F418360

General Info

Members Datasets Scaffolds Average Seq Length
350 194 700 182

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0025024|Ga0495606_0025024_201_857
Length 218
Sequence MSYGFTGKNSIFTLIKAGLPFQCAPYRARHFKIDTYMKIYTKTGDKGYTSLIGGTRVPKHHLRIESYGTVDELNSYIGLIRDQDITAHDKELLKQIQDRLFTIGSSLAADPEKSKMIIPDLHMADVELLEQEMDTMNEQLPELRHFILPGGSNTISFCHIARCICRRAERLTVNLAQESTVDEKVNIYLNRLSDYLFTLGRKVANERNIPENQWIPRI

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
102 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
103 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
104 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
115 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
116 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
124 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
125 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
126 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
127 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
128 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
129 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
140 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
155 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
163 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
170 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
171 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
172 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
173 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
174 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
175 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
178 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
179 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
180 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
181 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
182 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
183 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
184 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
185 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
186 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
187 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
188 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
189 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
190 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
191 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
192 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
193 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
194 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.14
Metatranscriptomes 0
Isolates 4.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.14
Nodule 0
Rhizoplane 0.86
Rhizosphere 85.14
Stem 0
Stem Tuber 0
Unclassified 2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0025024 3300046507 Bacteria 4285
2 JGI24736J21556_1005764 3300001904 Bacteria 2092
3 JGI24740J21852_10037081 3300001979 Bacteria 1509
4 JGI24743J22301_10013148 3300001991 Bacteria 1514
5 JGI25162J39368_1000089 3300002737 Bacteria 104054
6 JGI25162J39368_1000498 3300002737 Bacteria 29793
7 JGI25165J46597_1000618 3300003214 Bacteria 30063
8 JGI25165J46597_1033471 3300003214 Bacteria 662
9 rootH2_10018591 3300003320 Bacteria 30571
10 rootH2_10095836 3300003320 Bacteria 1051
11 rootH1_10017540 3300003323 Bacteria 39177
12 rootH1_10093143 3300003323 Bacteria 4723
13 rootH1_10100036 3300003323 Bacteria 1021
14 rootH1_10286877 3300003323 Bacteria 3332
15 Ga0065714_10011084 3300005288 Bacteria 1998
16 Ga0065714_10079220 3300005288 Bacteria 2534
17 Ga0065714_10115562 3300005288 Bacteria 1411
18 Ga0065714_10184441 3300005288 Bacteria 950
19 Ga0065715_10365105 3300005293 Bacteria 929
20 Ga0070658_10000018 3300005327 Bacteria 200558
21 Ga0070658_10099802 3300005327 Bacteria 2399
22 Ga0070658_10133225 3300005327 Bacteria 2072
23 Ga0070676_10000642 3300005328 Bacteria 17019
24 Ga0070683_100035829 3300005329 Bacteria 4537
25 Ga0068869_100106693 3300005334 Bacteria 2126
26 Ga0068868_100013908 3300005338 Bacteria 5917
27 Ga0068868_100027571 3300005338 Bacteria 4333
28 Ga0070660_100031635 3300005339 Bacteria 3975
29 Ga0070660_100054015 3300005339 Bacteria 3100
30 Ga0070660_100166420 3300005339 Bacteria 1779
31 Ga0070660_100374280 3300005339 Bacteria 1175
32 Ga0070671_100023057 3300005355 Bacteria 5088
33 Ga0070674_100055726 3300005356 Bacteria 2739
34 Ga0070673_100271414 3300005364 Bacteria 1485
35 Ga0070659_100000292 3300005366 Bacteria 39270
36 Ga0070659_100066937 3300005366 Bacteria 2848
37 Ga0070710_10664268 3300005437 Unclassified 732
38 Ga0070678_100018207 3300005456 Bacteria 4549
39 Ga0070662_100000626 3300005457 Bacteria 21383
40 Ga0070662_100149288 3300005457 Bacteria 1818
41 Ga0070681_10022542 3300005458 Bacteria 6324
42 Ga0070679_100155987 3300005530 Bacteria 2258
43 Ga0070679_100413028 3300005530 Bacteria 1295
44 Ga0068853_100101143 3300005539 Bacteria 2549
45 Ga0068853_100191308 3300005539 Bacteria 1859
46 Ga0068855_100000070 3300005563 Bacteria 123584
47 Ga0068855_100000268 3300005563 Bacteria 64693
48 Ga0068855_100037071 3300005563 Bacteria 5801
49 Ga0068855_100704975 3300005563 Bacteria 1080
50 Ga0068855_100727213 3300005563 Bacteria 1060
51 Ga0068855_101293569 3300005563 Unclassified 755
52 Ga0068857_100036027 3300005577 Bacteria 4384
53 Ga0068856_100000899 3300005614 Bacteria 31842
54 Ga0068856_100009016 3300005614 Bacteria 9706
55 Ga0068856_100068505 3300005614 Bacteria 3508
56 Ga0068856_100113651 3300005614 Bacteria 2706
57 Ga0068852_100019512 3300005616 Bacteria 5368
58 Ga0068852_100097079 3300005616 Bacteria 2650
59 Ga0068852_100323590 3300005616 Bacteria 1498
60 Ga0068852_100778098 3300005616 Bacteria 970
61 Ga0068851_10419390 3300005834 Bacteria 790
62 Ga0068858_100181062 3300005842 Bacteria 1990
63 Ga0081539_10010598 3300005985 Bacteria 7447
64 Ga0075366_10001061 3300006195 Bacteria 13486
65 Ga0097621_100000878 3300006237 Bacteria 21148
66 Ga0068871_100006906 3300006358 Bacteria 8084
67 Ga0075428_100010944 3300006844 Bacteria 10087
68 Ga0075430_100334530 3300006846 Bacteria 1251
69 Ga0068865_100000127 3300006881 Bacteria 39327
70 Ga0105240_10008851 3300009093 Bacteria 14336
71 Ga0105240_10059080 3300009093 Bacteria 4787
72 Ga0105240_10082406 3300009093 Bacteria 3951
73 Ga0105240_10198436 3300009093 Bacteria 2353
74 Ga0105240_10249747 3300009093 Bacteria 2052
75 Ga0105240_10266263 3300009093 Bacteria 1975
76 Ga0105240_10456752 3300009093 Bacteria 1428
77 Ga0111539_10003202 3300009094 Bacteria 21659
78 Ga0105245_10115881 3300009098 Bacteria 2498
79 Ga0105241_10014160 3300009174 Bacteria 5844
80 Ga0105241_10016950 3300009174 Bacteria 5347
81 Ga0105241_10019885 3300009174 Bacteria 4956
82 Ga0105241_10047248 3300009174 Bacteria 3273
83 Ga0105241_10052774 3300009174 Bacteria 3106
84 Ga0105241_10205178 3300009174 Bacteria 1649
85 Ga0105242_10060938 3300009176 Bacteria 3102
86 Ga0105237_10000224 3300009545 Bacteria 79854
87 Ga0105237_10000485 3300009545 Bacteria 56664
88 Ga0105237_10001308 3300009545 Bacteria 33108
89 Ga0105237_10007484 3300009545 Bacteria 11941
90 Ga0105237_10129481 3300009545 Bacteria 2518
91 Ga0105237_10712787 3300009545 Bacteria 1010
92 Ga0105237_11226451 3300009545 Bacteria 757
93 Ga0105238_10105636 3300009551 Unclassified 2798
94 Ga0105238_10124027 3300009551 Bacteria 2562
95 Ga0105238_11221178 3300009551 Bacteria 776
96 Ga0105239_10000039 3300010375 Bacteria 203537
97 Ga0105239_10000120 3300010375 Bacteria 110003
98 Ga0105239_10000987 3300010375 Bacteria 39852
99 Ga0105239_10005560 3300010375 Bacteria 14739
100 Ga0105239_10012917 3300010375 Bacteria 9289
101 Ga0105239_10013753 3300010375 Bacteria 8983
102 Ga0105239_10023687 3300010375 Bacteria 6759
103 Ga0105239_10068194 3300010375 Bacteria 3909
104 Ga0105239_10118182 3300010375 Bacteria 2942
105 Ga0105239_10202029 3300010375 Bacteria 2226
106 Ga0105239_10458729 3300010375 Bacteria 1446
107 Ga0105239_10744941 3300010375 Bacteria 1121
108 Ga0105246_10043748 3300011119 Bacteria 3040
109 Ga0105246_10823269 3300011119 Bacteria 826
110 Ga0157373_10000205 3300013100 Bacteria 48796
111 Ga0157373_10003515 3300013100 Bacteria 11847
112 Ga0157373_10043334 3300013100 Bacteria 3214
113 Ga0157371_10000263 3300013102 Bacteria 71557
114 Ga0157371_10005281 3300013102 Bacteria 10945
115 Ga0157370_10000449 3300013104 Bacteria 51431
116 Ga0157370_10044499 3300013104 Bacteria 4266
117 Ga0157370_10074075 3300013104 Bacteria 3212
118 Ga0157370_10556733 3300013104 Bacteria 1051
119 Ga0157369_10014846 3300013105 Bacteria 8790
120 Ga0157369_10142078 3300013105 Bacteria 2540
121 Ga0157369_10733280 3300013105 Unclassified 1017
122 Ga0157374_10001845 3300013296 Bacteria 17834
123 Ga0157374_10009022 3300013296 Bacteria 8552
124 Ga0157374_10044113 3300013296 Bacteria 4121
125 Ga0157374_10068545 3300013296 Bacteria 3338
126 Ga0157374_10159603 3300013296 Bacteria 2196
127 Ga0157374_10336959 3300013296 Bacteria 1497
128 Ga0157374_10345164 3300013296 Bacteria 1478
129 Ga0157374_10802699 3300013296 Bacteria 957
130 Ga0157374_11171013 3300013296 Bacteria 790
131 Ga0157378_10012553 3300013297 Bacteria 7415
132 Ga0163162_10000010 3300013306 Bacteria 302032
133 Ga0163162_10030319 3300013306 Bacteria 5359
134 Ga0163162_10213876 3300013306 Bacteria 2058
135 Ga0163162_10249542 3300013306 Bacteria 1906
136 Ga0163162_10641863 3300013306 Bacteria 1186
137 Ga0163162_10806739 3300013306 Bacteria 1056
138 Ga0157372_10000050 3300013307 Bacteria 140381
139 Ga0157372_10000635 3300013307 Bacteria 38523
140 Ga0157372_10002192 3300013307 Bacteria 21241
141 Ga0157372_10052596 3300013307 Bacteria 4536
142 Ga0157375_10005903 3300013308 Bacteria 10672
143 Ga0157375_10126604 3300013308 Bacteria 2669
144 Ga0157375_11384892 3300013308 Bacteria 828
145 Ga0182008_10088827 3300014497 Bacteria 1523
146 Ga0157377_10006123 3300014745 Bacteria 5711
147 Ga0163161_10014162 3300017792 Bacteria 5553
148 Ga0163161_10043434 3300017792 Bacteria 3236
149 Ga0163161_10068723 3300017792 Bacteria 2589
150 Ga0163161_10132627 3300017792 Bacteria 1881
151 Ga0213872_10006890 3300021361 Bacteria 5656
152 Ga0209563_107363 3300025230 Bacteria 1814
153 Ga0207427_100359 3300025231 Bacteria 28547
154 Ga0209437_100034 3300025233 Bacteria 494007
155 Ga0209437_100221 3300025233 Bacteria 104135
156 Ga0209026_1000739 3300025250 Bacteria 18792
157 Ga0209026_1003634 3300025250 Bacteria 4952
158 Ga0209129_1011462 3300025258 Bacteria 2115
159 Ga0209233_1000038 3300025261 Bacteria 548972
160 Ga0209233_1005850 3300025261 Bacteria 4037
161 Ga0209233_1006383 3300025261 Bacteria 3806
162 Ga0209455_1000861 3300025272 Bacteria 16150
163 Ga0207647_10000076 3300025904 Bacteria 75824
164 Ga0207647_10012704 3300025904 Bacteria 5852
165 Ga0207645_10018663 3300025907 Bacteria 4557
166 Ga0207705_10000036 3300025909 Bacteria 200787
167 Ga0207705_10094626 3300025909 Bacteria 2191
168 Ga0207654_10003136 3300025911 Bacteria 8363
169 Ga0207654_10007603 3300025911 Bacteria 5463
170 Ga0207654_10015094 3300025911 Bacteria 4000
171 Ga0207654_10293743 3300025911 Bacteria 1103
172 Ga0207695_10000916 3300025913 Bacteria 52837
173 Ga0207695_10004656 3300025913 Bacteria 18589
174 Ga0207695_10065391 3300025913 Bacteria 3739
175 Ga0207695_10087055 3300025913 Bacteria 3148
176 Ga0207695_10489661 3300025913 Bacteria 1112
177 Ga0207695_10511617 3300025913 Bacteria 1082
178 Ga0207671_10002624 3300025914 Bacteria 18962
179 Ga0207671_10006239 3300025914 Bacteria 10682
180 Ga0207671_10008271 3300025914 Bacteria 8849
181 Ga0207671_10040826 3300025914 Bacteria 3434
182 Ga0207671_10106479 3300025914 Bacteria 2129
183 Ga0207671_10219246 3300025914 Bacteria 1490
184 Ga0207660_10194388 3300025917 Bacteria 1582
185 Ga0207657_10020956 3300025919 Bacteria 6166
186 Ga0207657_10333491 3300025919 Bacteria 1198
187 Ga0207657_10373791 3300025919 Bacteria 1123
188 Ga0207652_10034681 3300025921 Bacteria 4254
189 Ga0207694_10769530 3300025924 Bacteria 813
190 Ga0207694_10828652 3300025924 Bacteria 782
191 Ga0207687_10226983 3300025927 Bacteria 1473
192 Ga0207644_10015452 3300025931 Bacteria 5124
193 Ga0207690_10000311 3300025932 Bacteria 33041
194 Ga0207690_10003941 3300025932 Bacteria 8778
195 Ga0207706_10006487 3300025933 Bacteria 10861
196 Ga0207686_10100625 3300025934 Bacteria 1929
197 Ga0207669_10422711 3300025937 Bacteria 1049
198 Ga0207704_10000044 3300025938 Bacteria 86753
199 Ga0207667_10000009 3300025949 Bacteria 603135
200 Ga0207667_10000971 3300025949 Bacteria 36600
201 Ga0207667_10021526 3300025949 Bacteria 7144
202 Ga0207667_10167503 3300025949 Bacteria 2258
203 Ga0207667_10295878 3300025949 Bacteria 1654
204 Ga0207667_10494455 3300025949 Bacteria 1241
205 Ga0207651_10206985 3300025960 Bacteria 1576
206 Ga0207640_10334042 3300025981 Bacteria 1211
207 Ga0207677_10016554 3300026023 Bacteria 4371
208 Ga0207703_10173828 3300026035 Bacteria 1897
209 Ga0207639_10004531 3300026041 Bacteria 9364
210 Ga0207639_10401214 3300026041 Bacteria 1235
211 Ga0207639_10830426 3300026041 Bacteria 862
212 Ga0207678_10028584 3300026067 Bacteria 4866
213 Ga0207702_10000507 3300026078 Bacteria 43964
214 Ga0207702_10031437 3300026078 Bacteria 4424
215 Ga0207702_10094321 3300026078 Bacteria 2627
216 Ga0207702_10164054 3300026078 Bacteria 2031
217 Ga0207702_10302540 3300026078 Bacteria 1518
218 Ga0207648_10002139 3300026089 Bacteria 21480
219 Ga0207674_10051052 3300026116 Bacteria 4222
220 Ga0207683_10031312 3300026121 Bacteria 4616
221 Ga0207698_10005251 3300026142 Bacteria 7971
222 Ga0207698_10079196 3300026142 Bacteria 2642
223 Ga0207698_10267932 3300026142 Bacteria 1573
224 Ga0268266_10000089 3300028379 Bacteria 198566
225 Ga0307515_10001481 3300028794 Bacteria 52778
226 Ga0307515_10006233 3300028794 Bacteria 23951
227 Ga0307515_10273863 3300028794 Bacteria 1405
228 Ga0265338_10023639 3300028800 Bacteria 6309
229 Ga0316182_1063435 3300030745 Bacteria 1081
230 Ga0265332_10229002 3300031238 Unclassified 770
231 Ga0265320_10047105 3300031240 Bacteria 2110
232 Ga0265329_10045851 3300031242 Bacteria 1397
233 Ga0265331_10030773 3300031250 Bacteria 2670
234 Ga0265327_10166551 3300031251 Bacteria 1015
235 Ga0307408_100000055 3300031548 Bacteria 140772
236 Ga0265314_10016103 3300031711 Bacteria 5920
237 Ga0307516_10592353 3300031730 Unclassified 763
238 Ga0307413_10428463 3300031824 Bacteria 1044
239 Ga0307412_10399757 3300031911 Bacteria 1118
240 Ga0307414_10005937 3300032004 Bacteria 6761
241 Ga0307411_10035287 3300032005 Bacteria 3121
242 Ga0307507_10000345 3300033179 Bacteria 94462
243 Ga0307510_10006636 3300033180 Bacteria 13804
244 Ga0373941_0048695 3300035115 Bacteria 1339
245 Ga0395899_0000659 3300037312 Bacteria 35170
246 Ga0395899_0001109 3300037312 Bacteria 24123
247 Ga0395899_0120586 3300037312 Bacteria 1879
248 Ga0395900_0000277 3300037418 Bacteria 77256
249 Ga0395900_0001234 3300037418 Bacteria 31453
250 Ga0395900_0019640 3300037418 Bacteria 6889
251 Ga0395898_0124571 3300037466 Bacteria 2469
252 Ga0395905_0000068 3300037471 Bacteria 177163
253 Ga0395905_0004443 3300037471 Bacteria 14577
254 Ga0395901_0005268 3300038443 Bacteria 13060
255 Ga0395901_0125253 3300038443 Bacteria 2700
256 Ga0436361_0742208 3300039447 Bacteria 6052
257 Ga0451791_0011005 3300041451 Bacteria 821
258 Ga0451802_0423201 3300041460 Bacteria 757
259 Ga0451833_0557083 3300041491 Bacteria 1088
260 Ga0451837_0647620 3300041494 Bacteria 3594
261 Ga0451841_0624971 3300041498 Bacteria 679
262 Ga0451851_1104605 3300041507 Bacteria 1494
263 Ga0439445_0130502 3300042004 Bacteria 725
264 Ga0451577_1005510 3300042876 Bacteria 749
265 Ga0466966_0014415 3300044684 Bacteria 5233
266 Ga0466961_0206857 3300044693 Bacteria 1212
267 Ga0453684_0051748 3300044712 Bacteria 5379
268 Ga0495627_006270 3300046453 Bacteria 4674
269 Ga0495651_0140018 3300046462 Bacteria 1756
270 Ga0495650_0000132 3300046471 Bacteria 174226
271 Ga0495650_0070836 3300046471 Bacteria 1368
272 Ga0495585_0000093 3300046492 Bacteria 94793
273 Ga0495585_0001039 3300046492 Bacteria 23036
274 Ga0495585_0166108 3300046492 Bacteria 1143
275 Ga0495606_0183105 3300046507 Bacteria 1206
276 Ga0495606_0281562 3300046507 Bacteria 909
277 Ga0495610_0001847 3300046512 Bacteria 18358
278 Ga0495616_0022703 3300046513 Bacteria 3385
279 Ga0495616_0033587 3300046513 Bacteria 2671
280 Ga0495644_0006779 3300046523 Bacteria 4436
281 Ga0495648_0009158 3300046524 Bacteria 7717
282 Ga0495648_0027664 3300046524 Bacteria 3792
283 Ga0495652_0075813 3300046529 Bacteria 2792
284 Ga0495652_0216224 3300046529 Bacteria 1443
285 Ga0495609_0004664 3300046538 Bacteria 7432
286 Ga0495622_0062398 3300046557 Bacteria 1725
287 Ga0495633_0000035 3300046558 Bacteria 185403
288 Ga0495633_0005241 3300046558 Bacteria 7996
289 Ga0495668_0000032 3300046616 Bacteria 254951
290 Ga0495625_0000036 3300046660 Bacteria 221680
291 Ga0495625_0001432 3300046660 Bacteria 29071
292 Ga0495625_0010825 3300046660 Bacteria 7505
293 Ga0495625_0136531 3300046660 Bacteria 1657
294 Ga0495625_0222219 3300046660 Bacteria 1237
295 Ga0495661_0000707 3300046665 Bacteria 33018
296 Ga0495661_0004419 3300046665 Bacteria 10151
297 Ga0495588_0170192 3300046674 Bacteria 1152
298 Ga0495658_0091793 3300046683 Bacteria 1799
299 Ga0495669_0198884 3300046684 Bacteria 958
300 Ga0495671_0185332 3300046692 Bacteria 1011
301 Ga0495649_0000017 3300046694 Bacteria 221685
302 Ga0495649_0114727 3300046694 Bacteria 1427
303 Ga0495589_0239284 3300046794 Bacteria 850
304 Ga0495660_0009135 3300046810 Bacteria 5788
305 Ga0495660_0232546 3300046810 Bacteria 863
306 Ga0495683_0022996 3300047323 Bacteria 3204
307 Ga0495687_016125 3300047443 Bacteria 3768
308 Ga0495687_045438 3300047443 Bacteria 1901
309 Ga0495686_0001209 3300047472 Bacteria 29698
310 Ga0495686_0001825 3300047472 Bacteria 21435
311 Ga0495686_0182224 3300047472 Bacteria 1216
312 Ga0495686_0382281 3300047472 Bacteria 759
313 Ga0495686_0449952 3300047472 Bacteria 684
314 Ga0496115_0043219 3300048918 Bacteria 3593
315 Ga0496125_0000031 3300048928 Bacteria 365156
316 Ga0496126_0001893 3300048929 Bacteria 30186
317 Ga0495678_006363 3300049459 Bacteria 6298
318 Ga0495682_0064158 3300049460 Bacteria 1324
319 Ga0501033_0108285 3300049570 Bacteria 2024
320 Ga0501038_0748321 3300049574 Unclassified 729
321 nmdc:mga0k408_386_c1 3300050493 Bacteria 24235
322 nmdc:mga0qj67_72687_c1 3300050509 Bacteria 2746
323 nmdc:mga08y16_11789_c1 3300050511 Bacteria 9185
324 Ga0500578_0185983 3300053086 Bacteria 1278
325 Ga0500647_0131867 3300053091 Bacteria 1178
326 Ga0500641_0000115 3300053096 Bacteria 30968
327 Ga0500594_0087086 3300053118 Bacteria 943
328 Ga0500608_063704 3300053122 Bacteria 1759
329 Ga0500618_000003 3300053125 Bacteria 338706
330 Ga0500618_037605 3300053125 Bacteria 1118
331 Ga0500619_091777 3300053154 Bacteria 1026
332 Ga0500622_0144443 3300053156 Bacteria 1131
333 Ga0500624_000694 3300053157 Bacteria 8505
334 2513233361 2513020052 Bacteria 5120511
335 2520881807 2519899754 Bacteria 5336938
336 2740002591 2739367857 Bacteria 5433684
337 2740007407 2739367858 Bacteria 5432813
338 2740031201 2739367866 Bacteria 4215900
339 2833640324 2833640130 Bacteria 4858325
340 2852626924 2852623160 Bacteria 4376875
341 2881250131 2881247448 Bacteria 3717788
342 2884938024 2884933994 Bacteria 4535041
343 2910249564 2910245624 Bacteria 6935613
344 2919442229 2919437846 Bacteria 6199444
345 2919512290 2919509842 Bacteria 4104664
346 2958458979 2958458903 Bacteria 5301041
347 2958515438 2958512119 Bacteria 4528530
348 2965322213 2965320100 Bacteria 3975600
349 8036738191 8036736890 Bacteria 2944828
350 8056440308 8056440228 Bacteria 4946504
351 Ga0495606_0025024
352 JGI24736J21556_1005764
353 JGI24740J21852_10037081
354 JGI24743J22301_10013148
355 JGI25162J39368_1000089
356 JGI25162J39368_1000498
357 JGI25165J46597_1000618
358 JGI25165J46597_1033471
359 rootH2_10018591
360 rootH2_10095836
361 rootH1_10017540
362 rootH1_10093143
363 rootH1_10100036
364 rootH1_10286877
365 Ga0065714_10011084
366 Ga0065714_10079220
367 Ga0065714_10115562
368 Ga0065714_10184441
369 Ga0065715_10365105
370 Ga0070658_10000018
371 Ga0070658_10099802
372 Ga0070658_10133225
373 Ga0070676_10000642
374 Ga0070683_100035829
375 Ga0068869_100106693
376 Ga0068868_100013908
377 Ga0068868_100027571
378 Ga0070660_100031635
379 Ga0070660_100054015
380 Ga0070660_100166420
381 Ga0070660_100374280
382 Ga0070671_100023057
383 Ga0070674_100055726
384 Ga0070673_100271414
385 Ga0070659_100000292
386 Ga0070659_100066937
387 Ga0070710_10664268
388 Ga0070678_100018207
389 Ga0070662_100000626
390 Ga0070662_100149288
391 Ga0070681_10022542
392 Ga0070679_100155987
393 Ga0070679_100413028
394 Ga0068853_100101143
395 Ga0068853_100191308
396 Ga0068855_100000070
397 Ga0068855_100000268
398 Ga0068855_100037071
399 Ga0068855_100704975
400 Ga0068855_100727213
401 Ga0068855_101293569
402 Ga0068857_100036027
403 Ga0068856_100000899
404 Ga0068856_100009016
405 Ga0068856_100068505
406 Ga0068856_100113651
407 Ga0068852_100019512
408 Ga0068852_100097079
409 Ga0068852_100323590
410 Ga0068852_100778098
411 Ga0068851_10419390
412 Ga0068858_100181062
413 Ga0081539_10010598
414 Ga0075366_10001061
415 Ga0097621_100000878
416 Ga0068871_100006906
417 Ga0075428_100010944
418 Ga0075430_100334530
419 Ga0068865_100000127
420 Ga0105240_10008851
421 Ga0105240_10059080
422 Ga0105240_10082406
423 Ga0105240_10198436
424 Ga0105240_10249747
425 Ga0105240_10266263
426 Ga0105240_10456752
427 Ga0111539_10003202
428 Ga0105245_10115881
429 Ga0105241_10014160
430 Ga0105241_10016950
431 Ga0105241_10019885
432 Ga0105241_10047248
433 Ga0105241_10052774
434 Ga0105241_10205178
435 Ga0105242_10060938
436 Ga0105237_10000224
437 Ga0105237_10000485
438 Ga0105237_10001308
439 Ga0105237_10007484
440 Ga0105237_10129481
441 Ga0105237_10712787
442 Ga0105237_11226451
443 Ga0105238_10105636
444 Ga0105238_10124027
445 Ga0105238_11221178
446 Ga0105239_10000039
447 Ga0105239_10000120
448 Ga0105239_10000987
449 Ga0105239_10005560
450 Ga0105239_10012917
451 Ga0105239_10013753
452 Ga0105239_10023687
453 Ga0105239_10068194
454 Ga0105239_10118182
455 Ga0105239_10202029
456 Ga0105239_10458729
457 Ga0105239_10744941
458 Ga0105246_10043748
459 Ga0105246_10823269
460 Ga0157373_10000205
461 Ga0157373_10003515
462 Ga0157373_10043334
463 Ga0157371_10000263
464 Ga0157371_10005281
465 Ga0157370_10000449
466 Ga0157370_10044499
467 Ga0157370_10074075
468 Ga0157370_10556733
469 Ga0157369_10014846
470 Ga0157369_10142078
471 Ga0157369_10733280
472 Ga0157374_10001845
473 Ga0157374_10009022
474 Ga0157374_10044113
475 Ga0157374_10068545
476 Ga0157374_10159603
477 Ga0157374_10336959
478 Ga0157374_10345164
479 Ga0157374_10802699
480 Ga0157374_11171013
481 Ga0157378_10012553
482 Ga0163162_10000010
483 Ga0163162_10030319
484 Ga0163162_10213876
485 Ga0163162_10249542
486 Ga0163162_10641863
487 Ga0163162_10806739
488 Ga0157372_10000050
489 Ga0157372_10000635
490 Ga0157372_10002192
491 Ga0157372_10052596
492 Ga0157375_10005903
493 Ga0157375_10126604
494 Ga0157375_11384892
495 Ga0182008_10088827
496 Ga0157377_10006123
497 Ga0163161_10014162
498 Ga0163161_10043434
499 Ga0163161_10068723
500 Ga0163161_10132627
501 Ga0213872_10006890
502 Ga0209563_107363
503 Ga0207427_100359
504 Ga0209437_100034
505 Ga0209437_100221
506 Ga0209026_1000739
507 Ga0209026_1003634
508 Ga0209129_1011462
509 Ga0209233_1000038
510 Ga0209233_1005850
511 Ga0209233_1006383
512 Ga0209455_1000861
513 Ga0207647_10000076
514 Ga0207647_10012704
515 Ga0207645_10018663
516 Ga0207705_10000036
517 Ga0207705_10094626
518 Ga0207654_10003136
519 Ga0207654_10007603
520 Ga0207654_10015094
521 Ga0207654_10293743
522 Ga0207695_10000916
523 Ga0207695_10004656
524 Ga0207695_10065391
525 Ga0207695_10087055
526 Ga0207695_10489661
527 Ga0207695_10511617
528 Ga0207671_10002624
529 Ga0207671_10006239
530 Ga0207671_10008271
531 Ga0207671_10040826
532 Ga0207671_10106479
533 Ga0207671_10219246
534 Ga0207660_10194388
535 Ga0207657_10020956
536 Ga0207657_10333491
537 Ga0207657_10373791
538 Ga0207652_10034681
539 Ga0207694_10769530
540 Ga0207694_10828652
541 Ga0207687_10226983
542 Ga0207644_10015452
543 Ga0207690_10000311
544 Ga0207690_10003941
545 Ga0207706_10006487
546 Ga0207686_10100625
547 Ga0207669_10422711
548 Ga0207704_10000044
549 Ga0207667_10000009
550 Ga0207667_10000971
551 Ga0207667_10021526
552 Ga0207667_10167503
553 Ga0207667_10295878
554 Ga0207667_10494455
555 Ga0207651_10206985
556 Ga0207640_10334042
557 Ga0207677_10016554
558 Ga0207703_10173828
559 Ga0207639_10004531
560 Ga0207639_10401214
561 Ga0207639_10830426
562 Ga0207678_10028584
563 Ga0207702_10000507
564 Ga0207702_10031437
565 Ga0207702_10094321
566 Ga0207702_10164054
567 Ga0207702_10302540
568 Ga0207648_10002139
569 Ga0207674_10051052
570 Ga0207683_10031312
571 Ga0207698_10005251
572 Ga0207698_10079196
573 Ga0207698_10267932
574 Ga0268266_10000089
575 Ga0307515_10001481
576 Ga0307515_10006233
577 Ga0307515_10273863
578 Ga0265338_10023639
579 Ga0316182_1063435
580 Ga0265332_10229002
581 Ga0265320_10047105
582 Ga0265329_10045851
583 Ga0265331_10030773
584 Ga0265327_10166551
585 Ga0307408_100000055
586 Ga0265314_10016103
587 Ga0307516_10592353
588 Ga0307413_10428463
589 Ga0307412_10399757
590 Ga0307414_10005937
591 Ga0307411_10035287
592 Ga0307507_10000345
593 Ga0307510_10006636
594 Ga0373941_0048695
595 Ga0395899_0000659
596 Ga0395899_0001109
597 Ga0395899_0120586
598 Ga0395900_0000277
599 Ga0395900_0001234
600 Ga0395900_0019640
601 Ga0395898_0124571
602 Ga0395905_0000068
603 Ga0395905_0004443
604 Ga0395901_0005268
605 Ga0395901_0125253
606 Ga0436361_0742208
607 Ga0451791_0011005
608 Ga0451802_0423201
609 Ga0451833_0557083
610 Ga0451837_0647620
611 Ga0451841_0624971
612 Ga0451851_1104605
613 Ga0439445_0130502
614 Ga0451577_1005510
615 Ga0466966_0014415
616 Ga0466961_0206857
617 Ga0453684_0051748
618 Ga0495627_006270
619 Ga0495651_0140018
620 Ga0495650_0000132
621 Ga0495650_0070836
622 Ga0495585_0000093
623 Ga0495585_0001039
624 Ga0495585_0166108
625 Ga0495606_0183105
626 Ga0495606_0281562
627 Ga0495610_0001847
628 Ga0495616_0022703
629 Ga0495616_0033587
630 Ga0495644_0006779
631 Ga0495648_0009158
632 Ga0495648_0027664
633 Ga0495652_0075813
634 Ga0495652_0216224
635 Ga0495609_0004664
636 Ga0495622_0062398
637 Ga0495633_0000035
638 Ga0495633_0005241
639 Ga0495668_0000032
640 Ga0495625_0000036
641 Ga0495625_0001432
642 Ga0495625_0010825
643 Ga0495625_0136531
644 Ga0495625_0222219
645 Ga0495661_0000707
646 Ga0495661_0004419
647 Ga0495588_0170192
648 Ga0495658_0091793
649 Ga0495669_0198884
650 Ga0495671_0185332
651 Ga0495649_0000017
652 Ga0495649_0114727
653 Ga0495589_0239284
654 Ga0495660_0009135
655 Ga0495660_0232546
656 Ga0495683_0022996
657 Ga0495687_016125
658 Ga0495687_045438
659 Ga0495686_0001209
660 Ga0495686_0001825
661 Ga0495686_0182224
662 Ga0495686_0382281
663 Ga0495686_0449952
664 Ga0496115_0043219
665 Ga0496125_0000031
666 Ga0496126_0001893
667 Ga0495678_006363
668 Ga0495682_0064158
669 Ga0501033_0108285
670 Ga0501038_0748321
671 nmdc:mga0k408_386_c1
672 nmdc:mga0qj67_72687_c1
673 nmdc:mga08y16_11789_c1
674 Ga0500578_0185983
675 Ga0500647_0131867
676 Ga0500641_0000115
677 Ga0500594_0087086
678 Ga0500608_063704
679 Ga0500618_000003
680 Ga0500618_037605
681 Ga0500619_091777
682 Ga0500622_0144443
683 Ga0500624_000694
684 2513233361
685 2520881807
686 2740002591
687 2740007407
688 2740031201
689 2833640324
690 2852626924
691 2881250131
692 2884938024
693 2910249564
694 2919442229
695 2919512290
696 2958458979
697 2958515438
698 2965322213
699 8036738191
700 8056440308

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01923

Cob_adeno_trans

Cobalamin adenosyltransferase

39

203

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5im6-assembly1.cif.gz_A crystal structure of designed two-component self-assembling icosahedral cage i32-28 0.9583 26 179
2zhy-assembly1.cif.gz_A crystal structure of a pduo-type atp:cobalamin adenosyltransferase from burkholderia thailandensis 0.9543 26 176
7ruu-assembly2.cif.gz_D structure of human atp:cobalamin adenosyltransferase r190c bound to adenosylcobalamin 0.9514 26 180
5cy5-assembly1.cif.gz_A crystal structure of the t33-51h designed self-assembling protein tetrahedron 0.9382 26 172
2zhy-assembly1.cif.gz_A crystal structure of a pduo-type atp:cobalamin adenosyltransferase from burkholderia thailandensis 0.9361 26 176
ID Description Score Start End Superfamily
2zhzB01 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9553 13 179 1.20.1200.10
2zhzB01 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.944 13 179 1.20.1200.10
5cy5A00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9382 26 172 1.20.1200.10
1wvtA00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9362 23 179 1.20.1200.10
2idxA00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9334 26 180 1.20.1200.10
ID Description Score Start End GO Terms
AF-A0A3C2E9L9-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9909 89 181 GO:0005524
GO:0008817
GO:0009236
AF-A0A524H4I9-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9871 93 180 GO:0005524
GO:0008817
GO:0009236
AF-A0A2T0U551-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9845 1 182 GO:0005524
GO:0008817
GO:0009236
AF-A0A382NIU5-F1-model_v4 Cobalamin adenosyltransferase-like domain-containing protein 0.9817 85 182 GO:0005524
GO:0008817
AF-A0A257RYL1-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9802 86 178 GO:0005524
GO:0008817
GO:0009236

Map