F418360
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 350 | 194 | 700 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300046507|Ga0495606_0025024|Ga0495606_0025024_201_857 |
| Length | 218 |
| Sequence | MSYGFTGKNSIFTLIKAGLPFQCAPYRARHFKIDTYMKIYTKTGDKGYTSLIGGTRVPKHHLRIESYGTVDELNSYIGLIRDQDITAHDKELLKQIQDRLFTIGSSLAADPEKSKMIIPDLHMADVELLEQEMDTMNEQLPELRHFILPGGSNTISFCHIARCICRRAERLTVNLAQESTVDEKVNIYLNRLSDYLFTLGRKVANERNIPENQWIPRI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 34 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 37 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 38 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 39 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 59 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 62 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 100 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 101 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 102 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 104 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 105 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 106 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 107 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 108 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 109 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 110 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 111 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 112 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 113 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 114 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 115 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 116 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 117 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 118 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 119 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 120 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 121 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 122 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 123 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 124 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 125 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 126 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 127 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 128 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 129 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 130 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 131 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 132 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 133 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 134 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 160 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 161 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 162 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 167 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 170 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 171 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 172 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 173 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 174 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 175 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 176 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 177 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 178 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 179 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 180 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 181 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 182 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 183 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 184 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 185 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 186 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 187 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 188 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 189 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 190 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 191 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 192 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 193 | 8036736890 | Flavobacterium dauae TCH3-2 | Isolate | Rhizosphere |
| 194 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.14 |
| Metatranscriptomes | 0 |
| Isolates | 4.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.14 |
| Nodule | 0 |
| Rhizoplane | 0.86 |
| Rhizosphere | 85.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495606_0025024 | 3300046507 | Bacteria | 4285 |
| 2 | JGI24736J21556_1005764 | 3300001904 | Bacteria | 2092 |
| 3 | JGI24740J21852_10037081 | 3300001979 | Bacteria | 1509 |
| 4 | JGI24743J22301_10013148 | 3300001991 | Bacteria | 1514 |
| 5 | JGI25162J39368_1000089 | 3300002737 | Bacteria | 104054 |
| 6 | JGI25162J39368_1000498 | 3300002737 | Bacteria | 29793 |
| 7 | JGI25165J46597_1000618 | 3300003214 | Bacteria | 30063 |
| 8 | JGI25165J46597_1033471 | 3300003214 | Bacteria | 662 |
| 9 | rootH2_10018591 | 3300003320 | Bacteria | 30571 |
| 10 | rootH2_10095836 | 3300003320 | Bacteria | 1051 |
| 11 | rootH1_10017540 | 3300003323 | Bacteria | 39177 |
| 12 | rootH1_10093143 | 3300003323 | Bacteria | 4723 |
| 13 | rootH1_10100036 | 3300003323 | Bacteria | 1021 |
| 14 | rootH1_10286877 | 3300003323 | Bacteria | 3332 |
| 15 | Ga0065714_10011084 | 3300005288 | Bacteria | 1998 |
| 16 | Ga0065714_10079220 | 3300005288 | Bacteria | 2534 |
| 17 | Ga0065714_10115562 | 3300005288 | Bacteria | 1411 |
| 18 | Ga0065714_10184441 | 3300005288 | Bacteria | 950 |
| 19 | Ga0065715_10365105 | 3300005293 | Bacteria | 929 |
| 20 | Ga0070658_10000018 | 3300005327 | Bacteria | 200558 |
| 21 | Ga0070658_10099802 | 3300005327 | Bacteria | 2399 |
| 22 | Ga0070658_10133225 | 3300005327 | Bacteria | 2072 |
| 23 | Ga0070676_10000642 | 3300005328 | Bacteria | 17019 |
| 24 | Ga0070683_100035829 | 3300005329 | Bacteria | 4537 |
| 25 | Ga0068869_100106693 | 3300005334 | Bacteria | 2126 |
| 26 | Ga0068868_100013908 | 3300005338 | Bacteria | 5917 |
| 27 | Ga0068868_100027571 | 3300005338 | Bacteria | 4333 |
| 28 | Ga0070660_100031635 | 3300005339 | Bacteria | 3975 |
| 29 | Ga0070660_100054015 | 3300005339 | Bacteria | 3100 |
| 30 | Ga0070660_100166420 | 3300005339 | Bacteria | 1779 |
| 31 | Ga0070660_100374280 | 3300005339 | Bacteria | 1175 |
| 32 | Ga0070671_100023057 | 3300005355 | Bacteria | 5088 |
| 33 | Ga0070674_100055726 | 3300005356 | Bacteria | 2739 |
| 34 | Ga0070673_100271414 | 3300005364 | Bacteria | 1485 |
| 35 | Ga0070659_100000292 | 3300005366 | Bacteria | 39270 |
| 36 | Ga0070659_100066937 | 3300005366 | Bacteria | 2848 |
| 37 | Ga0070710_10664268 | 3300005437 | Unclassified | 732 |
| 38 | Ga0070678_100018207 | 3300005456 | Bacteria | 4549 |
| 39 | Ga0070662_100000626 | 3300005457 | Bacteria | 21383 |
| 40 | Ga0070662_100149288 | 3300005457 | Bacteria | 1818 |
| 41 | Ga0070681_10022542 | 3300005458 | Bacteria | 6324 |
| 42 | Ga0070679_100155987 | 3300005530 | Bacteria | 2258 |
| 43 | Ga0070679_100413028 | 3300005530 | Bacteria | 1295 |
| 44 | Ga0068853_100101143 | 3300005539 | Bacteria | 2549 |
| 45 | Ga0068853_100191308 | 3300005539 | Bacteria | 1859 |
| 46 | Ga0068855_100000070 | 3300005563 | Bacteria | 123584 |
| 47 | Ga0068855_100000268 | 3300005563 | Bacteria | 64693 |
| 48 | Ga0068855_100037071 | 3300005563 | Bacteria | 5801 |
| 49 | Ga0068855_100704975 | 3300005563 | Bacteria | 1080 |
| 50 | Ga0068855_100727213 | 3300005563 | Bacteria | 1060 |
| 51 | Ga0068855_101293569 | 3300005563 | Unclassified | 755 |
| 52 | Ga0068857_100036027 | 3300005577 | Bacteria | 4384 |
| 53 | Ga0068856_100000899 | 3300005614 | Bacteria | 31842 |
| 54 | Ga0068856_100009016 | 3300005614 | Bacteria | 9706 |
| 55 | Ga0068856_100068505 | 3300005614 | Bacteria | 3508 |
| 56 | Ga0068856_100113651 | 3300005614 | Bacteria | 2706 |
| 57 | Ga0068852_100019512 | 3300005616 | Bacteria | 5368 |
| 58 | Ga0068852_100097079 | 3300005616 | Bacteria | 2650 |
| 59 | Ga0068852_100323590 | 3300005616 | Bacteria | 1498 |
| 60 | Ga0068852_100778098 | 3300005616 | Bacteria | 970 |
| 61 | Ga0068851_10419390 | 3300005834 | Bacteria | 790 |
| 62 | Ga0068858_100181062 | 3300005842 | Bacteria | 1990 |
| 63 | Ga0081539_10010598 | 3300005985 | Bacteria | 7447 |
| 64 | Ga0075366_10001061 | 3300006195 | Bacteria | 13486 |
| 65 | Ga0097621_100000878 | 3300006237 | Bacteria | 21148 |
| 66 | Ga0068871_100006906 | 3300006358 | Bacteria | 8084 |
| 67 | Ga0075428_100010944 | 3300006844 | Bacteria | 10087 |
| 68 | Ga0075430_100334530 | 3300006846 | Bacteria | 1251 |
| 69 | Ga0068865_100000127 | 3300006881 | Bacteria | 39327 |
| 70 | Ga0105240_10008851 | 3300009093 | Bacteria | 14336 |
| 71 | Ga0105240_10059080 | 3300009093 | Bacteria | 4787 |
| 72 | Ga0105240_10082406 | 3300009093 | Bacteria | 3951 |
| 73 | Ga0105240_10198436 | 3300009093 | Bacteria | 2353 |
| 74 | Ga0105240_10249747 | 3300009093 | Bacteria | 2052 |
| 75 | Ga0105240_10266263 | 3300009093 | Bacteria | 1975 |
| 76 | Ga0105240_10456752 | 3300009093 | Bacteria | 1428 |
| 77 | Ga0111539_10003202 | 3300009094 | Bacteria | 21659 |
| 78 | Ga0105245_10115881 | 3300009098 | Bacteria | 2498 |
| 79 | Ga0105241_10014160 | 3300009174 | Bacteria | 5844 |
| 80 | Ga0105241_10016950 | 3300009174 | Bacteria | 5347 |
| 81 | Ga0105241_10019885 | 3300009174 | Bacteria | 4956 |
| 82 | Ga0105241_10047248 | 3300009174 | Bacteria | 3273 |
| 83 | Ga0105241_10052774 | 3300009174 | Bacteria | 3106 |
| 84 | Ga0105241_10205178 | 3300009174 | Bacteria | 1649 |
| 85 | Ga0105242_10060938 | 3300009176 | Bacteria | 3102 |
| 86 | Ga0105237_10000224 | 3300009545 | Bacteria | 79854 |
| 87 | Ga0105237_10000485 | 3300009545 | Bacteria | 56664 |
| 88 | Ga0105237_10001308 | 3300009545 | Bacteria | 33108 |
| 89 | Ga0105237_10007484 | 3300009545 | Bacteria | 11941 |
| 90 | Ga0105237_10129481 | 3300009545 | Bacteria | 2518 |
| 91 | Ga0105237_10712787 | 3300009545 | Bacteria | 1010 |
| 92 | Ga0105237_11226451 | 3300009545 | Bacteria | 757 |
| 93 | Ga0105238_10105636 | 3300009551 | Unclassified | 2798 |
| 94 | Ga0105238_10124027 | 3300009551 | Bacteria | 2562 |
| 95 | Ga0105238_11221178 | 3300009551 | Bacteria | 776 |
| 96 | Ga0105239_10000039 | 3300010375 | Bacteria | 203537 |
| 97 | Ga0105239_10000120 | 3300010375 | Bacteria | 110003 |
| 98 | Ga0105239_10000987 | 3300010375 | Bacteria | 39852 |
| 99 | Ga0105239_10005560 | 3300010375 | Bacteria | 14739 |
| 100 | Ga0105239_10012917 | 3300010375 | Bacteria | 9289 |
| 101 | Ga0105239_10013753 | 3300010375 | Bacteria | 8983 |
| 102 | Ga0105239_10023687 | 3300010375 | Bacteria | 6759 |
| 103 | Ga0105239_10068194 | 3300010375 | Bacteria | 3909 |
| 104 | Ga0105239_10118182 | 3300010375 | Bacteria | 2942 |
| 105 | Ga0105239_10202029 | 3300010375 | Bacteria | 2226 |
| 106 | Ga0105239_10458729 | 3300010375 | Bacteria | 1446 |
| 107 | Ga0105239_10744941 | 3300010375 | Bacteria | 1121 |
| 108 | Ga0105246_10043748 | 3300011119 | Bacteria | 3040 |
| 109 | Ga0105246_10823269 | 3300011119 | Bacteria | 826 |
| 110 | Ga0157373_10000205 | 3300013100 | Bacteria | 48796 |
| 111 | Ga0157373_10003515 | 3300013100 | Bacteria | 11847 |
| 112 | Ga0157373_10043334 | 3300013100 | Bacteria | 3214 |
| 113 | Ga0157371_10000263 | 3300013102 | Bacteria | 71557 |
| 114 | Ga0157371_10005281 | 3300013102 | Bacteria | 10945 |
| 115 | Ga0157370_10000449 | 3300013104 | Bacteria | 51431 |
| 116 | Ga0157370_10044499 | 3300013104 | Bacteria | 4266 |
| 117 | Ga0157370_10074075 | 3300013104 | Bacteria | 3212 |
| 118 | Ga0157370_10556733 | 3300013104 | Bacteria | 1051 |
| 119 | Ga0157369_10014846 | 3300013105 | Bacteria | 8790 |
| 120 | Ga0157369_10142078 | 3300013105 | Bacteria | 2540 |
| 121 | Ga0157369_10733280 | 3300013105 | Unclassified | 1017 |
| 122 | Ga0157374_10001845 | 3300013296 | Bacteria | 17834 |
| 123 | Ga0157374_10009022 | 3300013296 | Bacteria | 8552 |
| 124 | Ga0157374_10044113 | 3300013296 | Bacteria | 4121 |
| 125 | Ga0157374_10068545 | 3300013296 | Bacteria | 3338 |
| 126 | Ga0157374_10159603 | 3300013296 | Bacteria | 2196 |
| 127 | Ga0157374_10336959 | 3300013296 | Bacteria | 1497 |
| 128 | Ga0157374_10345164 | 3300013296 | Bacteria | 1478 |
| 129 | Ga0157374_10802699 | 3300013296 | Bacteria | 957 |
| 130 | Ga0157374_11171013 | 3300013296 | Bacteria | 790 |
| 131 | Ga0157378_10012553 | 3300013297 | Bacteria | 7415 |
| 132 | Ga0163162_10000010 | 3300013306 | Bacteria | 302032 |
| 133 | Ga0163162_10030319 | 3300013306 | Bacteria | 5359 |
| 134 | Ga0163162_10213876 | 3300013306 | Bacteria | 2058 |
| 135 | Ga0163162_10249542 | 3300013306 | Bacteria | 1906 |
| 136 | Ga0163162_10641863 | 3300013306 | Bacteria | 1186 |
| 137 | Ga0163162_10806739 | 3300013306 | Bacteria | 1056 |
| 138 | Ga0157372_10000050 | 3300013307 | Bacteria | 140381 |
| 139 | Ga0157372_10000635 | 3300013307 | Bacteria | 38523 |
| 140 | Ga0157372_10002192 | 3300013307 | Bacteria | 21241 |
| 141 | Ga0157372_10052596 | 3300013307 | Bacteria | 4536 |
| 142 | Ga0157375_10005903 | 3300013308 | Bacteria | 10672 |
| 143 | Ga0157375_10126604 | 3300013308 | Bacteria | 2669 |
| 144 | Ga0157375_11384892 | 3300013308 | Bacteria | 828 |
| 145 | Ga0182008_10088827 | 3300014497 | Bacteria | 1523 |
| 146 | Ga0157377_10006123 | 3300014745 | Bacteria | 5711 |
| 147 | Ga0163161_10014162 | 3300017792 | Bacteria | 5553 |
| 148 | Ga0163161_10043434 | 3300017792 | Bacteria | 3236 |
| 149 | Ga0163161_10068723 | 3300017792 | Bacteria | 2589 |
| 150 | Ga0163161_10132627 | 3300017792 | Bacteria | 1881 |
| 151 | Ga0213872_10006890 | 3300021361 | Bacteria | 5656 |
| 152 | Ga0209563_107363 | 3300025230 | Bacteria | 1814 |
| 153 | Ga0207427_100359 | 3300025231 | Bacteria | 28547 |
| 154 | Ga0209437_100034 | 3300025233 | Bacteria | 494007 |
| 155 | Ga0209437_100221 | 3300025233 | Bacteria | 104135 |
| 156 | Ga0209026_1000739 | 3300025250 | Bacteria | 18792 |
| 157 | Ga0209026_1003634 | 3300025250 | Bacteria | 4952 |
| 158 | Ga0209129_1011462 | 3300025258 | Bacteria | 2115 |
| 159 | Ga0209233_1000038 | 3300025261 | Bacteria | 548972 |
| 160 | Ga0209233_1005850 | 3300025261 | Bacteria | 4037 |
| 161 | Ga0209233_1006383 | 3300025261 | Bacteria | 3806 |
| 162 | Ga0209455_1000861 | 3300025272 | Bacteria | 16150 |
| 163 | Ga0207647_10000076 | 3300025904 | Bacteria | 75824 |
| 164 | Ga0207647_10012704 | 3300025904 | Bacteria | 5852 |
| 165 | Ga0207645_10018663 | 3300025907 | Bacteria | 4557 |
| 166 | Ga0207705_10000036 | 3300025909 | Bacteria | 200787 |
| 167 | Ga0207705_10094626 | 3300025909 | Bacteria | 2191 |
| 168 | Ga0207654_10003136 | 3300025911 | Bacteria | 8363 |
| 169 | Ga0207654_10007603 | 3300025911 | Bacteria | 5463 |
| 170 | Ga0207654_10015094 | 3300025911 | Bacteria | 4000 |
| 171 | Ga0207654_10293743 | 3300025911 | Bacteria | 1103 |
| 172 | Ga0207695_10000916 | 3300025913 | Bacteria | 52837 |
| 173 | Ga0207695_10004656 | 3300025913 | Bacteria | 18589 |
| 174 | Ga0207695_10065391 | 3300025913 | Bacteria | 3739 |
| 175 | Ga0207695_10087055 | 3300025913 | Bacteria | 3148 |
| 176 | Ga0207695_10489661 | 3300025913 | Bacteria | 1112 |
| 177 | Ga0207695_10511617 | 3300025913 | Bacteria | 1082 |
| 178 | Ga0207671_10002624 | 3300025914 | Bacteria | 18962 |
| 179 | Ga0207671_10006239 | 3300025914 | Bacteria | 10682 |
| 180 | Ga0207671_10008271 | 3300025914 | Bacteria | 8849 |
| 181 | Ga0207671_10040826 | 3300025914 | Bacteria | 3434 |
| 182 | Ga0207671_10106479 | 3300025914 | Bacteria | 2129 |
| 183 | Ga0207671_10219246 | 3300025914 | Bacteria | 1490 |
| 184 | Ga0207660_10194388 | 3300025917 | Bacteria | 1582 |
| 185 | Ga0207657_10020956 | 3300025919 | Bacteria | 6166 |
| 186 | Ga0207657_10333491 | 3300025919 | Bacteria | 1198 |
| 187 | Ga0207657_10373791 | 3300025919 | Bacteria | 1123 |
| 188 | Ga0207652_10034681 | 3300025921 | Bacteria | 4254 |
| 189 | Ga0207694_10769530 | 3300025924 | Bacteria | 813 |
| 190 | Ga0207694_10828652 | 3300025924 | Bacteria | 782 |
| 191 | Ga0207687_10226983 | 3300025927 | Bacteria | 1473 |
| 192 | Ga0207644_10015452 | 3300025931 | Bacteria | 5124 |
| 193 | Ga0207690_10000311 | 3300025932 | Bacteria | 33041 |
| 194 | Ga0207690_10003941 | 3300025932 | Bacteria | 8778 |
| 195 | Ga0207706_10006487 | 3300025933 | Bacteria | 10861 |
| 196 | Ga0207686_10100625 | 3300025934 | Bacteria | 1929 |
| 197 | Ga0207669_10422711 | 3300025937 | Bacteria | 1049 |
| 198 | Ga0207704_10000044 | 3300025938 | Bacteria | 86753 |
| 199 | Ga0207667_10000009 | 3300025949 | Bacteria | 603135 |
| 200 | Ga0207667_10000971 | 3300025949 | Bacteria | 36600 |
| 201 | Ga0207667_10021526 | 3300025949 | Bacteria | 7144 |
| 202 | Ga0207667_10167503 | 3300025949 | Bacteria | 2258 |
| 203 | Ga0207667_10295878 | 3300025949 | Bacteria | 1654 |
| 204 | Ga0207667_10494455 | 3300025949 | Bacteria | 1241 |
| 205 | Ga0207651_10206985 | 3300025960 | Bacteria | 1576 |
| 206 | Ga0207640_10334042 | 3300025981 | Bacteria | 1211 |
| 207 | Ga0207677_10016554 | 3300026023 | Bacteria | 4371 |
| 208 | Ga0207703_10173828 | 3300026035 | Bacteria | 1897 |
| 209 | Ga0207639_10004531 | 3300026041 | Bacteria | 9364 |
| 210 | Ga0207639_10401214 | 3300026041 | Bacteria | 1235 |
| 211 | Ga0207639_10830426 | 3300026041 | Bacteria | 862 |
| 212 | Ga0207678_10028584 | 3300026067 | Bacteria | 4866 |
| 213 | Ga0207702_10000507 | 3300026078 | Bacteria | 43964 |
| 214 | Ga0207702_10031437 | 3300026078 | Bacteria | 4424 |
| 215 | Ga0207702_10094321 | 3300026078 | Bacteria | 2627 |
| 216 | Ga0207702_10164054 | 3300026078 | Bacteria | 2031 |
| 217 | Ga0207702_10302540 | 3300026078 | Bacteria | 1518 |
| 218 | Ga0207648_10002139 | 3300026089 | Bacteria | 21480 |
| 219 | Ga0207674_10051052 | 3300026116 | Bacteria | 4222 |
| 220 | Ga0207683_10031312 | 3300026121 | Bacteria | 4616 |
| 221 | Ga0207698_10005251 | 3300026142 | Bacteria | 7971 |
| 222 | Ga0207698_10079196 | 3300026142 | Bacteria | 2642 |
| 223 | Ga0207698_10267932 | 3300026142 | Bacteria | 1573 |
| 224 | Ga0268266_10000089 | 3300028379 | Bacteria | 198566 |
| 225 | Ga0307515_10001481 | 3300028794 | Bacteria | 52778 |
| 226 | Ga0307515_10006233 | 3300028794 | Bacteria | 23951 |
| 227 | Ga0307515_10273863 | 3300028794 | Bacteria | 1405 |
| 228 | Ga0265338_10023639 | 3300028800 | Bacteria | 6309 |
| 229 | Ga0316182_1063435 | 3300030745 | Bacteria | 1081 |
| 230 | Ga0265332_10229002 | 3300031238 | Unclassified | 770 |
| 231 | Ga0265320_10047105 | 3300031240 | Bacteria | 2110 |
| 232 | Ga0265329_10045851 | 3300031242 | Bacteria | 1397 |
| 233 | Ga0265331_10030773 | 3300031250 | Bacteria | 2670 |
| 234 | Ga0265327_10166551 | 3300031251 | Bacteria | 1015 |
| 235 | Ga0307408_100000055 | 3300031548 | Bacteria | 140772 |
| 236 | Ga0265314_10016103 | 3300031711 | Bacteria | 5920 |
| 237 | Ga0307516_10592353 | 3300031730 | Unclassified | 763 |
| 238 | Ga0307413_10428463 | 3300031824 | Bacteria | 1044 |
| 239 | Ga0307412_10399757 | 3300031911 | Bacteria | 1118 |
| 240 | Ga0307414_10005937 | 3300032004 | Bacteria | 6761 |
| 241 | Ga0307411_10035287 | 3300032005 | Bacteria | 3121 |
| 242 | Ga0307507_10000345 | 3300033179 | Bacteria | 94462 |
| 243 | Ga0307510_10006636 | 3300033180 | Bacteria | 13804 |
| 244 | Ga0373941_0048695 | 3300035115 | Bacteria | 1339 |
| 245 | Ga0395899_0000659 | 3300037312 | Bacteria | 35170 |
| 246 | Ga0395899_0001109 | 3300037312 | Bacteria | 24123 |
| 247 | Ga0395899_0120586 | 3300037312 | Bacteria | 1879 |
| 248 | Ga0395900_0000277 | 3300037418 | Bacteria | 77256 |
| 249 | Ga0395900_0001234 | 3300037418 | Bacteria | 31453 |
| 250 | Ga0395900_0019640 | 3300037418 | Bacteria | 6889 |
| 251 | Ga0395898_0124571 | 3300037466 | Bacteria | 2469 |
| 252 | Ga0395905_0000068 | 3300037471 | Bacteria | 177163 |
| 253 | Ga0395905_0004443 | 3300037471 | Bacteria | 14577 |
| 254 | Ga0395901_0005268 | 3300038443 | Bacteria | 13060 |
| 255 | Ga0395901_0125253 | 3300038443 | Bacteria | 2700 |
| 256 | Ga0436361_0742208 | 3300039447 | Bacteria | 6052 |
| 257 | Ga0451791_0011005 | 3300041451 | Bacteria | 821 |
| 258 | Ga0451802_0423201 | 3300041460 | Bacteria | 757 |
| 259 | Ga0451833_0557083 | 3300041491 | Bacteria | 1088 |
| 260 | Ga0451837_0647620 | 3300041494 | Bacteria | 3594 |
| 261 | Ga0451841_0624971 | 3300041498 | Bacteria | 679 |
| 262 | Ga0451851_1104605 | 3300041507 | Bacteria | 1494 |
| 263 | Ga0439445_0130502 | 3300042004 | Bacteria | 725 |
| 264 | Ga0451577_1005510 | 3300042876 | Bacteria | 749 |
| 265 | Ga0466966_0014415 | 3300044684 | Bacteria | 5233 |
| 266 | Ga0466961_0206857 | 3300044693 | Bacteria | 1212 |
| 267 | Ga0453684_0051748 | 3300044712 | Bacteria | 5379 |
| 268 | Ga0495627_006270 | 3300046453 | Bacteria | 4674 |
| 269 | Ga0495651_0140018 | 3300046462 | Bacteria | 1756 |
| 270 | Ga0495650_0000132 | 3300046471 | Bacteria | 174226 |
| 271 | Ga0495650_0070836 | 3300046471 | Bacteria | 1368 |
| 272 | Ga0495585_0000093 | 3300046492 | Bacteria | 94793 |
| 273 | Ga0495585_0001039 | 3300046492 | Bacteria | 23036 |
| 274 | Ga0495585_0166108 | 3300046492 | Bacteria | 1143 |
| 275 | Ga0495606_0183105 | 3300046507 | Bacteria | 1206 |
| 276 | Ga0495606_0281562 | 3300046507 | Bacteria | 909 |
| 277 | Ga0495610_0001847 | 3300046512 | Bacteria | 18358 |
| 278 | Ga0495616_0022703 | 3300046513 | Bacteria | 3385 |
| 279 | Ga0495616_0033587 | 3300046513 | Bacteria | 2671 |
| 280 | Ga0495644_0006779 | 3300046523 | Bacteria | 4436 |
| 281 | Ga0495648_0009158 | 3300046524 | Bacteria | 7717 |
| 282 | Ga0495648_0027664 | 3300046524 | Bacteria | 3792 |
| 283 | Ga0495652_0075813 | 3300046529 | Bacteria | 2792 |
| 284 | Ga0495652_0216224 | 3300046529 | Bacteria | 1443 |
| 285 | Ga0495609_0004664 | 3300046538 | Bacteria | 7432 |
| 286 | Ga0495622_0062398 | 3300046557 | Bacteria | 1725 |
| 287 | Ga0495633_0000035 | 3300046558 | Bacteria | 185403 |
| 288 | Ga0495633_0005241 | 3300046558 | Bacteria | 7996 |
| 289 | Ga0495668_0000032 | 3300046616 | Bacteria | 254951 |
| 290 | Ga0495625_0000036 | 3300046660 | Bacteria | 221680 |
| 291 | Ga0495625_0001432 | 3300046660 | Bacteria | 29071 |
| 292 | Ga0495625_0010825 | 3300046660 | Bacteria | 7505 |
| 293 | Ga0495625_0136531 | 3300046660 | Bacteria | 1657 |
| 294 | Ga0495625_0222219 | 3300046660 | Bacteria | 1237 |
| 295 | Ga0495661_0000707 | 3300046665 | Bacteria | 33018 |
| 296 | Ga0495661_0004419 | 3300046665 | Bacteria | 10151 |
| 297 | Ga0495588_0170192 | 3300046674 | Bacteria | 1152 |
| 298 | Ga0495658_0091793 | 3300046683 | Bacteria | 1799 |
| 299 | Ga0495669_0198884 | 3300046684 | Bacteria | 958 |
| 300 | Ga0495671_0185332 | 3300046692 | Bacteria | 1011 |
| 301 | Ga0495649_0000017 | 3300046694 | Bacteria | 221685 |
| 302 | Ga0495649_0114727 | 3300046694 | Bacteria | 1427 |
| 303 | Ga0495589_0239284 | 3300046794 | Bacteria | 850 |
| 304 | Ga0495660_0009135 | 3300046810 | Bacteria | 5788 |
| 305 | Ga0495660_0232546 | 3300046810 | Bacteria | 863 |
| 306 | Ga0495683_0022996 | 3300047323 | Bacteria | 3204 |
| 307 | Ga0495687_016125 | 3300047443 | Bacteria | 3768 |
| 308 | Ga0495687_045438 | 3300047443 | Bacteria | 1901 |
| 309 | Ga0495686_0001209 | 3300047472 | Bacteria | 29698 |
| 310 | Ga0495686_0001825 | 3300047472 | Bacteria | 21435 |
| 311 | Ga0495686_0182224 | 3300047472 | Bacteria | 1216 |
| 312 | Ga0495686_0382281 | 3300047472 | Bacteria | 759 |
| 313 | Ga0495686_0449952 | 3300047472 | Bacteria | 684 |
| 314 | Ga0496115_0043219 | 3300048918 | Bacteria | 3593 |
| 315 | Ga0496125_0000031 | 3300048928 | Bacteria | 365156 |
| 316 | Ga0496126_0001893 | 3300048929 | Bacteria | 30186 |
| 317 | Ga0495678_006363 | 3300049459 | Bacteria | 6298 |
| 318 | Ga0495682_0064158 | 3300049460 | Bacteria | 1324 |
| 319 | Ga0501033_0108285 | 3300049570 | Bacteria | 2024 |
| 320 | Ga0501038_0748321 | 3300049574 | Unclassified | 729 |
| 321 | nmdc:mga0k408_386_c1 | 3300050493 | Bacteria | 24235 |
| 322 | nmdc:mga0qj67_72687_c1 | 3300050509 | Bacteria | 2746 |
| 323 | nmdc:mga08y16_11789_c1 | 3300050511 | Bacteria | 9185 |
| 324 | Ga0500578_0185983 | 3300053086 | Bacteria | 1278 |
| 325 | Ga0500647_0131867 | 3300053091 | Bacteria | 1178 |
| 326 | Ga0500641_0000115 | 3300053096 | Bacteria | 30968 |
| 327 | Ga0500594_0087086 | 3300053118 | Bacteria | 943 |
| 328 | Ga0500608_063704 | 3300053122 | Bacteria | 1759 |
| 329 | Ga0500618_000003 | 3300053125 | Bacteria | 338706 |
| 330 | Ga0500618_037605 | 3300053125 | Bacteria | 1118 |
| 331 | Ga0500619_091777 | 3300053154 | Bacteria | 1026 |
| 332 | Ga0500622_0144443 | 3300053156 | Bacteria | 1131 |
| 333 | Ga0500624_000694 | 3300053157 | Bacteria | 8505 |
| 334 | 2513233361 | 2513020052 | Bacteria | 5120511 |
| 335 | 2520881807 | 2519899754 | Bacteria | 5336938 |
| 336 | 2740002591 | 2739367857 | Bacteria | 5433684 |
| 337 | 2740007407 | 2739367858 | Bacteria | 5432813 |
| 338 | 2740031201 | 2739367866 | Bacteria | 4215900 |
| 339 | 2833640324 | 2833640130 | Bacteria | 4858325 |
| 340 | 2852626924 | 2852623160 | Bacteria | 4376875 |
| 341 | 2881250131 | 2881247448 | Bacteria | 3717788 |
| 342 | 2884938024 | 2884933994 | Bacteria | 4535041 |
| 343 | 2910249564 | 2910245624 | Bacteria | 6935613 |
| 344 | 2919442229 | 2919437846 | Bacteria | 6199444 |
| 345 | 2919512290 | 2919509842 | Bacteria | 4104664 |
| 346 | 2958458979 | 2958458903 | Bacteria | 5301041 |
| 347 | 2958515438 | 2958512119 | Bacteria | 4528530 |
| 348 | 2965322213 | 2965320100 | Bacteria | 3975600 |
| 349 | 8036738191 | 8036736890 | Bacteria | 2944828 |
| 350 | 8056440308 | 8056440228 | Bacteria | 4946504 |
| 351 | Ga0495606_0025024 | |||
| 352 | JGI24736J21556_1005764 | |||
| 353 | JGI24740J21852_10037081 | |||
| 354 | JGI24743J22301_10013148 | |||
| 355 | JGI25162J39368_1000089 | |||
| 356 | JGI25162J39368_1000498 | |||
| 357 | JGI25165J46597_1000618 | |||
| 358 | JGI25165J46597_1033471 | |||
| 359 | rootH2_10018591 | |||
| 360 | rootH2_10095836 | |||
| 361 | rootH1_10017540 | |||
| 362 | rootH1_10093143 | |||
| 363 | rootH1_10100036 | |||
| 364 | rootH1_10286877 | |||
| 365 | Ga0065714_10011084 | |||
| 366 | Ga0065714_10079220 | |||
| 367 | Ga0065714_10115562 | |||
| 368 | Ga0065714_10184441 | |||
| 369 | Ga0065715_10365105 | |||
| 370 | Ga0070658_10000018 | |||
| 371 | Ga0070658_10099802 | |||
| 372 | Ga0070658_10133225 | |||
| 373 | Ga0070676_10000642 | |||
| 374 | Ga0070683_100035829 | |||
| 375 | Ga0068869_100106693 | |||
| 376 | Ga0068868_100013908 | |||
| 377 | Ga0068868_100027571 | |||
| 378 | Ga0070660_100031635 | |||
| 379 | Ga0070660_100054015 | |||
| 380 | Ga0070660_100166420 | |||
| 381 | Ga0070660_100374280 | |||
| 382 | Ga0070671_100023057 | |||
| 383 | Ga0070674_100055726 | |||
| 384 | Ga0070673_100271414 | |||
| 385 | Ga0070659_100000292 | |||
| 386 | Ga0070659_100066937 | |||
| 387 | Ga0070710_10664268 | |||
| 388 | Ga0070678_100018207 | |||
| 389 | Ga0070662_100000626 | |||
| 390 | Ga0070662_100149288 | |||
| 391 | Ga0070681_10022542 | |||
| 392 | Ga0070679_100155987 | |||
| 393 | Ga0070679_100413028 | |||
| 394 | Ga0068853_100101143 | |||
| 395 | Ga0068853_100191308 | |||
| 396 | Ga0068855_100000070 | |||
| 397 | Ga0068855_100000268 | |||
| 398 | Ga0068855_100037071 | |||
| 399 | Ga0068855_100704975 | |||
| 400 | Ga0068855_100727213 | |||
| 401 | Ga0068855_101293569 | |||
| 402 | Ga0068857_100036027 | |||
| 403 | Ga0068856_100000899 | |||
| 404 | Ga0068856_100009016 | |||
| 405 | Ga0068856_100068505 | |||
| 406 | Ga0068856_100113651 | |||
| 407 | Ga0068852_100019512 | |||
| 408 | Ga0068852_100097079 | |||
| 409 | Ga0068852_100323590 | |||
| 410 | Ga0068852_100778098 | |||
| 411 | Ga0068851_10419390 | |||
| 412 | Ga0068858_100181062 | |||
| 413 | Ga0081539_10010598 | |||
| 414 | Ga0075366_10001061 | |||
| 415 | Ga0097621_100000878 | |||
| 416 | Ga0068871_100006906 | |||
| 417 | Ga0075428_100010944 | |||
| 418 | Ga0075430_100334530 | |||
| 419 | Ga0068865_100000127 | |||
| 420 | Ga0105240_10008851 | |||
| 421 | Ga0105240_10059080 | |||
| 422 | Ga0105240_10082406 | |||
| 423 | Ga0105240_10198436 | |||
| 424 | Ga0105240_10249747 | |||
| 425 | Ga0105240_10266263 | |||
| 426 | Ga0105240_10456752 | |||
| 427 | Ga0111539_10003202 | |||
| 428 | Ga0105245_10115881 | |||
| 429 | Ga0105241_10014160 | |||
| 430 | Ga0105241_10016950 | |||
| 431 | Ga0105241_10019885 | |||
| 432 | Ga0105241_10047248 | |||
| 433 | Ga0105241_10052774 | |||
| 434 | Ga0105241_10205178 | |||
| 435 | Ga0105242_10060938 | |||
| 436 | Ga0105237_10000224 | |||
| 437 | Ga0105237_10000485 | |||
| 438 | Ga0105237_10001308 | |||
| 439 | Ga0105237_10007484 | |||
| 440 | Ga0105237_10129481 | |||
| 441 | Ga0105237_10712787 | |||
| 442 | Ga0105237_11226451 | |||
| 443 | Ga0105238_10105636 | |||
| 444 | Ga0105238_10124027 | |||
| 445 | Ga0105238_11221178 | |||
| 446 | Ga0105239_10000039 | |||
| 447 | Ga0105239_10000120 | |||
| 448 | Ga0105239_10000987 | |||
| 449 | Ga0105239_10005560 | |||
| 450 | Ga0105239_10012917 | |||
| 451 | Ga0105239_10013753 | |||
| 452 | Ga0105239_10023687 | |||
| 453 | Ga0105239_10068194 | |||
| 454 | Ga0105239_10118182 | |||
| 455 | Ga0105239_10202029 | |||
| 456 | Ga0105239_10458729 | |||
| 457 | Ga0105239_10744941 | |||
| 458 | Ga0105246_10043748 | |||
| 459 | Ga0105246_10823269 | |||
| 460 | Ga0157373_10000205 | |||
| 461 | Ga0157373_10003515 | |||
| 462 | Ga0157373_10043334 | |||
| 463 | Ga0157371_10000263 | |||
| 464 | Ga0157371_10005281 | |||
| 465 | Ga0157370_10000449 | |||
| 466 | Ga0157370_10044499 | |||
| 467 | Ga0157370_10074075 | |||
| 468 | Ga0157370_10556733 | |||
| 469 | Ga0157369_10014846 | |||
| 470 | Ga0157369_10142078 | |||
| 471 | Ga0157369_10733280 | |||
| 472 | Ga0157374_10001845 | |||
| 473 | Ga0157374_10009022 | |||
| 474 | Ga0157374_10044113 | |||
| 475 | Ga0157374_10068545 | |||
| 476 | Ga0157374_10159603 | |||
| 477 | Ga0157374_10336959 | |||
| 478 | Ga0157374_10345164 | |||
| 479 | Ga0157374_10802699 | |||
| 480 | Ga0157374_11171013 | |||
| 481 | Ga0157378_10012553 | |||
| 482 | Ga0163162_10000010 | |||
| 483 | Ga0163162_10030319 | |||
| 484 | Ga0163162_10213876 | |||
| 485 | Ga0163162_10249542 | |||
| 486 | Ga0163162_10641863 | |||
| 487 | Ga0163162_10806739 | |||
| 488 | Ga0157372_10000050 | |||
| 489 | Ga0157372_10000635 | |||
| 490 | Ga0157372_10002192 | |||
| 491 | Ga0157372_10052596 | |||
| 492 | Ga0157375_10005903 | |||
| 493 | Ga0157375_10126604 | |||
| 494 | Ga0157375_11384892 | |||
| 495 | Ga0182008_10088827 | |||
| 496 | Ga0157377_10006123 | |||
| 497 | Ga0163161_10014162 | |||
| 498 | Ga0163161_10043434 | |||
| 499 | Ga0163161_10068723 | |||
| 500 | Ga0163161_10132627 | |||
| 501 | Ga0213872_10006890 | |||
| 502 | Ga0209563_107363 | |||
| 503 | Ga0207427_100359 | |||
| 504 | Ga0209437_100034 | |||
| 505 | Ga0209437_100221 | |||
| 506 | Ga0209026_1000739 | |||
| 507 | Ga0209026_1003634 | |||
| 508 | Ga0209129_1011462 | |||
| 509 | Ga0209233_1000038 | |||
| 510 | Ga0209233_1005850 | |||
| 511 | Ga0209233_1006383 | |||
| 512 | Ga0209455_1000861 | |||
| 513 | Ga0207647_10000076 | |||
| 514 | Ga0207647_10012704 | |||
| 515 | Ga0207645_10018663 | |||
| 516 | Ga0207705_10000036 | |||
| 517 | Ga0207705_10094626 | |||
| 518 | Ga0207654_10003136 | |||
| 519 | Ga0207654_10007603 | |||
| 520 | Ga0207654_10015094 | |||
| 521 | Ga0207654_10293743 | |||
| 522 | Ga0207695_10000916 | |||
| 523 | Ga0207695_10004656 | |||
| 524 | Ga0207695_10065391 | |||
| 525 | Ga0207695_10087055 | |||
| 526 | Ga0207695_10489661 | |||
| 527 | Ga0207695_10511617 | |||
| 528 | Ga0207671_10002624 | |||
| 529 | Ga0207671_10006239 | |||
| 530 | Ga0207671_10008271 | |||
| 531 | Ga0207671_10040826 | |||
| 532 | Ga0207671_10106479 | |||
| 533 | Ga0207671_10219246 | |||
| 534 | Ga0207660_10194388 | |||
| 535 | Ga0207657_10020956 | |||
| 536 | Ga0207657_10333491 | |||
| 537 | Ga0207657_10373791 | |||
| 538 | Ga0207652_10034681 | |||
| 539 | Ga0207694_10769530 | |||
| 540 | Ga0207694_10828652 | |||
| 541 | Ga0207687_10226983 | |||
| 542 | Ga0207644_10015452 | |||
| 543 | Ga0207690_10000311 | |||
| 544 | Ga0207690_10003941 | |||
| 545 | Ga0207706_10006487 | |||
| 546 | Ga0207686_10100625 | |||
| 547 | Ga0207669_10422711 | |||
| 548 | Ga0207704_10000044 | |||
| 549 | Ga0207667_10000009 | |||
| 550 | Ga0207667_10000971 | |||
| 551 | Ga0207667_10021526 | |||
| 552 | Ga0207667_10167503 | |||
| 553 | Ga0207667_10295878 | |||
| 554 | Ga0207667_10494455 | |||
| 555 | Ga0207651_10206985 | |||
| 556 | Ga0207640_10334042 | |||
| 557 | Ga0207677_10016554 | |||
| 558 | Ga0207703_10173828 | |||
| 559 | Ga0207639_10004531 | |||
| 560 | Ga0207639_10401214 | |||
| 561 | Ga0207639_10830426 | |||
| 562 | Ga0207678_10028584 | |||
| 563 | Ga0207702_10000507 | |||
| 564 | Ga0207702_10031437 | |||
| 565 | Ga0207702_10094321 | |||
| 566 | Ga0207702_10164054 | |||
| 567 | Ga0207702_10302540 | |||
| 568 | Ga0207648_10002139 | |||
| 569 | Ga0207674_10051052 | |||
| 570 | Ga0207683_10031312 | |||
| 571 | Ga0207698_10005251 | |||
| 572 | Ga0207698_10079196 | |||
| 573 | Ga0207698_10267932 | |||
| 574 | Ga0268266_10000089 | |||
| 575 | Ga0307515_10001481 | |||
| 576 | Ga0307515_10006233 | |||
| 577 | Ga0307515_10273863 | |||
| 578 | Ga0265338_10023639 | |||
| 579 | Ga0316182_1063435 | |||
| 580 | Ga0265332_10229002 | |||
| 581 | Ga0265320_10047105 | |||
| 582 | Ga0265329_10045851 | |||
| 583 | Ga0265331_10030773 | |||
| 584 | Ga0265327_10166551 | |||
| 585 | Ga0307408_100000055 | |||
| 586 | Ga0265314_10016103 | |||
| 587 | Ga0307516_10592353 | |||
| 588 | Ga0307413_10428463 | |||
| 589 | Ga0307412_10399757 | |||
| 590 | Ga0307414_10005937 | |||
| 591 | Ga0307411_10035287 | |||
| 592 | Ga0307507_10000345 | |||
| 593 | Ga0307510_10006636 | |||
| 594 | Ga0373941_0048695 | |||
| 595 | Ga0395899_0000659 | |||
| 596 | Ga0395899_0001109 | |||
| 597 | Ga0395899_0120586 | |||
| 598 | Ga0395900_0000277 | |||
| 599 | Ga0395900_0001234 | |||
| 600 | Ga0395900_0019640 | |||
| 601 | Ga0395898_0124571 | |||
| 602 | Ga0395905_0000068 | |||
| 603 | Ga0395905_0004443 | |||
| 604 | Ga0395901_0005268 | |||
| 605 | Ga0395901_0125253 | |||
| 606 | Ga0436361_0742208 | |||
| 607 | Ga0451791_0011005 | |||
| 608 | Ga0451802_0423201 | |||
| 609 | Ga0451833_0557083 | |||
| 610 | Ga0451837_0647620 | |||
| 611 | Ga0451841_0624971 | |||
| 612 | Ga0451851_1104605 | |||
| 613 | Ga0439445_0130502 | |||
| 614 | Ga0451577_1005510 | |||
| 615 | Ga0466966_0014415 | |||
| 616 | Ga0466961_0206857 | |||
| 617 | Ga0453684_0051748 | |||
| 618 | Ga0495627_006270 | |||
| 619 | Ga0495651_0140018 | |||
| 620 | Ga0495650_0000132 | |||
| 621 | Ga0495650_0070836 | |||
| 622 | Ga0495585_0000093 | |||
| 623 | Ga0495585_0001039 | |||
| 624 | Ga0495585_0166108 | |||
| 625 | Ga0495606_0183105 | |||
| 626 | Ga0495606_0281562 | |||
| 627 | Ga0495610_0001847 | |||
| 628 | Ga0495616_0022703 | |||
| 629 | Ga0495616_0033587 | |||
| 630 | Ga0495644_0006779 | |||
| 631 | Ga0495648_0009158 | |||
| 632 | Ga0495648_0027664 | |||
| 633 | Ga0495652_0075813 | |||
| 634 | Ga0495652_0216224 | |||
| 635 | Ga0495609_0004664 | |||
| 636 | Ga0495622_0062398 | |||
| 637 | Ga0495633_0000035 | |||
| 638 | Ga0495633_0005241 | |||
| 639 | Ga0495668_0000032 | |||
| 640 | Ga0495625_0000036 | |||
| 641 | Ga0495625_0001432 | |||
| 642 | Ga0495625_0010825 | |||
| 643 | Ga0495625_0136531 | |||
| 644 | Ga0495625_0222219 | |||
| 645 | Ga0495661_0000707 | |||
| 646 | Ga0495661_0004419 | |||
| 647 | Ga0495588_0170192 | |||
| 648 | Ga0495658_0091793 | |||
| 649 | Ga0495669_0198884 | |||
| 650 | Ga0495671_0185332 | |||
| 651 | Ga0495649_0000017 | |||
| 652 | Ga0495649_0114727 | |||
| 653 | Ga0495589_0239284 | |||
| 654 | Ga0495660_0009135 | |||
| 655 | Ga0495660_0232546 | |||
| 656 | Ga0495683_0022996 | |||
| 657 | Ga0495687_016125 | |||
| 658 | Ga0495687_045438 | |||
| 659 | Ga0495686_0001209 | |||
| 660 | Ga0495686_0001825 | |||
| 661 | Ga0495686_0182224 | |||
| 662 | Ga0495686_0382281 | |||
| 663 | Ga0495686_0449952 | |||
| 664 | Ga0496115_0043219 | |||
| 665 | Ga0496125_0000031 | |||
| 666 | Ga0496126_0001893 | |||
| 667 | Ga0495678_006363 | |||
| 668 | Ga0495682_0064158 | |||
| 669 | Ga0501033_0108285 | |||
| 670 | Ga0501038_0748321 | |||
| 671 | nmdc:mga0k408_386_c1 | |||
| 672 | nmdc:mga0qj67_72687_c1 | |||
| 673 | nmdc:mga08y16_11789_c1 | |||
| 674 | Ga0500578_0185983 | |||
| 675 | Ga0500647_0131867 | |||
| 676 | Ga0500641_0000115 | |||
| 677 | Ga0500594_0087086 | |||
| 678 | Ga0500608_063704 | |||
| 679 | Ga0500618_000003 | |||
| 680 | Ga0500618_037605 | |||
| 681 | Ga0500619_091777 | |||
| 682 | Ga0500622_0144443 | |||
| 683 | Ga0500624_000694 | |||
| 684 | 2513233361 | |||
| 685 | 2520881807 | |||
| 686 | 2740002591 | |||
| 687 | 2740007407 | |||
| 688 | 2740031201 | |||
| 689 | 2833640324 | |||
| 690 | 2852626924 | |||
| 691 | 2881250131 | |||
| 692 | 2884938024 | |||
| 693 | 2910249564 | |||
| 694 | 2919442229 | |||
| 695 | 2919512290 | |||
| 696 | 2958458979 | |||
| 697 | 2958515438 | |||
| 698 | 2965322213 | |||
| 699 | 8036738191 | |||
| 700 | 8056440308 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5im6-assembly1.cif.gz_A | crystal structure of designed two-component self-assembling icosahedral cage i32-28 | 0.9583 | 26 | 179 |
| 2zhy-assembly1.cif.gz_A | crystal structure of a pduo-type atp:cobalamin adenosyltransferase from burkholderia thailandensis | 0.9543 | 26 | 176 |
| 7ruu-assembly2.cif.gz_D | structure of human atp:cobalamin adenosyltransferase r190c bound to adenosylcobalamin | 0.9514 | 26 | 180 |
| 5cy5-assembly1.cif.gz_A | crystal structure of the t33-51h designed self-assembling protein tetrahedron | 0.9382 | 26 | 172 |
| 2zhy-assembly1.cif.gz_A | crystal structure of a pduo-type atp:cobalamin adenosyltransferase from burkholderia thailandensis | 0.9361 | 26 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2zhzB01 | Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like | 0.9553 | 13 | 179 | 1.20.1200.10 |
| 2zhzB01 | Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like | 0.944 | 13 | 179 | 1.20.1200.10 |
| 5cy5A00 | Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like | 0.9382 | 26 | 172 | 1.20.1200.10 |
| 1wvtA00 | Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like | 0.9362 | 23 | 179 | 1.20.1200.10 |
| 2idxA00 | Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like | 0.9334 | 26 | 180 | 1.20.1200.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C2E9L9-F1-model_v4 | Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.9909 | 89 | 181 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-A0A524H4I9-F1-model_v4 | Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.9871 | 93 | 180 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-A0A2T0U551-F1-model_v4 | Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.9845 | 1 | 182 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-A0A382NIU5-F1-model_v4 | Cobalamin adenosyltransferase-like domain-containing protein | 0.9817 | 85 | 182 |
GO:0005524
GO:0008817 |
| AF-A0A257RYL1-F1-model_v4 | Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.9802 | 86 | 178 |
GO:0005524
GO:0008817 GO:0009236 |