0060620_1564_2232 220
331 3300048917 Ga0496114_0194927 Ga0496114_0194927_494_1177 220
332 3300048918 Ga0496115_0139066 Ga0496115_0139066_776_1444 220
333 3300049583 Ga0501067_0024025 Ga0501067_0024025_2190_2879 220
334 3300049583 Ga0501067_0139400 Ga0501067_0139400_277_939 220
335 3300049584 Ga0501068_0058727 Ga0501068_0058727_1530_2192 220
336 3300049585 Ga0501069_0055094 Ga0501069_0055094_719_1381 220
337 3300049585 Ga0501069_0098955 Ga0501069_0098955_674_1336 220
338 3300049585 Ga0501069_0134101 Ga0501069_0134101_621_1310 220
339 3300049591 Ga0501075_0067949 Ga0501075_0067949_1725_2414 220
340 3300049741 Ga0501079_0027259 Ga0501079_0027259_1666_2355 220
341 3300049743 Ga0501081_0044993 Ga0501081_0044993_405_1094 220
342 3300050511 nmdc:mga08y16_46040_c1 nmdc:mga08y16_46040_c1_3571_4233 220
343 3300050512 nmdc:mga0n895_185974_c1 nmdc:mga0n895_185974_c1_939_1604 220
344 3300050512 nmdc:mga0n895_45349_c1 nmdc:mga0n895_45349_c1_93_755 220
345 3300050514 nmdc:mga08x19_126870_c1 nmdc:mga08x19_126870_c1_807_1475 220
346 3300050515 nmdc:mga0a205_245048_c1 nmdc:mga0a205_245048_c1_124_786 220
347 3300050515 nmdc:mga0a205_62792_c1 nmdc:mga0a205_62792_c1_352_1017 220
348 3300054114 Ga0501084_0124727 Ga0501084_0124727_550_1239 220
349 3300061734 Ga0530510_0171310 Ga0530510_0171310_325_1014 220
350 3300061734 Ga0530510_0393343 Ga0530510_0393343_339_1007 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13462

Thioredoxin_4

Thioredoxin

52

212

0.91

PF01323

DSBA

DSBA-like thioredoxin domain

65

217

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f4s-assembly1.cif.gz_A crystal structure of wolbachia pipientis alpha-dsba1 t172v 0.8766 49 214
3f4t-assembly1.cif.gz_A crystal structure of wolbachia pipientis alpha-dsba1 c97a/c146a 0.8729 49 214
3f4r-assembly1.cif.gz_A crystal structure of wolbachia pipientis alpha-dsba1 0.8723 49 214
5kbc-assembly1.cif.gz_B crystal structure of chlamydia trachomatis dsba 0.8328 49 214
3eu4-assembly1.cif.gz_A crystal structure of bdbd from bacillus subtilis (oxidised) 0.8318 32 213
ID Description Score Start End Superfamily
3gykA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8418 48 213 3.40.30.10
3eu4A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8317 32 213 3.40.30.10
5xwhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8141 57 213 3.40.30.10
4xvwC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8137 49 214 3.40.30.10
3eu4A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8108 32 213 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7W1ENJ5-F1-model_v4 Thioredoxin domain-containing protein 0.9749 47 214
AF-A0A2V7MHB3-F1-model_v4 Thioredoxin-like fold domain-containing protein 0.9736 63 213
AF-A0A2V7RTQ0-F1-model_v4 Thioredoxin domain-containing protein 0.9716 49 214
AF-A0A2G9LVD1-F1-model_v4 Thioredoxin domain-containing protein 0.968 46 214 GO:0016020
AF-A0A842WB47-F1-model_v4 Thioredoxin domain-containing protein 0.9666 46 213 GO:0016020

Feature Viewer

pLDDT pTM Quality
91.03 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map