F418332

General Info

Members Datasets Scaffolds Average Seq Length
350 167 700 200

Family's Representative Sequence

Representative Sequence 3300038735|Ga0400485_10388|Ga0400485_10388_7567_8256
Length 229
Sequence MRSHIVSFTEHQFKLTANALRLLEAKEEDFMSVLITKEAPDFTAPAVMPDGTIEEAFKLSDLKGRYVVLFFYPLDFTFVCPTEIIAHDRRVEEFKQRQVEVVGVSIDSQFTHHAWRNTDINDGGIGPVQFPLVADVNHQITQAYGIEHPAGIALRASFLIDREGVVQHQVVNNLPLGRNVDEMLRLVDALQYTEEHGEVCPAGWQKGDDGMTPTAKGVSDYLSAKSDKL

Samples

Sample ID Description Type Environment
1 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
2 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
81 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
82 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
83 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
84 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
87 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
88 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
89 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
102 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
103 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
104 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
105 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
106 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
107 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
108 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
109 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
110 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
111 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
115 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
116 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
117 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
118 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
122 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
160 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 69.14
Metatranscriptomes 30.57
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0.29
Rhizoplane 2.86
Rhizosphere 87.43
Stem 0
Stem Tuber 0
Unclassified 4.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400485_10388 3300038735 Bacteria 9671
2 Ga0006765J45826_105711 3300003161 Bacteria 701
3 rootH2_10216387 3300003320 Bacteria 2121
4 rootH1_10068586 3300003323 Bacteria 15418
5 Ga0007416J51690_1020935 3300003577 Bacteria 678
6 Ga0058859_11486287 3300004798 Unclassified 706
7 Ga0058863_11749218 3300004799 Bacteria 1426
8 Ga0058861_12054889 3300004800 Bacteria 1534
9 Ga0058862_10287046 3300004803 Bacteria 736
10 Ga0070670_100000054 3300005331 Bacteria 127396
11 Ga0070666_10007111 3300005335 Bacteria 6902
12 Ga0070660_100222795 3300005339 Unclassified 1533
13 Ga0070671_100000037 3300005355 Bacteria 95248
14 Ga0070659_100044039 3300005366 Bacteria 3492
15 Ga0070659_101012940 3300005366 Unclassified 729
16 Ga0070667_100000002 3300005367 Bacteria 504831
17 Ga0070663_100350351 3300005455 Bacteria 1195
18 Ga0070662_100011738 3300005457 Bacteria 5784
19 Ga0070685_10000014 3300005466 Bacteria 120530
20 Ga0070697_100127195 3300005536 Bacteria 2135
21 Ga0068853_100311556 3300005539 Bacteria 1457
22 Ga0068853_100490173 3300005539 Bacteria 1159
23 Ga0068853_100692919 3300005539 Bacteria 971
24 Ga0068853_100844484 3300005539 Bacteria 878
25 Ga0070665_100083984 3300005548 Bacteria 3189
26 Ga0068855_100054524 3300005563 Bacteria 4699
27 Ga0068855_100263496 3300005563 Bacteria 1919
28 Ga0068855_101266846 3300005563 Bacteria 764
29 Ga0068856_100553392 3300005614 Bacteria 1172
30 Ga0068859_100312761 3300005617 Bacteria 1664
31 Ga0068859_100414387 3300005617 Bacteria 1443
32 Ga0068864_100000002 3300005618 Bacteria 658857
33 Ga0068858_100020409 3300005842 Bacteria 6196
34 Ga0068858_100048969 3300005842 Bacteria 3914
35 Ga0068860_100003644 3300005843 Bacteria 15849
36 Ga0068862_100001634 3300005844 Bacteria 20402
37 Ga0075365_10043363 3300006038 Bacteria 2945
38 Ga0075370_10311887 3300006353 Bacteria 936
39 Ga0097620_100312778 3300006931 Bacteria 1664
40 Ga0097620_100414381 3300006931 Bacteria 1443
41 Ga0079104_1007462 3300006946 Bacteria 3961
42 Ga0105251_10134134 3300009011 Bacteria 1121
43 Ga0105250_10000366 3300009092 Bacteria 33900
44 Ga0105240_10707310 3300009093 Bacteria 1099
45 Ga0111539_10011868 3300009094 Bacteria 10921
46 Ga0111539_10069969 3300009094 Unclassified 4143
47 Ga0105247_10029681 3300009101 Bacteria 3315
48 Ga0105241_10943109 3300009174 Bacteria 804
49 Ga0105248_10078878 3300009177 Bacteria 3701
50 Ga0105239_10006575 3300010375 Bacteria 13464
51 Ga0105246_10183471 3300011119 Bacteria 1613
52 Ga0157373_10657254 3300013100 Bacteria 766
53 Ga0157370_10007849 3300013104 Bacteria 11565
54 Ga0157369_10749542 3300013105 Bacteria 1005
55 Ga0157374_10148358 3300013296 Unclassified 2279
56 Ga0157372_10576581 3300013307 Bacteria 1311
57 Ga0157375_11139869 3300013308 Bacteria 914
58 Ga0163163_10000687 3300014325 Bacteria 28756
59 Ga0182008_10020496 3300014497 Bacteria 3404
60 Ga0157376_10116552 3300014969 Bacteria 2360
61 Ga0206356_10861666 3300020070 Bacteria 667
62 Ga0206350_11281916 3300020080 Bacteria 1392
63 Ga0213872_10010730 3300021361 Bacteria 4352
64 Ga0209256_1018088 3300025299 Bacteria 2310
65 Ga0207696_1000138 3300025711 Bacteria 127572
66 Ga0207713_1000080 3300025735 Bacteria 168403
67 Ga0207710_10107903 3300025900 Bacteria 1320
68 Ga0207680_10020739 3300025903 Bacteria 3545
69 Ga0207654_10637256 3300025911 Bacteria 762
70 Ga0207650_10000002 3300025925 Bacteria 1439222
71 Ga0207644_10000114 3300025931 Bacteria 59996
72 Ga0207690_10092185 3300025932 Bacteria 2143
73 Ga0207706_10057230 3300025933 Bacteria 3436
74 Ga0207711_10000540 3300025941 Bacteria 38701
75 Ga0207667_10673351 3300025949 Bacteria 1039
76 Ga0207658_10000001 3300025986 Bacteria 1439333
77 Ga0207703_10015908 3300026035 Bacteria 5868
78 Ga0207639_10332124 3300026041 Bacteria 1353
79 Ga0207639_10628665 3300026041 Bacteria 992
80 Ga0207639_10694082 3300026041 Bacteria 944
81 Ga0207678_10085703 3300026067 Bacteria 2693
82 Ga0207641_10274328 3300026088 Bacteria 1583
83 Ga0207676_10000001 3300026095 Bacteria 1439222
84 Ga0207683_10487011 3300026121 Bacteria 1139
85 Ga0209974_10028776 3300027876 Bacteria 1840
86 Ga0207428_10074424 3300027907 Bacteria 2663
87 Ga0207428_10185163 3300027907 Unclassified 1571
88 Ga0268266_10006302 3300028379 Bacteria 10869
89 Ga0268265_10001809 3300028380 Bacteria 17100
90 Ga0268264_10000004 3300028381 Bacteria 1116842
91 Ga0265327_10001210 3300031251 Bacteria 34803
92 Ga0307408_100000249 3300031548 Bacteria 56039
93 Ga0307408_100001646 3300031548 Bacteria 16479
94 Ga0316575_10000158 3300031665 Bacteria 17085
95 Ga0316575_10008091 3300031665 Bacteria 3822
96 Ga0316575_10036253 3300031665 Bacteria 1939
97 Ga0316575_10069633 3300031665 Bacteria 1412
98 Ga0316575_10104981 3300031665 Bacteria 1150
99 Ga0316579_10011152 3300031691 Bacteria 3815
100 Ga0316579_10146898 3300031691 Bacteria 1137
101 Ga0316576_10015565 3300031727 Bacteria 5108
102 Ga0316576_10076833 3300031727 Bacteria 2471
103 Ga0316576_10084184 3300031727 Bacteria 2363
104 Ga0316576_10171309 3300031727 Bacteria 1638
105 Ga0316576_10258267 3300031727 Bacteria 1307
106 Ga0316576_10282213 3300031727 Bacteria 1243
107 Ga0316578_10000169 3300031728 Bacteria 17713
108 Ga0316578_10000642 3300031728 Bacteria 12377
109 Ga0316578_10022371 3300031728 Bacteria 3523
110 Ga0316578_10068499 3300031728 Bacteria 2098
111 Ga0316578_10269885 3300031728 Bacteria 1019
112 Ga0316577_10003912 3300031733 Bacteria 7602
113 Ga0316577_10004013 3300031733 Bacteria 7535
114 Ga0316577_10032116 3300031733 Bacteria 2933
115 Ga0316577_10036785 3300031733 Bacteria 2738
116 Ga0316577_10192263 3300031733 Bacteria 1153
117 Ga0316577_10434955 3300031733 Bacteria 745
118 Ga0307406_10007017 3300031901 Bacteria 6235
119 Ga0307406_10164375 3300031901 Bacteria 1599
120 Ga0316583_10000694 3300032133 Bacteria 10382
121 Ga0316583_10003212 3300032133 Bacteria 5749
122 Ga0316583_10013893 3300032133 Bacteria 2905
123 Ga0316583_10014972 3300032133 Bacteria 2791
124 Ga0316583_10029747 3300032133 Bacteria 1947
125 Ga0316583_10056282 3300032133 Bacteria 1382
126 Ga0316583_10088512 3300032133 Bacteria 1080
127 Ga0316585_10002594 3300032137 Bacteria 4890
128 Ga0316585_10006923 3300032137 Bacteria 3254
129 Ga0316585_10010488 3300032137 Bacteria 2719
130 Ga0316585_10034620 3300032137 Bacteria 1597
131 Ga0316585_10038554 3300032137 Bacteria 1519
132 Ga0316585_10120804 3300032137 Bacteria 862
133 Ga0316580_10001207 3300032139 Bacteria 6603
134 Ga0316580_10034632 3300032139 Bacteria 1562
135 Ga0316580_10072218 3300032139 Bacteria 1056
136 Ga0316593_10003738 3300032168 Bacteria 3822
137 Ga0316593_10017944 3300032168 Bacteria 2166
138 Ga0316593_10034453 3300032168 Bacteria 1661
139 Ga0316593_10036011 3300032168 Bacteria 1630
140 Ga0316593_10036151 3300032168 Bacteria 1627
141 Ga0316593_10040909 3300032168 Bacteria 1541
142 Ga0316593_10079259 3300032168 Bacteria 1144
143 Ga0316593_10092536 3300032168 Bacteria 1066
144 Ga0316593_10153477 3300032168 Bacteria 838
145 Ga0316593_10170156 3300032168 Bacteria 798
146 Ga0316593_10182700 3300032168 Bacteria 771
147 Ga0316593_10182715 3300032168 Bacteria 771
148 Ga0316593_10183093 3300032168 Bacteria 771
149 Ga0316593_10185516 3300032168 Bacteria 766
150 Ga0316593_10187854 3300032168 Bacteria 761
151 Ga0316593_10189202 3300032168 Bacteria 758
152 Ga0316593_10223453 3300032168 Bacteria 700
153 Ga0316593_10239661 3300032168 Bacteria 677
154 Ga0316593_10244667 3300032168 Bacteria 670
155 Ga0316593_10265980 3300032168 Bacteria 644
156 Ga0316592_1005394 3300033524 Bacteria 2426
157 Ga0316592_1019756 3300033524 Bacteria 1427
158 Ga0316592_1025755 3300033524 Bacteria 1268
159 Ga0316592_1029722 3300033524 Bacteria 1186
160 Ga0316592_1030791 3300033524 Bacteria 1167
161 Ga0316592_1063216 3300033524 Bacteria 832
162 Ga0316592_1067643 3300033524 Bacteria 806
163 Ga0316592_1072335 3300033524 Bacteria 780
164 Ga0316592_1091738 3300033524 Bacteria 695
165 Ga0316592_1104816 3300033524 Bacteria 652
166 Ga0316586_1016425 3300033527 Bacteria 1186
167 Ga0316586_1020214 3300033527 Bacteria 1093
168 Ga0316586_1022584 3300033527 Bacteria 1046
169 Ga0316586_1026882 3300033527 Bacteria 973
170 Ga0316586_1028044 3300033527 Bacteria 956
171 Ga0316586_1032356 3300033527 Bacteria 900
172 Ga0316586_1033195 3300033527 Bacteria 890
173 Ga0316586_1035330 3300033527 Bacteria 866
174 Ga0316586_1036362 3300033527 Bacteria 856
175 Ga0316586_1041615 3300033527 Bacteria 809
176 Ga0316586_1044005 3300033527 Bacteria 790
177 Ga0316588_1013017 3300033528 Bacteria 1799
178 Ga0316588_1025247 3300033528 Bacteria 1372
179 Ga0316588_1028955 3300033528 Bacteria 1294
180 Ga0316588_1029744 3300033528 Bacteria 1279
181 Ga0316588_1032944 3300033528 Bacteria 1221
182 Ga0316588_1037051 3300033528 Bacteria 1159
183 Ga0316588_1040516 3300033528 Bacteria 1113
184 Ga0316588_1047586 3300033528 Bacteria 1036
185 Ga0316588_1057837 3300033528 Bacteria 944
186 Ga0316588_1064851 3300033528 Bacteria 894
187 Ga0316588_1090269 3300033528 Bacteria 763
188 Ga0316588_1104088 3300033528 Bacteria 712
189 Ga0316588_1104459 3300033528 Bacteria 710
190 Ga0316588_1113783 3300033528 Bacteria 682
191 Ga0316587_1017464 3300033529 Bacteria 1202
192 Ga0316587_1019972 3300033529 Bacteria 1136
193 Ga0316587_1022193 3300033529 Bacteria 1087
194 Ga0316587_1026567 3300033529 Bacteria 1009
195 Ga0316587_1030010 3300033529 Bacteria 958
196 Ga0316587_1032448 3300033529 Bacteria 926
197 Ga0316587_1041025 3300033529 Unclassified 836
198 Ga0316587_1044648 3300033529 Bacteria 805
199 Ga0316587_1048310 3300033529 Bacteria 777
200 Ga0316587_1048639 3300033529 Bacteria 774
201 Ga0316587_1051148 3300033529 Bacteria 757
202 Ga0316587_1054376 3300033529 Bacteria 736
203 Ga0316587_1059248 3300033529 Bacteria 708
204 Ga0316587_1070147 3300033529 Bacteria 655
205 Ga0316596_1006806 3300033541 Bacteria 2674
206 Ga0316596_1016016 3300033541 Bacteria 1876
207 Ga0316596_1022294 3300033541 Bacteria 1618
208 Ga0316596_1024029 3300033541 Bacteria 1564
209 Ga0316596_1024341 3300033541 Bacteria 1555
210 Ga0316596_1028052 3300033541 Bacteria 1454
211 Ga0316596_1039798 3300033541 Bacteria 1234
212 Ga0316596_1050034 3300033541 Bacteria 1105
213 Ga0316596_1052470 3300033541 Bacteria 1081
214 Ga0316596_1056534 3300033541 Bacteria 1043
215 Ga0316596_1056547 3300033541 Bacteria 1043
216 Ga0316596_1060664 3300033541 Bacteria 1009
217 Ga0316596_1063927 3300033541 Bacteria 983
218 Ga0316596_1078463 3300033541 Bacteria 887
219 Ga0316596_1078866 3300033541 Bacteria 885
220 Ga0316596_1091051 3300033541 Bacteria 822
221 Ga0316596_1095741 3300033541 Bacteria 801
222 Ga0316596_1105827 3300033541 Unclassified 762
223 Ga0316596_1106622 3300033541 Bacteria 759
224 Ga0316596_1121434 3300033541 Bacteria 711
225 Ga0316596_1124675 3300033541 Bacteria 702
226 Ga0316596_1133702 3300033541 Bacteria 678
227 Ga0316574_0004346 3300035398 Bacteria 7405
228 Ga0316574_0028855 3300035398 Bacteria 3349
229 Ga0316574_0054684 3300035398 Bacteria 2493
230 Ga0316574_0135372 3300035398 Bacteria 1586
231 Ga0316574_0203742 3300035398 Bacteria 1270
232 Ga0316574_0214325 3300035398 Bacteria 1235
233 Ga0316574_0388323 3300035398 Bacteria 880
234 Ga0373935_0519569 3300035692 Unclassified 866
235 Ga0373927_0017732 3300035695 Bacteria 4684
236 Ga0316582_0007783 3300036647 Bacteria 5726
237 Ga0316582_0064263 3300036647 Bacteria 2360
238 Ga0316582_0268749 3300036647 Bacteria 1170
239 Ga0316582_0331584 3300036647 Bacteria 1046
240 Ga0316582_0651529 3300036647 Bacteria 724
241 Ga0316584_0001090 3300036712 Bacteria 15885
242 Ga0316584_0001589 3300036712 Bacteria 13795
243 Ga0316584_0008496 3300036712 Bacteria 7075
244 Ga0316584_0021595 3300036712 Bacteria 4681
245 Ga0316584_0064901 3300036712 Bacteria 2734
246 Ga0316584_0294133 3300036712 Bacteria 1177
247 Ga0316584_0822320 3300036712 Unclassified 630
248 Ga0395900_0140409 3300037418 Bacteria 2474
249 Ga0316581_0008931 3300037588 Unclassified 2742
250 Ga0400484_21458 3300038725 Bacteria 6442
251 Ga0400484_38013 3300038725 Bacteria 2598
252 Ga0400484_44737 3300038725 Bacteria 3223
253 Ga0400490_06663 3300038726 Bacteria 42094
254 Ga0400490_14128 3300038726 Bacteria 1213
255 Ga0400491_28268 3300038727 Bacteria 6828
256 Ga0400485_09016 3300038735 Bacteria 2262
257 Ga0400485_14999 3300038735 Bacteria 12334
258 Ga0400488_31421 3300038741 Bacteria 13433
259 Ga0400488_57649 3300038741 Bacteria 3322
260 Ga0400486_08492 3300038742 Bacteria 14004
261 Ga0400486_08727 3300038742 Bacteria 1775
262 Ga0400486_10354 3300038742 Bacteria 21885
263 Ga0400486_20766 3300038742 Bacteria 91783
264 Ga0400489_72819 3300039093 Bacteria 45511
265 Ga0400487_05468 3300039110 Bacteria 18445
266 Ga0400487_31141 3300039110 Bacteria 6380
267 Ga0400487_38817 3300039110 Bacteria 3156
268 Ga0400487_40435 3300039110 Bacteria 1395
269 Ga0439438_014637 3300041405 Bacteria 2330
270 Ga0451807_1858697 3300041486 Bacteria 1202
271 Ga0450891_003174 3300042129 Bacteria 1602
272 Ga0451577_0000009 3300042876 Bacteria 646744
273 Ga0451577_0118250 3300042876 Bacteria 2374
274 Ga0451576_0011513 3300045051 Bacteria 10042
275 Ga0495627_000215 3300046453 Bacteria 62761
276 Ga0495650_0018782 3300046471 Bacteria 3427
277 Ga0495631_0001498 3300046518 Bacteria 14088
278 Ga0495632_0004196 3300046519 Bacteria 9851
279 Ga0495654_0000423 3300046530 Bacteria 35841
280 Ga0495645_0234354 3300046543 Bacteria 1228
281 Ga0495671_0000049 3300046692 Bacteria 146041
282 Ga0495671_0024200 3300046692 Bacteria 3165
283 Ga0495672_0003804 3300047320 Bacteria 12705
284 Ga0495673_0004094 3300047469 Bacteria 9259
285 Ga0496107_0722072 3300048910 Unclassified 732
286 Ga0496108_0085984 3300048911 Bacteria 2670
287 Ga0496109_0157011 3300048912 Bacteria 2131
288 Ga0496110_0201436 3300048913 Unclassified 1809
289 Ga0496112_0352120 3300048915 Bacteria 1415
290 Ga0496113_0953385 3300048916 Unclassified 677
291 Ga0496114_0025896 3300048917 Bacteria 4798
292 Ga0496114_0199888 3300048917 Unclassified 1750
293 Ga0496114_0450636 3300048917 Bacteria 1140
294 Ga0496116_0000019 3300048919 Bacteria 533227
295 Ga0496121_0000018 3300048924 Bacteria 542045
296 Ga0496124_0374293 3300048927 Bacteria 998
297 Ga0496126_0096961 3300048929 Bacteria 2585
298 Ga0501316_021583 3300049532 Bacteria 815
299 Ga0501031_0002498 3300049568 Bacteria 11718
300 Ga0501032_0000936 3300049569 Bacteria 23616
301 Ga0501032_0010256 3300049569 Bacteria 6759
302 Ga0501032_0038720 3300049569 Bacteria 3245
303 Ga0501033_0005384 3300049570 Bacteria 10139
304 Ga0501033_0007175 3300049570 Bacteria 8695
305 Ga0501034_0003514 3300049571 Bacteria 17785
306 Ga0501034_0239771 3300049571 Bacteria 1760
307 Ga0501036_0000887 3300049572 Bacteria 22368
308 Ga0501036_0009776 3300049572 Bacteria 7898
309 Ga0501036_0010301 3300049572 Bacteria 7712
310 Ga0501036_0464079 3300049572 Bacteria 1054
311 Ga0501037_0002031 3300049573 Bacteria 14661
312 Ga0501038_0015765 3300049574 Bacteria 6868
313 Ga0501039_0006959 3300049575 Bacteria 8609
314 Ga0501039_0062540 3300049575 Bacteria 2884
315 Ga0501039_0809191 3300049575 Bacteria 731
316 Ga0501040_0000774 3300049576 Bacteria 19878
317 Ga0501042_0000850 3300049578 Bacteria 17035
318 Ga0501043_0001224 3300049579 Bacteria 22638
319 Ga0501043_0152138 3300049579 Bacteria 1810
320 Ga0501046_0006333 3300049580 Bacteria 10489
321 Ga0501047_0011672 3300049581 Bacteria 8305
322 Ga0501047_0078863 3300049581 Bacteria 3167
323 Ga0501047_0430769 3300049581 Bacteria 1150
324 Ga0501048_0001029 3300049582 Bacteria 20864
325 Ga0501067_0179588 3300049583 Bacteria 1179
326 Ga0501068_0295519 3300049584 Bacteria 1036
327 Ga0501070_0145128 3300049586 Bacteria 1959
328 Ga0501073_0536768 3300049589 Bacteria 808
329 Ga0501230_017907 3300049667 Bacteria 1204
330 Ga0501035_0000450 3300049822 Bacteria 46029
331 Ga0501035_0007138 3300049822 Bacteria 10446
332 Ga0501035_0223876 3300049822 Bacteria 1605
333 Ga0501035_0275340 3300049822 Bacteria 1423
334 Ga0501044_0000068 3300049823 Bacteria 126642
335 Ga0501044_0001278 3300049823 Bacteria 29733
336 Ga0501044_0013125 3300049823 Bacteria 8968
337 Ga0501044_0022715 3300049823 Bacteria 6679
338 Ga0501045_0008825 3300049824 Bacteria 7042
339 nmdc:mga07m45_197797_c1 3300050496 Bacteria 1169
340 nmdc:mga08y16_14116_c1 3300050511 Bacteria 8410
341 nmdc:mga08y16_89501_c1 3300050511 Bacteria 3208
342 Ga0500650_0000029 3300053098 Bacteria 54937
343 Ga0587070_100693 3300059491 Bacteria 664
344 Ga0587088_058014 3300059508 Bacteria 777
345 Ga0587095_014345 3300059514 Bacteria 708
346 Ga0587101_055615 3300059623 Bacteria 693
347 Ga0587117_035471 3300059627 Bacteria 772
348 Ga0587068_064990 3300059641 Bacteria 709
349 Ga0587118_10765 3300059657 Bacteria 700
350 646814971 646564506 Bacteria 3192235
351 Ga0400485_10388
352 Ga0006765J45826_105711
353 rootH2_10216387
354 rootH1_10068586
355 Ga0007416J51690_1020935
356 Ga0058859_11486287
357 Ga0058863_11749218
358 Ga0058861_12054889
359 Ga0058862_10287046
360 Ga0070670_100000054
361 Ga0070666_10007111
362 Ga0070660_100222795
363 Ga0070671_100000037
364 Ga0070659_100044039
365 Ga0070659_101012940
366 Ga0070667_100000002
367 Ga0070663_100350351
368 Ga0070662_100011738
369 Ga0070685_10000014
370 Ga0070697_100127195
371 Ga0068853_100311556
372 Ga0068853_100490173
373 Ga0068853_100692919
374 Ga0068853_100844484
375 Ga0070665_100083984
376 Ga0068855_100054524
377 Ga0068855_100263496
378 Ga0068855_101266846
379 Ga0068856_100553392
380 Ga0068859_100312761
381 Ga0068859_100414387
382 Ga0068864_100000002
383 Ga0068858_100020409
384 Ga0068858_100048969
385 Ga0068860_100003644
386 Ga0068862_100001634
387 Ga0075365_10043363
388 Ga0075370_10311887
389 Ga0097620_100312778
390 Ga0097620_100414381
391 Ga0079104_1007462
392 Ga0105251_10134134
393 Ga0105250_10000366
394 Ga0105240_10707310
395 Ga0111539_10011868
396 Ga0111539_10069969
397 Ga0105247_10029681
398 Ga0105241_10943109
399 Ga0105248_10078878
400 Ga0105239_10006575
401 Ga0105246_10183471
402 Ga0157373_10657254
403 Ga0157370_10007849
404 Ga0157369_10749542
405 Ga0157374_10148358
406 Ga0157372_10576581
407 Ga0157375_11139869
408 Ga0163163_10000687
409 Ga0182008_10020496
410 Ga0157376_10116552
411 Ga0206356_10861666
412 Ga0206350_11281916
413 Ga0213872_10010730
414 Ga0209256_1018088
415 Ga0207696_1000138
416 Ga0207713_1000080
417 Ga0207710_10107903
418 Ga0207680_10020739
419 Ga0207654_10637256
420 Ga0207650_10000002
421 Ga0207644_10000114
422 Ga0207690_10092185
423 Ga0207706_10057230
424 Ga0207711_10000540
425 Ga0207667_10673351
426 Ga0207658_10000001
427 Ga0207703_10015908
428 Ga0207639_10332124
429 Ga0207639_10628665
430 Ga0207639_10694082
431 Ga0207678_10085703
432 Ga0207641_10274328
433 Ga0207676_10000001
434 Ga0207683_10487011
435 Ga0209974_10028776
436 Ga0207428_10074424
437 Ga0207428_10185163
438 Ga0268266_10006302
439 Ga0268265_10001809
440 Ga0268264_10000004
441 Ga0265327_10001210
442 Ga0307408_100000249
443 Ga0307408_100001646
444 Ga0316575_10000158
445 Ga0316575_10008091
446 Ga0316575_10036253
447 Ga0316575_10069633
448 Ga0316575_10104981
449 Ga0316579_10011152
450 Ga0316579_10146898
451 Ga0316576_10015565
452 Ga0316576_10076833
453 Ga0316576_10084184
454 Ga0316576_10171309
455 Ga0316576_10258267
456 Ga0316576_10282213
457 Ga0316578_10000169
458 Ga0316578_10000642
459 Ga0316578_10022371
460 Ga0316578_10068499
461 Ga0316578_10269885
462 Ga0316577_10003912
463 Ga0316577_10004013
464 Ga0316577_10032116
465 Ga0316577_10036785
466 Ga0316577_10192263
467 Ga0316577_10434955
468 Ga0307406_10007017
469 Ga0307406_10164375
470 Ga0316583_10000694
471 Ga0316583_10003212
472 Ga0316583_10013893
473 Ga0316583_10014972
474 Ga0316583_10029747
475 Ga0316583_10056282
476 Ga0316583_10088512
477 Ga0316585_10002594
478 Ga0316585_10006923
479 Ga0316585_10010488
480 Ga0316585_10034620
481 Ga0316585_10038554
482 Ga0316585_10120804
483 Ga0316580_10001207
484 Ga0316580_10034632
485 Ga0316580_10072218
486 Ga0316593_10003738
487 Ga0316593_10017944
488 Ga0316593_10034453
489 Ga0316593_10036011
490 Ga0316593_10036151
491 Ga0316593_10040909
492 Ga0316593_10079259
493 Ga0316593_10092536
494 Ga0316593_10153477
495 Ga0316593_10170156
496 Ga0316593_10182700
497 Ga0316593_10182715
498 Ga0316593_10183093
499 Ga0316593_10185516
500 Ga0316593_10187854
501 Ga0316593_10189202
502 Ga0316593_10223453
503 Ga0316593_10239661
504 Ga0316593_10244667
505 Ga0316593_10265980
506 Ga0316592_1005394
507 Ga0316592_1019756
508 Ga0316592_1025755
509 Ga0316592_1029722
510 Ga0316592_1030791
511 Ga0316592_1063216
512 Ga0316592_1067643
513 Ga0316592_1072335
514 Ga0316592_1091738
515 Ga0316592_1104816
516 Ga0316586_1016425
517 Ga0316586_1020214
518 Ga0316586_1022584
519 Ga0316586_1026882
520 Ga0316586_1028044
521 Ga0316586_1032356
522 Ga0316586_1033195
523 Ga0316586_1035330
524 Ga0316586_1036362
525 Ga0316586_1041615
526 Ga0316586_1044005
527 Ga0316588_1013017
528 Ga0316588_1025247
529 Ga0316588_1028955
530 Ga0316588_1029744
531 Ga0316588_1032944
532 Ga0316588_1037051
533 Ga0316588_1040516
534 Ga0316588_1047586
535 Ga0316588_1057837
536 Ga0316588_1064851
537 Ga0316588_1090269
538 Ga0316588_1104088
539 Ga0316588_1104459
540 Ga0316588_1113783
541 Ga0316587_1017464
542 Ga0316587_1019972
543 Ga0316587_1022193
544 Ga0316587_1026567
545 Ga0316587_1030010
546 Ga0316587_1032448
547 Ga0316587_1041025
548 Ga0316587_1044648
549 Ga0316587_1048310
550 Ga0316587_1048639
551 Ga0316587_1051148
552 Ga0316587_1054376
553 Ga0316587_1059248
554 Ga0316587_1070147
555 Ga0316596_1006806
556 Ga0316596_1016016
557 Ga0316596_1022294
558 Ga0316596_1024029
559 Ga0316596_1024341
560 Ga0316596_1028052
561 Ga0316596_1039798
562 Ga0316596_1050034
563 Ga0316596_1052470
564 Ga0316596_1056534
565 Ga0316596_1056547
566 Ga0316596_1060664
567 Ga0316596_1063927
568 Ga0316596_1078463
569 Ga0316596_1078866
570 Ga0316596_1091051
571 Ga0316596_1095741
572 Ga0316596_1105827
573 Ga0316596_1106622
574 Ga0316596_1121434
575 Ga0316596_1124675
576 Ga0316596_1133702
577 Ga0316574_0004346
578 Ga0316574_0028855
579 Ga0316574_0054684
580 Ga0316574_0135372
581 Ga0316574_0203742
582 Ga0316574_0214325
583 Ga0316574_0388323
584 Ga0373935_0519569
585 Ga0373927_0017732
586 Ga0316582_0007783
587 Ga0316582_0064263
588 Ga0316582_0268749
589 Ga0316582_0331584
590 Ga0316582_0651529
591 Ga0316584_0001090
592 Ga0316584_0001589
593 Ga0316584_0008496
594 Ga0316584_0021595
595 Ga0316584_0064901
596 Ga0316584_0294133
597 Ga0316584_0822320
598 Ga0395900_0140409
599 Ga0316581_0008931
600 Ga0400484_21458
601 Ga0400484_38013
602 Ga0400484_44737
603 Ga0400490_06663
604 Ga0400490_14128
605 Ga0400491_28268
606 Ga0400485_09016
607 Ga0400485_14999
608 Ga0400488_31421
609 Ga0400488_57649
610 Ga0400486_08492
611 Ga0400486_08727
612 Ga0400486_10354
613 Ga0400486_20766
614 Ga0400489_72819
615 Ga0400487_05468
616 Ga0400487_31141
617 Ga0400487_38817
618 Ga0400487_40435
619 Ga0439438_014637
620 Ga0451807_1858697
621 Ga0450891_003174
622 Ga0451577_0000009
623 Ga0451577_0118250
624 Ga0451576_0011513
625 Ga0495627_000215
626 Ga0495650_0018782
627 Ga0495631_0001498
628 Ga0495632_0004196
629 Ga0495654_0000423
630 Ga0495645_0234354
631 Ga0495671_0000049
632 Ga0495671_0024200
633 Ga0495672_0003804
634 Ga0495673_0004094
635 Ga0496107_0722072
636 Ga0496108_0085984
637 Ga0496109_0157011
638 Ga0496110_0201436
639 Ga0496112_0352120
640 Ga0496113_0953385
641 Ga0496114_0025896
642 Ga0496114_0199888
643 Ga0496114_0450636
644 Ga0496116_0000019
645 Ga0496121_0000018
646 Ga0496124_0374293
647 Ga0496126_0096961
648 Ga0501316_021583
649 Ga0501031_0002498
650 Ga0501032_0000936
651 Ga0501032_0010256
652 Ga0501032_0038720
653 Ga0501033_0005384
654 Ga0501033_0007175
655 Ga0501034_0003514
656 Ga0501034_0239771
657 Ga0501036_0000887
658 Ga0501036_0009776
659 Ga0501036_0010301
660 Ga0501036_0464079
661 Ga0501037_0002031
662 Ga0501038_0015765
663 Ga0501039_0006959
664 Ga0501039_0062540
665 Ga0501039_0809191
666 Ga0501040_0000774
667 Ga0501042_0000850
668 Ga0501043_0001224
669 Ga0501043_0152138
670 Ga0501046_0006333
671 Ga0501047_0011672
672 Ga0501047_0078863
673 Ga0501047_0430769
674 Ga0501048_0001029
675 Ga0501067_0179588
676 Ga0501068_0295519
677 Ga0501070_0145128
678 Ga0501073_0536768
679 Ga0501230_017907
680 Ga0501035_0000450
681 Ga0501035_0007138
682 Ga0501035_0223876
683 Ga0501035_0275340
684 Ga0501044_0000068
685 Ga0501044_0001278
686 Ga0501044_0013125
687 Ga0501044_0022715
688 Ga0501045_0008825
689 nmdc:mga07m45_197797_c1
690 nmdc:mga08y16_14116_c1
691 nmdc:mga08y16_89501_c1
692 Ga0500650_0000029
693 Ga0587070_100693
694 Ga0587088_058014
695 Ga0587095_014345
696 Ga0587101_055615
697 Ga0587117_035471
698 Ga0587068_064990
699 Ga0587118_10765
700 646814971

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

189

224

0.96

PF00578

AhpC-TSA

AhpC/TSA family

35

169

0.95

PF08534

Redoxin

Redoxin

35

185

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tue-assembly1.cif.gz_A the structure of tryparedoxin peroxidase i from leishmania major 0.9587 5 167
6j13-assembly2.cif.gz_H redox protein from chlamydomonas reinhardtii 0.9581 2 167
1e2y-assembly1.cif.gz_F tryparedoxin peroxidase from crithidia fasciculata 0.9549 5 163
7e4u-assembly4.cif.gz_H crystal structure of peroxiredoxin-1 0.9538 5 173
2c0d-assembly1.cif.gz_A structure of the mitochondrial 2-cys peroxiredoxin from plasmodium falciparum 0.9527 4 172
ID Description Score Start End Superfamily
2c0dA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9527 4 172 3.40.30.10
5ijtA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9483 5 164 3.40.30.10
2c0dA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9472 4 172 3.40.30.10
af_Q8I5Q6_15_214_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9421 1 200 3.40.30.10
af_A0A0R4J2P7_61_260_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.933 2 195 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6N6X8E0-F1-model_v4 deleted 0.9795 2 168
AF-A0A0N1DAZ8-F1-model_v4 Alkyl hydroperoxide reductase 0.9783 1 200 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A0R2ZTX2-F1-model_v4 Alkyl hydroperoxide reductase 0.978 1 200 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A1F3B131-F1-model_v4 Alkyl hydroperoxide reductase 0.9778 2 157 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A7T7X180-F1-model_v4 deleted 0.9775 1 200

Map