F418332
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 350 | 167 | 700 | 200 |
Family's Representative Sequence
| Representative Sequence | 3300038735|Ga0400485_10388|Ga0400485_10388_7567_8256 |
| Length | 229 |
| Sequence | MRSHIVSFTEHQFKLTANALRLLEAKEEDFMSVLITKEAPDFTAPAVMPDGTIEEAFKLSDLKGRYVVLFFYPLDFTFVCPTEIIAHDRRVEEFKQRQVEVVGVSIDSQFTHHAWRNTDINDGGIGPVQFPLVADVNHQITQAYGIEHPAGIALRASFLIDREGVVQHQVVNNLPLGRNVDEMLRLVDALQYTEEHGEVCPAGWQKGDDGMTPTAKGVSDYLSAKSDKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 2 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 24 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 25 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 26 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 27 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 28 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 29 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 30 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 31 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 33 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 50 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 52 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 53 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 54 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 55 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 75 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 79 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 80 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 81 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 82 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 83 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 84 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 85 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 86 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 87 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 88 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 89 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 90 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 91 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 92 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 93 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 94 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 95 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 96 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 97 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 98 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 99 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 100 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 101 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 102 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 103 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 104 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 105 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 106 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 107 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 108 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 109 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 110 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 111 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 112 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 113 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 114 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 124 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 125 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 127 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 128 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 129 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 130 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 131 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 132 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 133 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 134 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 154 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 158 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 160 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 646564506 | Arcobacter nitrofigilis DSM 7299 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 69.14 |
| Metatranscriptomes | 30.57 |
| Isolates | 0.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.43 |
| Nodule | 0.29 |
| Rhizoplane | 2.86 |
| Rhizosphere | 87.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0400485_10388 | 3300038735 | Bacteria | 9671 |
| 2 | Ga0006765J45826_105711 | 3300003161 | Bacteria | 701 |
| 3 | rootH2_10216387 | 3300003320 | Bacteria | 2121 |
| 4 | rootH1_10068586 | 3300003323 | Bacteria | 15418 |
| 5 | Ga0007416J51690_1020935 | 3300003577 | Bacteria | 678 |
| 6 | Ga0058859_11486287 | 3300004798 | Unclassified | 706 |
| 7 | Ga0058863_11749218 | 3300004799 | Bacteria | 1426 |
| 8 | Ga0058861_12054889 | 3300004800 | Bacteria | 1534 |
| 9 | Ga0058862_10287046 | 3300004803 | Bacteria | 736 |
| 10 | Ga0070670_100000054 | 3300005331 | Bacteria | 127396 |
| 11 | Ga0070666_10007111 | 3300005335 | Bacteria | 6902 |
| 12 | Ga0070660_100222795 | 3300005339 | Unclassified | 1533 |
| 13 | Ga0070671_100000037 | 3300005355 | Bacteria | 95248 |
| 14 | Ga0070659_100044039 | 3300005366 | Bacteria | 3492 |
| 15 | Ga0070659_101012940 | 3300005366 | Unclassified | 729 |
| 16 | Ga0070667_100000002 | 3300005367 | Bacteria | 504831 |
| 17 | Ga0070663_100350351 | 3300005455 | Bacteria | 1195 |
| 18 | Ga0070662_100011738 | 3300005457 | Bacteria | 5784 |
| 19 | Ga0070685_10000014 | 3300005466 | Bacteria | 120530 |
| 20 | Ga0070697_100127195 | 3300005536 | Bacteria | 2135 |
| 21 | Ga0068853_100311556 | 3300005539 | Bacteria | 1457 |
| 22 | Ga0068853_100490173 | 3300005539 | Bacteria | 1159 |
| 23 | Ga0068853_100692919 | 3300005539 | Bacteria | 971 |
| 24 | Ga0068853_100844484 | 3300005539 | Bacteria | 878 |
| 25 | Ga0070665_100083984 | 3300005548 | Bacteria | 3189 |
| 26 | Ga0068855_100054524 | 3300005563 | Bacteria | 4699 |
| 27 | Ga0068855_100263496 | 3300005563 | Bacteria | 1919 |
| 28 | Ga0068855_101266846 | 3300005563 | Bacteria | 764 |
| 29 | Ga0068856_100553392 | 3300005614 | Bacteria | 1172 |
| 30 | Ga0068859_100312761 | 3300005617 | Bacteria | 1664 |
| 31 | Ga0068859_100414387 | 3300005617 | Bacteria | 1443 |
| 32 | Ga0068864_100000002 | 3300005618 | Bacteria | 658857 |
| 33 | Ga0068858_100020409 | 3300005842 | Bacteria | 6196 |
| 34 | Ga0068858_100048969 | 3300005842 | Bacteria | 3914 |
| 35 | Ga0068860_100003644 | 3300005843 | Bacteria | 15849 |
| 36 | Ga0068862_100001634 | 3300005844 | Bacteria | 20402 |
| 37 | Ga0075365_10043363 | 3300006038 | Bacteria | 2945 |
| 38 | Ga0075370_10311887 | 3300006353 | Bacteria | 936 |
| 39 | Ga0097620_100312778 | 3300006931 | Bacteria | 1664 |
| 40 | Ga0097620_100414381 | 3300006931 | Bacteria | 1443 |
| 41 | Ga0079104_1007462 | 3300006946 | Bacteria | 3961 |
| 42 | Ga0105251_10134134 | 3300009011 | Bacteria | 1121 |
| 43 | Ga0105250_10000366 | 3300009092 | Bacteria | 33900 |
| 44 | Ga0105240_10707310 | 3300009093 | Bacteria | 1099 |
| 45 | Ga0111539_10011868 | 3300009094 | Bacteria | 10921 |
| 46 | Ga0111539_10069969 | 3300009094 | Unclassified | 4143 |
| 47 | Ga0105247_10029681 | 3300009101 | Bacteria | 3315 |
| 48 | Ga0105241_10943109 | 3300009174 | Bacteria | 804 |
| 49 | Ga0105248_10078878 | 3300009177 | Bacteria | 3701 |
| 50 | Ga0105239_10006575 | 3300010375 | Bacteria | 13464 |
| 51 | Ga0105246_10183471 | 3300011119 | Bacteria | 1613 |
| 52 | Ga0157373_10657254 | 3300013100 | Bacteria | 766 |
| 53 | Ga0157370_10007849 | 3300013104 | Bacteria | 11565 |
| 54 | Ga0157369_10749542 | 3300013105 | Bacteria | 1005 |
| 55 | Ga0157374_10148358 | 3300013296 | Unclassified | 2279 |
| 56 | Ga0157372_10576581 | 3300013307 | Bacteria | 1311 |
| 57 | Ga0157375_11139869 | 3300013308 | Bacteria | 914 |
| 58 | Ga0163163_10000687 | 3300014325 | Bacteria | 28756 |
| 59 | Ga0182008_10020496 | 3300014497 | Bacteria | 3404 |
| 60 | Ga0157376_10116552 | 3300014969 | Bacteria | 2360 |
| 61 | Ga0206356_10861666 | 3300020070 | Bacteria | 667 |
| 62 | Ga0206350_11281916 | 3300020080 | Bacteria | 1392 |
| 63 | Ga0213872_10010730 | 3300021361 | Bacteria | 4352 |
| 64 | Ga0209256_1018088 | 3300025299 | Bacteria | 2310 |
| 65 | Ga0207696_1000138 | 3300025711 | Bacteria | 127572 |
| 66 | Ga0207713_1000080 | 3300025735 | Bacteria | 168403 |
| 67 | Ga0207710_10107903 | 3300025900 | Bacteria | 1320 |
| 68 | Ga0207680_10020739 | 3300025903 | Bacteria | 3545 |
| 69 | Ga0207654_10637256 | 3300025911 | Bacteria | 762 |
| 70 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 71 | Ga0207644_10000114 | 3300025931 | Bacteria | 59996 |
| 72 | Ga0207690_10092185 | 3300025932 | Bacteria | 2143 |
| 73 | Ga0207706_10057230 | 3300025933 | Bacteria | 3436 |
| 74 | Ga0207711_10000540 | 3300025941 | Bacteria | 38701 |
| 75 | Ga0207667_10673351 | 3300025949 | Bacteria | 1039 |
| 76 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 77 | Ga0207703_10015908 | 3300026035 | Bacteria | 5868 |
| 78 | Ga0207639_10332124 | 3300026041 | Bacteria | 1353 |
| 79 | Ga0207639_10628665 | 3300026041 | Bacteria | 992 |
| 80 | Ga0207639_10694082 | 3300026041 | Bacteria | 944 |
| 81 | Ga0207678_10085703 | 3300026067 | Bacteria | 2693 |
| 82 | Ga0207641_10274328 | 3300026088 | Bacteria | 1583 |
| 83 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 84 | Ga0207683_10487011 | 3300026121 | Bacteria | 1139 |
| 85 | Ga0209974_10028776 | 3300027876 | Bacteria | 1840 |
| 86 | Ga0207428_10074424 | 3300027907 | Bacteria | 2663 |
| 87 | Ga0207428_10185163 | 3300027907 | Unclassified | 1571 |
| 88 | Ga0268266_10006302 | 3300028379 | Bacteria | 10869 |
| 89 | Ga0268265_10001809 | 3300028380 | Bacteria | 17100 |
| 90 | Ga0268264_10000004 | 3300028381 | Bacteria | 1116842 |
| 91 | Ga0265327_10001210 | 3300031251 | Bacteria | 34803 |
| 92 | Ga0307408_100000249 | 3300031548 | Bacteria | 56039 |
| 93 | Ga0307408_100001646 | 3300031548 | Bacteria | 16479 |
| 94 | Ga0316575_10000158 | 3300031665 | Bacteria | 17085 |
| 95 | Ga0316575_10008091 | 3300031665 | Bacteria | 3822 |
| 96 | Ga0316575_10036253 | 3300031665 | Bacteria | 1939 |
| 97 | Ga0316575_10069633 | 3300031665 | Bacteria | 1412 |
| 98 | Ga0316575_10104981 | 3300031665 | Bacteria | 1150 |
| 99 | Ga0316579_10011152 | 3300031691 | Bacteria | 3815 |
| 100 | Ga0316579_10146898 | 3300031691 | Bacteria | 1137 |
| 101 | Ga0316576_10015565 | 3300031727 | Bacteria | 5108 |
| 102 | Ga0316576_10076833 | 3300031727 | Bacteria | 2471 |
| 103 | Ga0316576_10084184 | 3300031727 | Bacteria | 2363 |
| 104 | Ga0316576_10171309 | 3300031727 | Bacteria | 1638 |
| 105 | Ga0316576_10258267 | 3300031727 | Bacteria | 1307 |
| 106 | Ga0316576_10282213 | 3300031727 | Bacteria | 1243 |
| 107 | Ga0316578_10000169 | 3300031728 | Bacteria | 17713 |
| 108 | Ga0316578_10000642 | 3300031728 | Bacteria | 12377 |
| 109 | Ga0316578_10022371 | 3300031728 | Bacteria | 3523 |
| 110 | Ga0316578_10068499 | 3300031728 | Bacteria | 2098 |
| 111 | Ga0316578_10269885 | 3300031728 | Bacteria | 1019 |
| 112 | Ga0316577_10003912 | 3300031733 | Bacteria | 7602 |
| 113 | Ga0316577_10004013 | 3300031733 | Bacteria | 7535 |
| 114 | Ga0316577_10032116 | 3300031733 | Bacteria | 2933 |
| 115 | Ga0316577_10036785 | 3300031733 | Bacteria | 2738 |
| 116 | Ga0316577_10192263 | 3300031733 | Bacteria | 1153 |
| 117 | Ga0316577_10434955 | 3300031733 | Bacteria | 745 |
| 118 | Ga0307406_10007017 | 3300031901 | Bacteria | 6235 |
| 119 | Ga0307406_10164375 | 3300031901 | Bacteria | 1599 |
| 120 | Ga0316583_10000694 | 3300032133 | Bacteria | 10382 |
| 121 | Ga0316583_10003212 | 3300032133 | Bacteria | 5749 |
| 122 | Ga0316583_10013893 | 3300032133 | Bacteria | 2905 |
| 123 | Ga0316583_10014972 | 3300032133 | Bacteria | 2791 |
| 124 | Ga0316583_10029747 | 3300032133 | Bacteria | 1947 |
| 125 | Ga0316583_10056282 | 3300032133 | Bacteria | 1382 |
| 126 | Ga0316583_10088512 | 3300032133 | Bacteria | 1080 |
| 127 | Ga0316585_10002594 | 3300032137 | Bacteria | 4890 |
| 128 | Ga0316585_10006923 | 3300032137 | Bacteria | 3254 |
| 129 | Ga0316585_10010488 | 3300032137 | Bacteria | 2719 |
| 130 | Ga0316585_10034620 | 3300032137 | Bacteria | 1597 |
| 131 | Ga0316585_10038554 | 3300032137 | Bacteria | 1519 |
| 132 | Ga0316585_10120804 | 3300032137 | Bacteria | 862 |
| 133 | Ga0316580_10001207 | 3300032139 | Bacteria | 6603 |
| 134 | Ga0316580_10034632 | 3300032139 | Bacteria | 1562 |
| 135 | Ga0316580_10072218 | 3300032139 | Bacteria | 1056 |
| 136 | Ga0316593_10003738 | 3300032168 | Bacteria | 3822 |
| 137 | Ga0316593_10017944 | 3300032168 | Bacteria | 2166 |
| 138 | Ga0316593_10034453 | 3300032168 | Bacteria | 1661 |
| 139 | Ga0316593_10036011 | 3300032168 | Bacteria | 1630 |
| 140 | Ga0316593_10036151 | 3300032168 | Bacteria | 1627 |
| 141 | Ga0316593_10040909 | 3300032168 | Bacteria | 1541 |
| 142 | Ga0316593_10079259 | 3300032168 | Bacteria | 1144 |
| 143 | Ga0316593_10092536 | 3300032168 | Bacteria | 1066 |
| 144 | Ga0316593_10153477 | 3300032168 | Bacteria | 838 |
| 145 | Ga0316593_10170156 | 3300032168 | Bacteria | 798 |
| 146 | Ga0316593_10182700 | 3300032168 | Bacteria | 771 |
| 147 | Ga0316593_10182715 | 3300032168 | Bacteria | 771 |
| 148 | Ga0316593_10183093 | 3300032168 | Bacteria | 771 |
| 149 | Ga0316593_10185516 | 3300032168 | Bacteria | 766 |
| 150 | Ga0316593_10187854 | 3300032168 | Bacteria | 761 |
| 151 | Ga0316593_10189202 | 3300032168 | Bacteria | 758 |
| 152 | Ga0316593_10223453 | 3300032168 | Bacteria | 700 |
| 153 | Ga0316593_10239661 | 3300032168 | Bacteria | 677 |
| 154 | Ga0316593_10244667 | 3300032168 | Bacteria | 670 |
| 155 | Ga0316593_10265980 | 3300032168 | Bacteria | 644 |
| 156 | Ga0316592_1005394 | 3300033524 | Bacteria | 2426 |
| 157 | Ga0316592_1019756 | 3300033524 | Bacteria | 1427 |
| 158 | Ga0316592_1025755 | 3300033524 | Bacteria | 1268 |
| 159 | Ga0316592_1029722 | 3300033524 | Bacteria | 1186 |
| 160 | Ga0316592_1030791 | 3300033524 | Bacteria | 1167 |
| 161 | Ga0316592_1063216 | 3300033524 | Bacteria | 832 |
| 162 | Ga0316592_1067643 | 3300033524 | Bacteria | 806 |
| 163 | Ga0316592_1072335 | 3300033524 | Bacteria | 780 |
| 164 | Ga0316592_1091738 | 3300033524 | Bacteria | 695 |
| 165 | Ga0316592_1104816 | 3300033524 | Bacteria | 652 |
| 166 | Ga0316586_1016425 | 3300033527 | Bacteria | 1186 |
| 167 | Ga0316586_1020214 | 3300033527 | Bacteria | 1093 |
| 168 | Ga0316586_1022584 | 3300033527 | Bacteria | 1046 |
| 169 | Ga0316586_1026882 | 3300033527 | Bacteria | 973 |
| 170 | Ga0316586_1028044 | 3300033527 | Bacteria | 956 |
| 171 | Ga0316586_1032356 | 3300033527 | Bacteria | 900 |
| 172 | Ga0316586_1033195 | 3300033527 | Bacteria | 890 |
| 173 | Ga0316586_1035330 | 3300033527 | Bacteria | 866 |
| 174 | Ga0316586_1036362 | 3300033527 | Bacteria | 856 |
| 175 | Ga0316586_1041615 | 3300033527 | Bacteria | 809 |
| 176 | Ga0316586_1044005 | 3300033527 | Bacteria | 790 |
| 177 | Ga0316588_1013017 | 3300033528 | Bacteria | 1799 |
| 178 | Ga0316588_1025247 | 3300033528 | Bacteria | 1372 |
| 179 | Ga0316588_1028955 | 3300033528 | Bacteria | 1294 |
| 180 | Ga0316588_1029744 | 3300033528 | Bacteria | 1279 |
| 181 | Ga0316588_1032944 | 3300033528 | Bacteria | 1221 |
| 182 | Ga0316588_1037051 | 3300033528 | Bacteria | 1159 |
| 183 | Ga0316588_1040516 | 3300033528 | Bacteria | 1113 |
| 184 | Ga0316588_1047586 | 3300033528 | Bacteria | 1036 |
| 185 | Ga0316588_1057837 | 3300033528 | Bacteria | 944 |
| 186 | Ga0316588_1064851 | 3300033528 | Bacteria | 894 |
| 187 | Ga0316588_1090269 | 3300033528 | Bacteria | 763 |
| 188 | Ga0316588_1104088 | 3300033528 | Bacteria | 712 |
| 189 | Ga0316588_1104459 | 3300033528 | Bacteria | 710 |
| 190 | Ga0316588_1113783 | 3300033528 | Bacteria | 682 |
| 191 | Ga0316587_1017464 | 3300033529 | Bacteria | 1202 |
| 192 | Ga0316587_1019972 | 3300033529 | Bacteria | 1136 |
| 193 | Ga0316587_1022193 | 3300033529 | Bacteria | 1087 |
| 194 | Ga0316587_1026567 | 3300033529 | Bacteria | 1009 |
| 195 | Ga0316587_1030010 | 3300033529 | Bacteria | 958 |
| 196 | Ga0316587_1032448 | 3300033529 | Bacteria | 926 |
| 197 | Ga0316587_1041025 | 3300033529 | Unclassified | 836 |
| 198 | Ga0316587_1044648 | 3300033529 | Bacteria | 805 |
| 199 | Ga0316587_1048310 | 3300033529 | Bacteria | 777 |
| 200 | Ga0316587_1048639 | 3300033529 | Bacteria | 774 |
| 201 | Ga0316587_1051148 | 3300033529 | Bacteria | 757 |
| 202 | Ga0316587_1054376 | 3300033529 | Bacteria | 736 |
| 203 | Ga0316587_1059248 | 3300033529 | Bacteria | 708 |
| 204 | Ga0316587_1070147 | 3300033529 | Bacteria | 655 |
| 205 | Ga0316596_1006806 | 3300033541 | Bacteria | 2674 |
| 206 | Ga0316596_1016016 | 3300033541 | Bacteria | 1876 |
| 207 | Ga0316596_1022294 | 3300033541 | Bacteria | 1618 |
| 208 | Ga0316596_1024029 | 3300033541 | Bacteria | 1564 |
| 209 | Ga0316596_1024341 | 3300033541 | Bacteria | 1555 |
| 210 | Ga0316596_1028052 | 3300033541 | Bacteria | 1454 |
| 211 | Ga0316596_1039798 | 3300033541 | Bacteria | 1234 |
| 212 | Ga0316596_1050034 | 3300033541 | Bacteria | 1105 |
| 213 | Ga0316596_1052470 | 3300033541 | Bacteria | 1081 |
| 214 | Ga0316596_1056534 | 3300033541 | Bacteria | 1043 |
| 215 | Ga0316596_1056547 | 3300033541 | Bacteria | 1043 |
| 216 | Ga0316596_1060664 | 3300033541 | Bacteria | 1009 |
| 217 | Ga0316596_1063927 | 3300033541 | Bacteria | 983 |
| 218 | Ga0316596_1078463 | 3300033541 | Bacteria | 887 |
| 219 | Ga0316596_1078866 | 3300033541 | Bacteria | 885 |
| 220 | Ga0316596_1091051 | 3300033541 | Bacteria | 822 |
| 221 | Ga0316596_1095741 | 3300033541 | Bacteria | 801 |
| 222 | Ga0316596_1105827 | 3300033541 | Unclassified | 762 |
| 223 | Ga0316596_1106622 | 3300033541 | Bacteria | 759 |
| 224 | Ga0316596_1121434 | 3300033541 | Bacteria | 711 |
| 225 | Ga0316596_1124675 | 3300033541 | Bacteria | 702 |
| 226 | Ga0316596_1133702 | 3300033541 | Bacteria | 678 |
| 227 | Ga0316574_0004346 | 3300035398 | Bacteria | 7405 |
| 228 | Ga0316574_0028855 | 3300035398 | Bacteria | 3349 |
| 229 | Ga0316574_0054684 | 3300035398 | Bacteria | 2493 |
| 230 | Ga0316574_0135372 | 3300035398 | Bacteria | 1586 |
| 231 | Ga0316574_0203742 | 3300035398 | Bacteria | 1270 |
| 232 | Ga0316574_0214325 | 3300035398 | Bacteria | 1235 |
| 233 | Ga0316574_0388323 | 3300035398 | Bacteria | 880 |
| 234 | Ga0373935_0519569 | 3300035692 | Unclassified | 866 |
| 235 | Ga0373927_0017732 | 3300035695 | Bacteria | 4684 |
| 236 | Ga0316582_0007783 | 3300036647 | Bacteria | 5726 |
| 237 | Ga0316582_0064263 | 3300036647 | Bacteria | 2360 |
| 238 | Ga0316582_0268749 | 3300036647 | Bacteria | 1170 |
| 239 | Ga0316582_0331584 | 3300036647 | Bacteria | 1046 |
| 240 | Ga0316582_0651529 | 3300036647 | Bacteria | 724 |
| 241 | Ga0316584_0001090 | 3300036712 | Bacteria | 15885 |
| 242 | Ga0316584_0001589 | 3300036712 | Bacteria | 13795 |
| 243 | Ga0316584_0008496 | 3300036712 | Bacteria | 7075 |
| 244 | Ga0316584_0021595 | 3300036712 | Bacteria | 4681 |
| 245 | Ga0316584_0064901 | 3300036712 | Bacteria | 2734 |
| 246 | Ga0316584_0294133 | 3300036712 | Bacteria | 1177 |
| 247 | Ga0316584_0822320 | 3300036712 | Unclassified | 630 |
| 248 | Ga0395900_0140409 | 3300037418 | Bacteria | 2474 |
| 249 | Ga0316581_0008931 | 3300037588 | Unclassified | 2742 |
| 250 | Ga0400484_21458 | 3300038725 | Bacteria | 6442 |
| 251 | Ga0400484_38013 | 3300038725 | Bacteria | 2598 |
| 252 | Ga0400484_44737 | 3300038725 | Bacteria | 3223 |
| 253 | Ga0400490_06663 | 3300038726 | Bacteria | 42094 |
| 254 | Ga0400490_14128 | 3300038726 | Bacteria | 1213 |
| 255 | Ga0400491_28268 | 3300038727 | Bacteria | 6828 |
| 256 | Ga0400485_09016 | 3300038735 | Bacteria | 2262 |
| 257 | Ga0400485_14999 | 3300038735 | Bacteria | 12334 |
| 258 | Ga0400488_31421 | 3300038741 | Bacteria | 13433 |
| 259 | Ga0400488_57649 | 3300038741 | Bacteria | 3322 |
| 260 | Ga0400486_08492 | 3300038742 | Bacteria | 14004 |
| 261 | Ga0400486_08727 | 3300038742 | Bacteria | 1775 |
| 262 | Ga0400486_10354 | 3300038742 | Bacteria | 21885 |
| 263 | Ga0400486_20766 | 3300038742 | Bacteria | 91783 |
| 264 | Ga0400489_72819 | 3300039093 | Bacteria | 45511 |
| 265 | Ga0400487_05468 | 3300039110 | Bacteria | 18445 |
| 266 | Ga0400487_31141 | 3300039110 | Bacteria | 6380 |
| 267 | Ga0400487_38817 | 3300039110 | Bacteria | 3156 |
| 268 | Ga0400487_40435 | 3300039110 | Bacteria | 1395 |
| 269 | Ga0439438_014637 | 3300041405 | Bacteria | 2330 |
| 270 | Ga0451807_1858697 | 3300041486 | Bacteria | 1202 |
| 271 | Ga0450891_003174 | 3300042129 | Bacteria | 1602 |
| 272 | Ga0451577_0000009 | 3300042876 | Bacteria | 646744 |
| 273 | Ga0451577_0118250 | 3300042876 | Bacteria | 2374 |
| 274 | Ga0451576_0011513 | 3300045051 | Bacteria | 10042 |
| 275 | Ga0495627_000215 | 3300046453 | Bacteria | 62761 |
| 276 | Ga0495650_0018782 | 3300046471 | Bacteria | 3427 |
| 277 | Ga0495631_0001498 | 3300046518 | Bacteria | 14088 |
| 278 | Ga0495632_0004196 | 3300046519 | Bacteria | 9851 |
| 279 | Ga0495654_0000423 | 3300046530 | Bacteria | 35841 |
| 280 | Ga0495645_0234354 | 3300046543 | Bacteria | 1228 |
| 281 | Ga0495671_0000049 | 3300046692 | Bacteria | 146041 |
| 282 | Ga0495671_0024200 | 3300046692 | Bacteria | 3165 |
| 283 | Ga0495672_0003804 | 3300047320 | Bacteria | 12705 |
| 284 | Ga0495673_0004094 | 3300047469 | Bacteria | 9259 |
| 285 | Ga0496107_0722072 | 3300048910 | Unclassified | 732 |
| 286 | Ga0496108_0085984 | 3300048911 | Bacteria | 2670 |
| 287 | Ga0496109_0157011 | 3300048912 | Bacteria | 2131 |
| 288 | Ga0496110_0201436 | 3300048913 | Unclassified | 1809 |
| 289 | Ga0496112_0352120 | 3300048915 | Bacteria | 1415 |
| 290 | Ga0496113_0953385 | 3300048916 | Unclassified | 677 |
| 291 | Ga0496114_0025896 | 3300048917 | Bacteria | 4798 |
| 292 | Ga0496114_0199888 | 3300048917 | Unclassified | 1750 |
| 293 | Ga0496114_0450636 | 3300048917 | Bacteria | 1140 |
| 294 | Ga0496116_0000019 | 3300048919 | Bacteria | 533227 |
| 295 | Ga0496121_0000018 | 3300048924 | Bacteria | 542045 |
| 296 | Ga0496124_0374293 | 3300048927 | Bacteria | 998 |
| 297 | Ga0496126_0096961 | 3300048929 | Bacteria | 2585 |
| 298 | Ga0501316_021583 | 3300049532 | Bacteria | 815 |
| 299 | Ga0501031_0002498 | 3300049568 | Bacteria | 11718 |
| 300 | Ga0501032_0000936 | 3300049569 | Bacteria | 23616 |
| 301 | Ga0501032_0010256 | 3300049569 | Bacteria | 6759 |
| 302 | Ga0501032_0038720 | 3300049569 | Bacteria | 3245 |
| 303 | Ga0501033_0005384 | 3300049570 | Bacteria | 10139 |
| 304 | Ga0501033_0007175 | 3300049570 | Bacteria | 8695 |
| 305 | Ga0501034_0003514 | 3300049571 | Bacteria | 17785 |
| 306 | Ga0501034_0239771 | 3300049571 | Bacteria | 1760 |
| 307 | Ga0501036_0000887 | 3300049572 | Bacteria | 22368 |
| 308 | Ga0501036_0009776 | 3300049572 | Bacteria | 7898 |
| 309 | Ga0501036_0010301 | 3300049572 | Bacteria | 7712 |
| 310 | Ga0501036_0464079 | 3300049572 | Bacteria | 1054 |
| 311 | Ga0501037_0002031 | 3300049573 | Bacteria | 14661 |
| 312 | Ga0501038_0015765 | 3300049574 | Bacteria | 6868 |
| 313 | Ga0501039_0006959 | 3300049575 | Bacteria | 8609 |
| 314 | Ga0501039_0062540 | 3300049575 | Bacteria | 2884 |
| 315 | Ga0501039_0809191 | 3300049575 | Bacteria | 731 |
| 316 | Ga0501040_0000774 | 3300049576 | Bacteria | 19878 |
| 317 | Ga0501042_0000850 | 3300049578 | Bacteria | 17035 |
| 318 | Ga0501043_0001224 | 3300049579 | Bacteria | 22638 |
| 319 | Ga0501043_0152138 | 3300049579 | Bacteria | 1810 |
| 320 | Ga0501046_0006333 | 3300049580 | Bacteria | 10489 |
| 321 | Ga0501047_0011672 | 3300049581 | Bacteria | 8305 |
| 322 | Ga0501047_0078863 | 3300049581 | Bacteria | 3167 |
| 323 | Ga0501047_0430769 | 3300049581 | Bacteria | 1150 |
| 324 | Ga0501048_0001029 | 3300049582 | Bacteria | 20864 |
| 325 | Ga0501067_0179588 | 3300049583 | Bacteria | 1179 |
| 326 | Ga0501068_0295519 | 3300049584 | Bacteria | 1036 |
| 327 | Ga0501070_0145128 | 3300049586 | Bacteria | 1959 |
| 328 | Ga0501073_0536768 | 3300049589 | Bacteria | 808 |
| 329 | Ga0501230_017907 | 3300049667 | Bacteria | 1204 |
| 330 | Ga0501035_0000450 | 3300049822 | Bacteria | 46029 |
| 331 | Ga0501035_0007138 | 3300049822 | Bacteria | 10446 |
| 332 | Ga0501035_0223876 | 3300049822 | Bacteria | 1605 |
| 333 | Ga0501035_0275340 | 3300049822 | Bacteria | 1423 |
| 334 | Ga0501044_0000068 | 3300049823 | Bacteria | 126642 |
| 335 | Ga0501044_0001278 | 3300049823 | Bacteria | 29733 |
| 336 | Ga0501044_0013125 | 3300049823 | Bacteria | 8968 |
| 337 | Ga0501044_0022715 | 3300049823 | Bacteria | 6679 |
| 338 | Ga0501045_0008825 | 3300049824 | Bacteria | 7042 |
| 339 | nmdc:mga07m45_197797_c1 | 3300050496 | Bacteria | 1169 |
| 340 | nmdc:mga08y16_14116_c1 | 3300050511 | Bacteria | 8410 |
| 341 | nmdc:mga08y16_89501_c1 | 3300050511 | Bacteria | 3208 |
| 342 | Ga0500650_0000029 | 3300053098 | Bacteria | 54937 |
| 343 | Ga0587070_100693 | 3300059491 | Bacteria | 664 |
| 344 | Ga0587088_058014 | 3300059508 | Bacteria | 777 |
| 345 | Ga0587095_014345 | 3300059514 | Bacteria | 708 |
| 346 | Ga0587101_055615 | 3300059623 | Bacteria | 693 |
| 347 | Ga0587117_035471 | 3300059627 | Bacteria | 772 |
| 348 | Ga0587068_064990 | 3300059641 | Bacteria | 709 |
| 349 | Ga0587118_10765 | 3300059657 | Bacteria | 700 |
| 350 | 646814971 | 646564506 | Bacteria | 3192235 |
| 351 | Ga0400485_10388 | |||
| 352 | Ga0006765J45826_105711 | |||
| 353 | rootH2_10216387 | |||
| 354 | rootH1_10068586 | |||
| 355 | Ga0007416J51690_1020935 | |||
| 356 | Ga0058859_11486287 | |||
| 357 | Ga0058863_11749218 | |||
| 358 | Ga0058861_12054889 | |||
| 359 | Ga0058862_10287046 | |||
| 360 | Ga0070670_100000054 | |||
| 361 | Ga0070666_10007111 | |||
| 362 | Ga0070660_100222795 | |||
| 363 | Ga0070671_100000037 | |||
| 364 | Ga0070659_100044039 | |||
| 365 | Ga0070659_101012940 | |||
| 366 | Ga0070667_100000002 | |||
| 367 | Ga0070663_100350351 | |||
| 368 | Ga0070662_100011738 | |||
| 369 | Ga0070685_10000014 | |||
| 370 | Ga0070697_100127195 | |||
| 371 | Ga0068853_100311556 | |||
| 372 | Ga0068853_100490173 | |||
| 373 | Ga0068853_100692919 | |||
| 374 | Ga0068853_100844484 | |||
| 375 | Ga0070665_100083984 | |||
| 376 | Ga0068855_100054524 | |||
| 377 | Ga0068855_100263496 | |||
| 378 | Ga0068855_101266846 | |||
| 379 | Ga0068856_100553392 | |||
| 380 | Ga0068859_100312761 | |||
| 381 | Ga0068859_100414387 | |||
| 382 | Ga0068864_100000002 | |||
| 383 | Ga0068858_100020409 | |||
| 384 | Ga0068858_100048969 | |||
| 385 | Ga0068860_100003644 | |||
| 386 | Ga0068862_100001634 | |||
| 387 | Ga0075365_10043363 | |||
| 388 | Ga0075370_10311887 | |||
| 389 | Ga0097620_100312778 | |||
| 390 | Ga0097620_100414381 | |||
| 391 | Ga0079104_1007462 | |||
| 392 | Ga0105251_10134134 | |||
| 393 | Ga0105250_10000366 | |||
| 394 | Ga0105240_10707310 | |||
| 395 | Ga0111539_10011868 | |||
| 396 | Ga0111539_10069969 | |||
| 397 | Ga0105247_10029681 | |||
| 398 | Ga0105241_10943109 | |||
| 399 | Ga0105248_10078878 | |||
| 400 | Ga0105239_10006575 | |||
| 401 | Ga0105246_10183471 | |||
| 402 | Ga0157373_10657254 | |||
| 403 | Ga0157370_10007849 | |||
| 404 | Ga0157369_10749542 | |||
| 405 | Ga0157374_10148358 | |||
| 406 | Ga0157372_10576581 | |||
| 407 | Ga0157375_11139869 | |||
| 408 | Ga0163163_10000687 | |||
| 409 | Ga0182008_10020496 | |||
| 410 | Ga0157376_10116552 | |||
| 411 | Ga0206356_10861666 | |||
| 412 | Ga0206350_11281916 | |||
| 413 | Ga0213872_10010730 | |||
| 414 | Ga0209256_1018088 | |||
| 415 | Ga0207696_1000138 | |||
| 416 | Ga0207713_1000080 | |||
| 417 | Ga0207710_10107903 | |||
| 418 | Ga0207680_10020739 | |||
| 419 | Ga0207654_10637256 | |||
| 420 | Ga0207650_10000002 | |||
| 421 | Ga0207644_10000114 | |||
| 422 | Ga0207690_10092185 | |||
| 423 | Ga0207706_10057230 | |||
| 424 | Ga0207711_10000540 | |||
| 425 | Ga0207667_10673351 | |||
| 426 | Ga0207658_10000001 | |||
| 427 | Ga0207703_10015908 | |||
| 428 | Ga0207639_10332124 | |||
| 429 | Ga0207639_10628665 | |||
| 430 | Ga0207639_10694082 | |||
| 431 | Ga0207678_10085703 | |||
| 432 | Ga0207641_10274328 | |||
| 433 | Ga0207676_10000001 | |||
| 434 | Ga0207683_10487011 | |||
| 435 | Ga0209974_10028776 | |||
| 436 | Ga0207428_10074424 | |||
| 437 | Ga0207428_10185163 | |||
| 438 | Ga0268266_10006302 | |||
| 439 | Ga0268265_10001809 | |||
| 440 | Ga0268264_10000004 | |||
| 441 | Ga0265327_10001210 | |||
| 442 | Ga0307408_100000249 | |||
| 443 | Ga0307408_100001646 | |||
| 444 | Ga0316575_10000158 | |||
| 445 | Ga0316575_10008091 | |||
| 446 | Ga0316575_10036253 | |||
| 447 | Ga0316575_10069633 | |||
| 448 | Ga0316575_10104981 | |||
| 449 | Ga0316579_10011152 | |||
| 450 | Ga0316579_10146898 | |||
| 451 | Ga0316576_10015565 | |||
| 452 | Ga0316576_10076833 | |||
| 453 | Ga0316576_10084184 | |||
| 454 | Ga0316576_10171309 | |||
| 455 | Ga0316576_10258267 | |||
| 456 | Ga0316576_10282213 | |||
| 457 | Ga0316578_10000169 | |||
| 458 | Ga0316578_10000642 | |||
| 459 | Ga0316578_10022371 | |||
| 460 | Ga0316578_10068499 | |||
| 461 | Ga0316578_10269885 | |||
| 462 | Ga0316577_10003912 | |||
| 463 | Ga0316577_10004013 | |||
| 464 | Ga0316577_10032116 | |||
| 465 | Ga0316577_10036785 | |||
| 466 | Ga0316577_10192263 | |||
| 467 | Ga0316577_10434955 | |||
| 468 | Ga0307406_10007017 | |||
| 469 | Ga0307406_10164375 | |||
| 470 | Ga0316583_10000694 | |||
| 471 | Ga0316583_10003212 | |||
| 472 | Ga0316583_10013893 | |||
| 473 | Ga0316583_10014972 | |||
| 474 | Ga0316583_10029747 | |||
| 475 | Ga0316583_10056282 | |||
| 476 | Ga0316583_10088512 | |||
| 477 | Ga0316585_10002594 | |||
| 478 | Ga0316585_10006923 | |||
| 479 | Ga0316585_10010488 | |||
| 480 | Ga0316585_10034620 | |||
| 481 | Ga0316585_10038554 | |||
| 482 | Ga0316585_10120804 | |||
| 483 | Ga0316580_10001207 | |||
| 484 | Ga0316580_10034632 | |||
| 485 | Ga0316580_10072218 | |||
| 486 | Ga0316593_10003738 | |||
| 487 | Ga0316593_10017944 | |||
| 488 | Ga0316593_10034453 | |||
| 489 | Ga0316593_10036011 | |||
| 490 | Ga0316593_10036151 | |||
| 491 | Ga0316593_10040909 | |||
| 492 | Ga0316593_10079259 | |||
| 493 | Ga0316593_10092536 | |||
| 494 | Ga0316593_10153477 | |||
| 495 | Ga0316593_10170156 | |||
| 496 | Ga0316593_10182700 | |||
| 497 | Ga0316593_10182715 | |||
| 498 | Ga0316593_10183093 | |||
| 499 | Ga0316593_10185516 | |||
| 500 | Ga0316593_10187854 | |||
| 501 | Ga0316593_10189202 | |||
| 502 | Ga0316593_10223453 | |||
| 503 | Ga0316593_10239661 | |||
| 504 | Ga0316593_10244667 | |||
| 505 | Ga0316593_10265980 | |||
| 506 | Ga0316592_1005394 | |||
| 507 | Ga0316592_1019756 | |||
| 508 | Ga0316592_1025755 | |||
| 509 | Ga0316592_1029722 | |||
| 510 | Ga0316592_1030791 | |||
| 511 | Ga0316592_1063216 | |||
| 512 | Ga0316592_1067643 | |||
| 513 | Ga0316592_1072335 | |||
| 514 | Ga0316592_1091738 | |||
| 515 | Ga0316592_1104816 | |||
| 516 | Ga0316586_1016425 | |||
| 517 | Ga0316586_1020214 | |||
| 518 | Ga0316586_1022584 | |||
| 519 | Ga0316586_1026882 | |||
| 520 | Ga0316586_1028044 | |||
| 521 | Ga0316586_1032356 | |||
| 522 | Ga0316586_1033195 | |||
| 523 | Ga0316586_1035330 | |||
| 524 | Ga0316586_1036362 | |||
| 525 | Ga0316586_1041615 | |||
| 526 | Ga0316586_1044005 | |||
| 527 | Ga0316588_1013017 | |||
| 528 | Ga0316588_1025247 | |||
| 529 | Ga0316588_1028955 | |||
| 530 | Ga0316588_1029744 | |||
| 531 | Ga0316588_1032944 | |||
| 532 | Ga0316588_1037051 | |||
| 533 | Ga0316588_1040516 | |||
| 534 | Ga0316588_1047586 | |||
| 535 | Ga0316588_1057837 | |||
| 536 | Ga0316588_1064851 | |||
| 537 | Ga0316588_1090269 | |||
| 538 | Ga0316588_1104088 | |||
| 539 | Ga0316588_1104459 | |||
| 540 | Ga0316588_1113783 | |||
| 541 | Ga0316587_1017464 | |||
| 542 | Ga0316587_1019972 | |||
| 543 | Ga0316587_1022193 | |||
| 544 | Ga0316587_1026567 | |||
| 545 | Ga0316587_1030010 | |||
| 546 | Ga0316587_1032448 | |||
| 547 | Ga0316587_1041025 | |||
| 548 | Ga0316587_1044648 | |||
| 549 | Ga0316587_1048310 | |||
| 550 | Ga0316587_1048639 | |||
| 551 | Ga0316587_1051148 | |||
| 552 | Ga0316587_1054376 | |||
| 553 | Ga0316587_1059248 | |||
| 554 | Ga0316587_1070147 | |||
| 555 | Ga0316596_1006806 | |||
| 556 | Ga0316596_1016016 | |||
| 557 | Ga0316596_1022294 | |||
| 558 | Ga0316596_1024029 | |||
| 559 | Ga0316596_1024341 | |||
| 560 | Ga0316596_1028052 | |||
| 561 | Ga0316596_1039798 | |||
| 562 | Ga0316596_1050034 | |||
| 563 | Ga0316596_1052470 | |||
| 564 | Ga0316596_1056534 | |||
| 565 | Ga0316596_1056547 | |||
| 566 | Ga0316596_1060664 | |||
| 567 | Ga0316596_1063927 | |||
| 568 | Ga0316596_1078463 | |||
| 569 | Ga0316596_1078866 | |||
| 570 | Ga0316596_1091051 | |||
| 571 | Ga0316596_1095741 | |||
| 572 | Ga0316596_1105827 | |||
| 573 | Ga0316596_1106622 | |||
| 574 | Ga0316596_1121434 | |||
| 575 | Ga0316596_1124675 | |||
| 576 | Ga0316596_1133702 | |||
| 577 | Ga0316574_0004346 | |||
| 578 | Ga0316574_0028855 | |||
| 579 | Ga0316574_0054684 | |||
| 580 | Ga0316574_0135372 | |||
| 581 | Ga0316574_0203742 | |||
| 582 | Ga0316574_0214325 | |||
| 583 | Ga0316574_0388323 | |||
| 584 | Ga0373935_0519569 | |||
| 585 | Ga0373927_0017732 | |||
| 586 | Ga0316582_0007783 | |||
| 587 | Ga0316582_0064263 | |||
| 588 | Ga0316582_0268749 | |||
| 589 | Ga0316582_0331584 | |||
| 590 | Ga0316582_0651529 | |||
| 591 | Ga0316584_0001090 | |||
| 592 | Ga0316584_0001589 | |||
| 593 | Ga0316584_0008496 | |||
| 594 | Ga0316584_0021595 | |||
| 595 | Ga0316584_0064901 | |||
| 596 | Ga0316584_0294133 | |||
| 597 | Ga0316584_0822320 | |||
| 598 | Ga0395900_0140409 | |||
| 599 | Ga0316581_0008931 | |||
| 600 | Ga0400484_21458 | |||
| 601 | Ga0400484_38013 | |||
| 602 | Ga0400484_44737 | |||
| 603 | Ga0400490_06663 | |||
| 604 | Ga0400490_14128 | |||
| 605 | Ga0400491_28268 | |||
| 606 | Ga0400485_09016 | |||
| 607 | Ga0400485_14999 | |||
| 608 | Ga0400488_31421 | |||
| 609 | Ga0400488_57649 | |||
| 610 | Ga0400486_08492 | |||
| 611 | Ga0400486_08727 | |||
| 612 | Ga0400486_10354 | |||
| 613 | Ga0400486_20766 | |||
| 614 | Ga0400489_72819 | |||
| 615 | Ga0400487_05468 | |||
| 616 | Ga0400487_31141 | |||
| 617 | Ga0400487_38817 | |||
| 618 | Ga0400487_40435 | |||
| 619 | Ga0439438_014637 | |||
| 620 | Ga0451807_1858697 | |||
| 621 | Ga0450891_003174 | |||
| 622 | Ga0451577_0000009 | |||
| 623 | Ga0451577_0118250 | |||
| 624 | Ga0451576_0011513 | |||
| 625 | Ga0495627_000215 | |||
| 626 | Ga0495650_0018782 | |||
| 627 | Ga0495631_0001498 | |||
| 628 | Ga0495632_0004196 | |||
| 629 | Ga0495654_0000423 | |||
| 630 | Ga0495645_0234354 | |||
| 631 | Ga0495671_0000049 | |||
| 632 | Ga0495671_0024200 | |||
| 633 | Ga0495672_0003804 | |||
| 634 | Ga0495673_0004094 | |||
| 635 | Ga0496107_0722072 | |||
| 636 | Ga0496108_0085984 | |||
| 637 | Ga0496109_0157011 | |||
| 638 | Ga0496110_0201436 | |||
| 639 | Ga0496112_0352120 | |||
| 640 | Ga0496113_0953385 | |||
| 641 | Ga0496114_0025896 | |||
| 642 | Ga0496114_0199888 | |||
| 643 | Ga0496114_0450636 | |||
| 644 | Ga0496116_0000019 | |||
| 645 | Ga0496121_0000018 | |||
| 646 | Ga0496124_0374293 | |||
| 647 | Ga0496126_0096961 | |||
| 648 | Ga0501316_021583 | |||
| 649 | Ga0501031_0002498 | |||
| 650 | Ga0501032_0000936 | |||
| 651 | Ga0501032_0010256 | |||
| 652 | Ga0501032_0038720 | |||
| 653 | Ga0501033_0005384 | |||
| 654 | Ga0501033_0007175 | |||
| 655 | Ga0501034_0003514 | |||
| 656 | Ga0501034_0239771 | |||
| 657 | Ga0501036_0000887 | |||
| 658 | Ga0501036_0009776 | |||
| 659 | Ga0501036_0010301 | |||
| 660 | Ga0501036_0464079 | |||
| 661 | Ga0501037_0002031 | |||
| 662 | Ga0501038_0015765 | |||
| 663 | Ga0501039_0006959 | |||
| 664 | Ga0501039_0062540 | |||
| 665 | Ga0501039_0809191 | |||
| 666 | Ga0501040_0000774 | |||
| 667 | Ga0501042_0000850 | |||
| 668 | Ga0501043_0001224 | |||
| 669 | Ga0501043_0152138 | |||
| 670 | Ga0501046_0006333 | |||
| 671 | Ga0501047_0011672 | |||
| 672 | Ga0501047_0078863 | |||
| 673 | Ga0501047_0430769 | |||
| 674 | Ga0501048_0001029 | |||
| 675 | Ga0501067_0179588 | |||
| 676 | Ga0501068_0295519 | |||
| 677 | Ga0501070_0145128 | |||
| 678 | Ga0501073_0536768 | |||
| 679 | Ga0501230_017907 | |||
| 680 | Ga0501035_0000450 | |||
| 681 | Ga0501035_0007138 | |||
| 682 | Ga0501035_0223876 | |||
| 683 | Ga0501035_0275340 | |||
| 684 | Ga0501044_0000068 | |||
| 685 | Ga0501044_0001278 | |||
| 686 | Ga0501044_0013125 | |||
| 687 | Ga0501044_0022715 | |||
| 688 | Ga0501045_0008825 | |||
| 689 | nmdc:mga07m45_197797_c1 | |||
| 690 | nmdc:mga08y16_14116_c1 | |||
| 691 | nmdc:mga08y16_89501_c1 | |||
| 692 | Ga0500650_0000029 | |||
| 693 | Ga0587070_100693 | |||
| 694 | Ga0587088_058014 | |||
| 695 | Ga0587095_014345 | |||
| 696 | Ga0587101_055615 | |||
| 697 | Ga0587117_035471 | |||
| 698 | Ga0587068_064990 | |||
| 699 | Ga0587118_10765 | |||
| 700 | 646814971 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tue-assembly1.cif.gz_A | the structure of tryparedoxin peroxidase i from leishmania major | 0.9587 | 5 | 167 |
| 6j13-assembly2.cif.gz_H | redox protein from chlamydomonas reinhardtii | 0.9581 | 2 | 167 |
| 1e2y-assembly1.cif.gz_F | tryparedoxin peroxidase from crithidia fasciculata | 0.9549 | 5 | 163 |
| 7e4u-assembly4.cif.gz_H | crystal structure of peroxiredoxin-1 | 0.9538 | 5 | 173 |
| 2c0d-assembly1.cif.gz_A | structure of the mitochondrial 2-cys peroxiredoxin from plasmodium falciparum | 0.9527 | 4 | 172 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2c0dA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9527 | 4 | 172 | 3.40.30.10 |
| 5ijtA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9483 | 5 | 164 | 3.40.30.10 |
| 2c0dA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9472 | 4 | 172 | 3.40.30.10 |
| af_Q8I5Q6_15_214_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9421 | 1 | 200 | 3.40.30.10 |
| af_A0A0R4J2P7_61_260_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.933 | 2 | 195 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N6X8E0-F1-model_v4 | deleted | 0.9795 | 2 | 168 |
|
| AF-A0A0N1DAZ8-F1-model_v4 | Alkyl hydroperoxide reductase | 0.9783 | 1 | 200 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A0R2ZTX2-F1-model_v4 | Alkyl hydroperoxide reductase | 0.978 | 1 | 200 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A1F3B131-F1-model_v4 | Alkyl hydroperoxide reductase | 0.9778 | 2 | 157 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A7T7X180-F1-model_v4 | deleted | 0.9775 | 1 | 200 |
|