F418376

General Info

Members Datasets Scaffolds Average Seq Length
350 257 177 267

Family's Representative Sequence

Representative Sequence 3300046694|Ga0495649_0102773|Ga0495649_0102773_159_1019
Length 286
Sequence LLWEKKVCKKFKKRRWLGIMSIPVIYVVSDSVGETAELVTKAAITQFNGSGMILKRFPYVEDKEHIDEVISLVKMDKGMIAFTLVKPDMREYIQNAAEKEGIYACDLIGPLMDQIQELTGKVPLCEPGLVRKLDEDYFKKVEAIEFAVKYDDGRDPRGIMKADIVLIGVSRTSKTPLSQYLALKRLKVANVPLVPEVEPPEELYKVPPEKCFGLKISPEKLNNIRRERLISLGLNDQASYANIERIKEELVFFEKVVSRINCPIIDVTNKAVEETANEILNFIHKR

Samples

Sample ID Description Type Environment
1 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
2 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
3 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
4 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
5 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
6 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
7 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
8 2554235283 Bacillus safensis VK Isolate Rhizosphere
9 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
10 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
11 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
12 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
13 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
14 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
15 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
16 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
17 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
18 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
19 2643221729 Bacillus sp. Root11 Isolate Unclassified
20 2643221730 Bacillus sp. Root131 Isolate Unclassified
21 2643221731 Bacillus sp. Root147 Isolate Unclassified
22 2643221732 Bacillus sp. Root239 Isolate Unclassified
23 2643221735 Bacillus sp. Root920 Isolate Unclassified
24 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
25 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
26 2671180694 Paenibacillus sp. A3 Isolate Unclassified
27 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
28 2684622632 Bacillus cereus 905 Isolate Unclassified
29 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
30 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
31 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
32 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
33 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
34 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
35 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
36 2738541295 Bacillus sp. OK085 Isolate Unclassified
37 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
38 2738541358 Bacillus sp. OV752 Isolate Unclassified
39 2738543006 Bacillus sp. OK077 Isolate Unclassified
40 2738543010 Bacillus sp. YR335 Isolate Unclassified
41 2738543017 Bacillus sp. OV186 Isolate Unclassified
42 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
43 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
44 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
45 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
46 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
47 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
48 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
49 2811994870 Bacillus sp. JB4 Isolate Unclassified
50 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
51 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
52 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
53 2818991441 Niallia circulans 3243 Isolate Rhizosphere
54 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
55 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
56 2818991459 Paenibacillus sp. 597 Isolate Unclassified
57 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
58 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
59 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
60 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
61 2842682962 Bacillus sp. R-72492 Isolate Unclassified
62 2842882022 Bacillus sp. R-71893 Isolate Unclassified
63 2849139964 Bacillus sp. R-71875 Isolate Unclassified
64 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
65 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
66 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
67 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
68 2857472729 Cohnella sp. R-74144 Isolate Unclassified
69 2857581216 Bacillus sp. R-71922 Isolate Unclassified
70 2857586860 Bacillus sp. R-71935 Isolate Unclassified
71 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
72 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
73 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
74 2860837431 Bacillus sp. WR11 Isolate Unclassified
75 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
76 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
77 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
78 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
79 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
80 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
81 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
82 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
83 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
84 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
85 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
86 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
87 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
88 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
89 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
90 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
91 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
92 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
93 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
94 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
95 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
96 2919720352 Priestia megaterium 4340 Isolate Unclassified
97 2919726948 Bacillus pumilus 4489 Isolate Unclassified
98 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
99 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
100 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
101 2929004312 Priestia megaterium 1104 Isolate Unclassified
102 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
103 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
104 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
105 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
106 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
107 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
108 2938917290 Bacillus sp. CR71 Isolate Unclassified
109 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
110 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
111 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
112 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
113 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
114 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
115 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
116 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
117 2965761152 Bacillus sp. COPE52 Isolate Unclassified
118 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
119 2969141011 Bacillus velezensis MH25 Isolate Unclassified
120 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
121 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
122 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
123 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
124 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
125 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
126 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
127 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
128 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
129 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
130 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
131 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
132 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
133 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
134 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
135 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
136 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
137 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
138 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
139 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
140 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
141 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
142 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
143 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
144 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
145 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
146 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
147 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
148 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
149 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
150 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
151 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
152 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
153 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
154 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
155 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
156 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
157 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
158 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
159 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
160 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
161 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
162 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
163 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
164 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
165 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
166 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
173 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
174 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
180 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
181 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
189 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
190 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
191 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
239 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
240 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
241 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
242 8022653035 Bacillus sp. Rc4 Isolate Unclassified
243 8022792930 Bacillus sp. Xin Isolate Rhizosphere
244 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
245 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
246 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
247 8023438354 Bacillus sp. BH2 Isolate Unclassified
248 8023444577 Bacillus sp. BH32 Isolate Unclassified
249 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
250 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
251 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
252 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
253 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
254 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
255 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
256 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
257 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 42.57
Metatranscriptomes 8
Isolates 49.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.86
Nodule 0.57
Rhizoplane 7.14
Rhizosphere 47.43
Stem 0
Stem Tuber 0
Unclassified 30

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000006 3300003187 Bacteria 419711
2 JGI25151J46595_10006593 3300003187 Bacteria 5806
3 JGI25151J46595_10008020 3300003187 Bacteria 5119
4 JGI25151J46595_10009449 3300003187 Bacteria 4615
5 JGI25151J46595_10011908 3300003187 Bacteria 3977
6 JGI25151J46595_10014848 3300003187 Bacteria 3456
7 JGI25151J46595_10018886 3300003187 Bacteria 2945
8 JGI25151J46595_10049893 3300003187 Bacteria 1431
9 JGI25151J46595_10057001 3300003187 Bacteria 1277
10 JGI25151J46595_10075917 3300003187 Bacteria 995
11 JGI25151J46595_10089862 3300003187 Bacteria 859
12 rootH1_10000457 3300003316 Bacteria 39363
13 rootH2_10056773 3300003320 Bacteria 5708
14 rootL2_10004995 3300003322 Bacteria 33898
15 Ga0006562J51391_1001146 3300003578 Bacteria 47560
16 Ga0006562J51391_1001176 3300003578 Bacteria 6340
17 Ga0006562J51391_1001442 3300003578 Bacteria 20940
18 Ga0006562J51391_1004050 3300003578 Bacteria 4220
19 Ga0055538_1000233 3300003751 Bacteria 30999
20 Ga0055532_1000046 3300003758 Bacteria 182389
21 Ga0055532_1002155 3300003758 Bacteria 4396
22 Ga0055536_1027134 3300003781 Bacteria 1591
23 Ga0055528_1001481 3300003790 Bacteria 14268
24 Ga0105251_10057237 3300009011 Bacteria 1843
25 Ga0105244_10042031 3300009036 Bacteria 2366
26 Ga0105244_10065846 3300009036 Bacteria 1814
27 Ga0105244_10081969 3300009036 Bacteria 1595
28 Ga0105244_10109846 3300009036 Bacteria 1342
29 Ga0105250_10001260 3300009092 Bacteria 13993
30 Ga0105250_10044980 3300009092 Bacteria 1770
31 Ga0105250_10101796 3300009092 Bacteria 1172
32 Ga0105247_10004353 3300009101 Bacteria 9053
33 Ga0105243_10002181 3300009148 Bacteria 16523
34 Ga0105242_10001993 3300009176 Bacteria 16071
35 Ga0105239_11103572 3300010375 Bacteria 913
36 Ga0105246_10000276 3300011119 Bacteria 26748
37 Ga0105246_10078381 3300011119 Bacteria 2346
38 Ga0157371_10002286 3300013102 Bacteria 18467
39 Ga0157374_10276520 3300013296 Bacteria 1657
40 Ga0157378_10003046 3300013297 Bacteria 14903
41 Ga0157377_10006785 3300014745 Bacteria 5485
42 Ga0209784_100099 3300025224 Bacteria 101738
43 Ga0209566_100022 3300025225 Bacteria 403259
44 Ga0209566_100248 3300025225 Bacteria 51716
45 Ga0209147_100014 3300025229 Bacteria 597841
46 Ga0209147_100068 3300025229 Bacteria 230150
47 Ga0209147_100519 3300025229 Bacteria 22359
48 Ga0209147_100618 3300025229 Bacteria 19323
49 Ga0209147_109705 3300025229 Bacteria 1133
50 Ga0209673_1002814 3300025273 Bacteria 11246
51 Ga0209130_1002012 3300025284 Bacteria 11080
52 Ga0209130_1005420 3300025284 Bacteria 4426
53 Ga0209130_1008340 3300025284 Bacteria 3070
54 Ga0209130_1009149 3300025284 Bacteria 2853
55 Ga0209130_1012990 3300025284 Bacteria 2152
56 Ga0209676_1000783 3300025292 Bacteria 42336
57 Ga0209676_1002921 3300025292 Bacteria 11176
58 Ga0209676_1014882 3300025292 Bacteria 2896
59 Ga0209676_1023851 3300025292 Bacteria 1994
60 Ga0209025_1000001 3300025294 Bacteria 1888151
61 Ga0209025_1000539 3300025294 Bacteria 71638
62 Ga0209025_1001023 3300025294 Bacteria 41159
63 Ga0209025_1003755 3300025294 Bacteria 13922
64 Ga0209025_1004088 3300025294 Bacteria 13010
65 Ga0209025_1004904 3300025294 Bacteria 11258
66 Ga0209025_1005331 3300025294 Bacteria 10551
67 Ga0209025_1008720 3300025294 Bacteria 7230
68 Ga0209025_1015244 3300025294 Bacteria 4652
69 Ga0209025_1015420 3300025294 Bacteria 4606
70 Ga0209025_1020687 3300025294 Bacteria 3582
71 Ga0209025_1021371 3300025294 Bacteria 3489
72 Ga0209025_1033756 3300025294 Bacteria 2356
73 Ga0209025_1037420 3300025294 Bacteria 2153
74 Ga0209025_1050085 3300025294 Bacteria 1673
75 Ga0209025_1067542 3300025294 Bacteria 1291
76 Ga0209025_1077674 3300025294 Bacteria 1143
77 Ga0207426_1043198 3300025302 Bacteria 1386
78 Ga0207696_1001570 3300025711 Bacteria 12152
79 Ga0207696_1013027 3300025711 Bacteria 2916
80 Ga0207696_1013132 3300025711 Bacteria 2901
81 Ga0207655_1021566 3300025728 Bacteria 3265
82 Ga0207655_1101096 3300025728 Bacteria 993
83 Ga0207713_1002283 3300025735 Bacteria 14125
84 Ga0207713_1046513 3300025735 Bacteria 1764
85 Ga0207686_10008660 3300025934 Bacteria 5494
86 Ga0207709_10009372 3300025935 Bacteria 5387
87 Ga0209371_1002323 3300027312 Bacteria 10815
88 Ga0237817_10022 3300030083 Bacteria 62837
89 Ga0237817_10093 3300030083 Bacteria 27814
90 Ga0268256_1002064 3300030500 Bacteria 10815
91 Ga0307408_100007718 3300031548 Bacteria 7117
92 Ga0307408_100007773 3300031548 Bacteria 7085
93 Ga0307408_100079238 3300031548 Bacteria 2450
94 Ga0307405_10382420 3300031731 Bacteria 1096
95 Ga0307409_100349934 3300031995 Bacteria 1394
96 Ga0307416_100129396 3300032002 Bacteria 2269
97 Ga0307416_100277041 3300032002 Bacteria 1651
98 Ga0307416_100441200 3300032002 Bacteria 1352
99 Ga0316583_10000017 3300032133 Bacteria 32029
100 Ga0316583_10022209 3300032133 Bacteria 2273
101 Ga0395898_0214670 3300037466 Bacteria 1835
102 Ga0237819_00614 3300038705 Bacteria 11715
103 Ga0439449_0007880 3300042007 Bacteria 4045
104 Ga0439462_0007544 3300042015 Bacteria 2725
105 Ga0466969_0005019 3300044656 Bacteria 7043
106 Ga0466961_0315629 3300044693 Bacteria 953
107 Ga0466959_0007024 3300045049 Bacteria 7870
108 Ga0451576_0081089 3300045051 Bacteria 3375
109 Ga0466967_0000144 3300045976 Bacteria 27783
110 Ga0495603_0059502 3300046455 Bacteria 2258
111 Ga0495605_0116015 3300046474 Bacteria 1218
112 Ga0495584_0008087 3300046491 Bacteria 5467
113 Ga0495585_0006773 3300046492 Bacteria 7073
114 Ga0495661_0063086 3300046665 Bacteria 2192
115 Ga0495661_0219354 3300046665 Bacteria 986
116 Ga0495649_0102773 3300046694 Bacteria 1518
117 Ga0495649_0113993 3300046694 Bacteria 1432
118 Ga0495683_0005029 3300047323 Bacteria 7408
119 Ga0496100_0000790 3300048903 Bacteria 15074
120 Ga0496100_0158489 3300048903 Bacteria 1621
121 Ga0496101_0038190 3300048904 Bacteria 3409
122 Ga0496101_0149947 3300048904 Bacteria 1783
123 Ga0496102_0019905 3300048905 Bacteria 5918
124 Ga0496102_0159125 3300048905 Bacteria 2124
125 Ga0496103_0012475 3300048906 Bacteria 5039
126 Ga0496104_0001771 3300048907 Bacteria 18674
127 Ga0496105_0000412 3300048908 Bacteria 28052
128 Ga0496106_0000567 3300048909 Bacteria 26325
129 Ga0496107_0000227 3300048910 Bacteria 29794
130 Ga0496108_0002371 3300048911 Bacteria 15087
131 Ga0496109_0001823 3300048912 Bacteria 17696
132 Ga0496110_0018130 3300048913 Bacteria 5896
133 Ga0496110_0033997 3300048913 Bacteria 4412
134 Ga0496110_0069531 3300048913 Bacteria 3118
135 Ga0496111_0000205 3300048914 Bacteria 27749
136 Ga0496112_0005112 3300048915 Bacteria 11271
137 Ga0496112_0066480 3300048915 Bacteria 3557
138 Ga0496113_0079813 3300048916 Bacteria 2505
139 Ga0496113_0230230 3300048916 Bacteria 1478
140 Ga0496113_0364945 3300048916 Bacteria 1159
141 Ga0496116_0015025 3300048919 Bacteria 6140
142 Ga0496116_0036628 3300048919 Bacteria 3430
143 Ga0496119_0001436 3300048922 Bacteria 28717
144 Ga0496122_0003585 3300048925 Bacteria 20260
145 Ga0496122_0094227 3300048925 Unclassified 2028
146 Ga0496123_0075946 3300048926 Bacteria 2071
147 Ga0496125_0001194 3300048928 Bacteria 39236
148 Ga0496125_0010715 3300048928 Bacteria 9239
149 Ga0496125_0032992 3300048928 Bacteria 4589
150 Ga0496125_0121287 3300048928 Bacteria 1864
151 Ga0496126_0008542 3300048929 Bacteria 11039
152 Ga0501341_00478 3300049131 Bacteria 1693
153 Ga0501305_003814 3300049161 Bacteria 1734
154 Ga0501305_015465 3300049161 Bacteria 1078
155 Ga0501305_021999 3300049161 Bacteria 946
156 Ga0501315_000399 3300049531 Bacteria 2941
157 Ga0501316_002695 3300049532 Bacteria 1666
158 Ga0501317_000077 3300049533 Bacteria 4820
159 Ga0501317_000213 3300049533 Bacteria 3564
160 Ga0501317_005331 3300049533 Bacteria 1373
161 Ga0501317_016901 3300049533 Bacteria 951
162 Ga0501318_000051 3300049534 Bacteria 4702
163 Ga0501320_014976 3300049536 Bacteria 843
164 Ga0501321_000045 3300049537 Bacteria 5432
165 Ga0501321_010839 3300049537 Bacteria 1007
166 Ga0501326_00770 3300049542 Bacteria 1352
167 Ga0501332_00094 3300049548 Bacteria 2774
168 Ga0501334_01047 3300049550 Bacteria 1455
169 Ga0501335_000021 3300049551 Bacteria 6525
170 Ga0501335_000130 3300049551 Bacteria 3723
171 Ga0501335_000348 3300049551 Bacteria 2819
172 Ga0501335_007889 3300049551 Bacteria 991
173 Ga0501335_009116 3300049551 Bacteria 942
174 Ga0501337_000035 3300049553 Bacteria 4711
175 Ga0501338_00197 3300049554 Bacteria 2386
176 Ga0501072_0404931 3300049588 Bacteria 1082
177 Ga0501198_011151 3300049649 Bacteria 1337

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049551 Ga0501335_009116 Ga0501335_009116_27_740 237
2 3300049542 Ga0501326_00770 Ga0501326_00770_615_1331 238
3 3300042007 Ga0439449_0007880 Ga0439449_0007880_1532_2263 243
4 3300042015 Ga0439462_0007544 Ga0439462_0007544_734_1465 243
5 iso_pu_bacteria 2643221676 2644423147 244
6 3300048928 Ga0496125_0032992 Ga0496125_0032992_2459_3292 247
7 3300025292 Ga0209676_1002921 Ga0209676_100292113 251
8 3300048928 Ga0496125_0121287 Ga0496125_0121287_186_977 252
9 3300003758 Ga0055532_1000046 Ga0055532_100004629 255
10 3300025229 Ga0209147_100014 Ga0209147_10001490 255
11 3300048905 Ga0496102_0159125 Ga0496102_0159125_731_1543 255
12 3300003187 JGI25151J46595_10009449 JGI25151J46595_100094492 256
13 3300025294 Ga0209025_1001023 Ga0209025_100102350 256
14 3300003187 JGI25151J46595_10049893 JGI25151J46595_100498932 257
15 3300025294 Ga0209025_1015244 Ga0209025_10152443 257
16 3300049536 Ga0501320_014976 Ga0501320_014976_55_828 257
17 3300003187 JGI25151J46595_10057001 JGI25151J46595_100570011 258
18 3300025284 Ga0209130_1008340 Ga0209130_10083402 258
19 3300025294 Ga0209025_1005331 Ga0209025_100533113 258
20 iso_pu_bacteria 2929297113 2929298715 259
21 3300032002 Ga0307416_100277041 Ga0307416_1002770412 263
22 iso_pu_bacteria 2643221731 2644715771 263
23 iso_pu_bacteria 2643221732 2644727493 263
24 iso_pu_bacteria 2738541299 2738839238 263
25 iso_pu_bacteria 2818991465 2819709242 263
26 iso_pu_bacteria 2842882022 2842884512 263
27 iso_pu_bacteria 2904524088 2904524458 263
28 iso_pu_bacteria 2919143609 2919146965 263
29 iso_pu_bacteria 2919517244 2919518869 263
30 iso_pu_bacteria 2919720352 2919723236 263
31 iso_pu_bacteria 2928093941 2928096237 263
32 iso_pu_bacteria 2929004312 2929006392 263
33 iso_pu_bacteria 2960319331 2960319857 263
34 iso_pu_bacteria 2960375949 2960380932 263
35 iso_pu_bacteria 8002317523 8002321850 263
36 iso_pu_bacteria 8022893055 8022898186 263
37 iso_pu_bacteria 8022914991 8022917365 263
38 iso_pu_bacteria 8046991243 8046999146 263
39 3300025225 Ga0209566_100022 Ga0209566_100022125 264
40 iso_pu_bacteria 2808606364 2808869477 264
41 iso_pu_bacteria 2818991459 2819669380 264
42 iso_pu_bacteria 2919425241 2919429775 264
43 iso_pu_bacteria 3001267043 3001268420 264
44 iso_pu_bacteria 3006969106 3006972221 264
45 iso_pu_bacteria 3006973921 3006975962 264
46 iso_pu_bacteria 3006984091 3006984523 264
47 iso_pu_bacteria 3006988479 3006988941 264
48 iso_pu_bacteria 2551306519 2553393333 265
49 iso_pu_bacteria 2571042588 2573041239 265
50 iso_pu_bacteria 2576861424 2578335590 265
51 iso_pu_bacteria 2593339131 2595089484 265
52 iso_pu_bacteria 2619619294 2621273823 265
53 iso_pu_bacteria 2643221729 2644708071 265
54 iso_pu_bacteria 2643221730 2644714800 265
55 iso_pu_bacteria 2684622632 2685152269 265
56 iso_pu_bacteria 2695420987 2698320892 265
57 iso_pu_bacteria 2703719227 2705996209 265
58 iso_pu_bacteria 2718218445 2721507428 265
59 iso_pu_bacteria 2738541295 2738813901 265
60 iso_pu_bacteria 2738541358 2739154530 265
61 iso_pu_bacteria 2738543006 2739208098 265
62 iso_pu_bacteria 2738543017 2739270419 265
63 iso_pu_bacteria 2757320391 2757567937 265
64 iso_pu_bacteria 2775507177 2777761054 265
65 iso_pu_bacteria 2775507192 2777839328 265
66 iso_pu_bacteria 2818991441 2819571541 265
67 iso_pu_bacteria 2818991443 2819583188 265
68 iso_pu_bacteria 2857472729 2857478744 265
69 iso_pu_bacteria 2857586860 2857590616 265
70 iso_pu_bacteria 2881636855 2881640526 265
71 iso_pu_bacteria 2919414237 2919417171 265
72 iso_pu_bacteria 2929233124 2929237970 265
73 iso_pu_bacteria 2936340661 2936341214 265
74 iso_pu_bacteria 2936361878 2936367403 265
75 iso_pu_bacteria 2938917290 2938922159 265
76 iso_pu_bacteria 2947426588 2947431055 265
77 iso_pu_bacteria 2956897341 2956902084 265
78 iso_pu_bacteria 2965761152 2965765572 265
79 iso_pu_bacteria 2971511577 2971514982 265
80 iso_pu_bacteria 2977254563 2977256562 265
81 iso_pu_bacteria 2979083700 2979087958 265
82 iso_pu_bacteria 2980176882 2980181088 265
83 iso_pu_bacteria 2990275345 2990277431 265
84 iso_pu_bacteria 3001892409 3001897756 265
85 iso_pu_bacteria 8022621104 8022624201 265
86 iso_pu_bacteria 8022792930 8022796894 265
87 iso_pu_bacteria 8022948649 8022949866 265
88 iso_pu_bacteria 8023438354 8023443117 265
89 iso_pu_bacteria 8023444577 8023445164 265
90 iso_pu_bacteria 8057582654 8057586730 265
91 3300032133 Ga0316583_10000017 Ga0316583_1000001725 266
92 3300032133 Ga0316583_10022209 Ga0316583_100222091 266
93 3300046694 Ga0495649_0113993 Ga0495649_0113993_490_1323 266
94 3300048919 Ga0496116_0015025 Ga0496116_0015025_584_1393 266
95 iso_pu_bacteria 2511231119 2511700314 266
96 iso_pu_bacteria 2512564039 2512735005 266
97 iso_pu_bacteria 2540341094 2540607457 266
98 iso_pu_bacteria 2545555800 2545556996 266
99 iso_pu_bacteria 2576861599 2578931252 266
100 iso_pu_bacteria 2593339198 2595316421 266
101 iso_pu_bacteria 2599185353 2600198517 266
102 iso_pu_bacteria 2648501850 2651531808 266
103 iso_pu_bacteria 2671180694 2673823179 266
104 iso_pu_bacteria 2671180844 2674418874 266
105 iso_pu_bacteria 2695420354 2695628292 266
106 iso_pu_bacteria 2716884898 2717916005 266
107 iso_pu_bacteria 2788500588 2791214373 266
108 iso_pu_bacteria 2808606399 2809055857 266
109 iso_pu_bacteria 2816332295 2817480812 266
110 iso_pu_bacteria 2818991451 2819628549 266
111 iso_pu_bacteria 2857453340 2857459322 266
112 iso_pu_bacteria 2857604169 2857606334 266
113 iso_pu_bacteria 2857609550 2857610770 266
114 iso_pu_bacteria 2860837431 2860840150 266
115 iso_pu_bacteria 2864997549 2864999989 266
116 iso_pu_bacteria 2877768649 2877771198 266
117 iso_pu_bacteria 2880169592 2880172062 266
118 iso_pu_bacteria 2889295896 2889296092 266
119 iso_pu_bacteria 2897109615 2897112275 266
120 iso_pu_bacteria 2904560550 2904562152 266
121 iso_pu_bacteria 2904606771 2904607806 266
122 iso_pu_bacteria 2916971899 2916973762 266
123 iso_pu_bacteria 2925326138 2925330115 266
124 iso_pu_bacteria 2939593269 2939594859 266
125 iso_pu_bacteria 2962290636 2962293428 266
126 iso_pu_bacteria 2964375228 2964378249 266
127 iso_pu_bacteria 2969136845 2969139436 266
128 iso_pu_bacteria 2969141011 2969143645 266
129 iso_pu_bacteria 2969765954 2969767405 266
130 iso_pu_bacteria 2969770375 2969773282 266
131 iso_pu_bacteria 2971410472 2971417336 266
132 iso_pu_bacteria 2971893375 2971895844 266
133 iso_pu_bacteria 2980125574 2980125857 266
134 iso_pu_bacteria 2980492589 2980495191 266
135 iso_pu_bacteria 2981284811 2981287835 266
136 iso_pu_bacteria 2981289755 2981292453 266
137 iso_pu_bacteria 2981980479 2981983454 266
138 iso_pu_bacteria 2981985349 2981988509 266
139 iso_pu_bacteria 3001272096 3001273892 266
140 iso_pu_bacteria 3006858327 3006861171 266
141 iso_pu_bacteria 3006879489 3006881656 266
142 iso_pu_bacteria 8022630665 8022631939 266
143 iso_pu_bacteria 8022653035 8022654317 266
144 iso_pu_bacteria 8051952484 8051955229 266
145 iso_pu_bacteria 8052174270 8052176121 266
146 iso_pu_bacteria 8054280661 8054281160 266
147 iso_pu_bacteria 8055531788 8055535382 266
148 iso_pu_bacteria 8056533031 8056540042 266
149 3300003187 JGI25151J46595_10008020 JGI25151J46595_100080205 267
150 3300003187 JGI25151J46595_10075917 JGI25151J46595_100759171 267
151 3300003316 rootH1_10000457 rootH1_1000045726 267
152 3300003320 rootH2_10056773 rootH2_100567736 267
153 3300003322 rootL2_10004995 rootL2_1000499522 267
154 3300003578 Ga0006562J51391_1001442 Ga0006562J51391_100144215 267
155 3300003790 Ga0055528_1001481 Ga0055528_10014815 267
156 3300009101 Ga0105247_10004353 Ga0105247_100043539 267
157 3300009148 Ga0105243_10002181 Ga0105243_100021815 267
158 3300009176 Ga0105242_10001993 Ga0105242_1000199310 267
159 3300010375 Ga0105239_11103572 Ga0105239_111035721 267
160 3300011119 Ga0105246_10000276 Ga0105246_1000027621 267
161 3300013296 Ga0157374_10276520 Ga0157374_102765202 267
162 3300013297 Ga0157378_10003046 Ga0157378_100030468 267
163 3300014745 Ga0157377_10006785 Ga0157377_100067855 267
164 3300025229 Ga0209147_100618 Ga0209147_1006181 267
165 3300025229 Ga0209147_109705 Ga0209147_1097051 267
166 3300025273 Ga0209673_1002814 Ga0209673_10028148 267
167 3300025294 Ga0209025_1015420 Ga0209025_10154206 267
168 3300025302 Ga0207426_1043198 Ga0207426_10431982 267
169 3300025711 Ga0207696_1001570 Ga0207696_10015709 267
170 3300025728 Ga0207655_1101096 Ga0207655_11010961 267
171 3300025735 Ga0207713_1002283 Ga0207713_10022838 267
172 3300025934 Ga0207686_10008660 Ga0207686_100086605 267
173 3300025935 Ga0207709_10009372 Ga0207709_100093721 267
174 3300031548 Ga0307408_100007718 Ga0307408_1000077182 267
175 3300032002 Ga0307416_100441200 Ga0307416_1004412002 267
176 3300046455 Ga0495603_0059502 Ga0495603_0059502_786_1589 267
177 3300046491 Ga0495584_0008087 Ga0495584_0008087_2323_3126 267
178 3300046492 Ga0495585_0006773 Ga0495585_0006773_4245_5048 267
179 3300046694 Ga0495649_0102773 Ga0495649_0102773_159_1019 267
180 3300047323 Ga0495683_0005029 Ga0495683_0005029_5208_6011 267
181 3300048903 Ga0496100_0000790 Ga0496100_0000790_6491_7294 267
182 3300048904 Ga0496101_0038190 Ga0496101_0038190_477_1280 267
183 3300048905 Ga0496102_0019905 Ga0496102_0019905_3890_4693 267
184 3300048906 Ga0496103_0012475 Ga0496103_0012475_477_1280 267
185 3300048907 Ga0496104_0001771 Ga0496104_0001771_8206_9009 267
186 3300048908 Ga0496105_0000412 Ga0496105_0000412_477_1280 267
187 3300048909 Ga0496106_0000567 Ga0496106_0000567_1380_2183 267
188 3300048910 Ga0496107_0000227 Ga0496107_0000227_19326_20129 267
189 3300048911 Ga0496108_0002371 Ga0496108_0002371_6260_7063 267
190 3300048912 Ga0496109_0001823 Ga0496109_0001823_1143_1946 267
191 3300048913 Ga0496110_0018130 Ga0496110_0018130_817_1620 267
192 3300048914 Ga0496111_0000205 Ga0496111_0000205_7566_8369 267
193 3300048915 Ga0496112_0005112 Ga0496112_0005112_3978_4781 267
194 3300048916 Ga0496113_0079813 Ga0496113_0079813_477_1280 267
195 3300048919 Ga0496116_0036628 Ga0496116_0036628_1619_2422 267
196 3300048922 Ga0496119_0001436 Ga0496119_0001436_701_1504 267
197 3300048925 Ga0496122_0003585 Ga0496122_0003585_205_1008 267
198 3300048925 Ga0496122_0094227 Ga0496122_0094227_720_1535 267
199 3300048926 Ga0496123_0075946 Ga0496123_0075946_1201_2004 267
200 3300048928 Ga0496125_0001194 Ga0496125_0001194_3055_3888 267
201 3300048928 Ga0496125_0010715 Ga0496125_0010715_7712_8515 267
202 3300048929 Ga0496126_0008542 Ga0496126_0008542_9228_10031 267
203 3300049161 Ga0501305_021999 Ga0501305_021999_16_819 267
204 3300049533 Ga0501317_000213 Ga0501317_000213_534_1337 267
205 3300049537 Ga0501321_010839 Ga0501321_010839_99_902 267
206 3300049649 Ga0501198_011151 Ga0501198_011151_506_1309 267
207 iso_pu_bacteria 2585428059 2587737767 267
208 iso_pu_bacteria 2738541295 2738816157 267
209 iso_pu_bacteria 2738543010 2739230120 267
210 iso_pu_bacteria 2818991459 2819670571 267
211 iso_pu_bacteria 2904755435 2904760047 267
212 iso_pu_bacteria 2919425241 2919427112 267
213 iso_pu_bacteria 2928510474 2928513972 267
214 iso_pu_bacteria 2936361878 2936366810 267
215 iso_pu_bacteria 2977254563 2977257185 267
216 iso_pu_bacteria 2990275345 2990278080 267
217 iso_pu_bacteria 3001892409 3001898690 267
218 iso_pu_bacteria 3006978542 3006979969 267
219 iso_pu_bacteria 3006978542 3006981865 267
220 iso_pu_bacteria 8054795415 8054804784 267
221 iso_pu_bacteria 8057632132 8057635467 267
222 3300044656 Ga0466969_0005019 Ga0466969_0005019_507_1316 268
223 3300044693 Ga0466961_0315629 Ga0466961_0315629_89_898 268
224 3300045049 Ga0466959_0007024 Ga0466959_0007024_6744_7553 268
225 iso_pu_bacteria 2600254943 2600401228 268
226 iso_pu_bacteria 2744054657 2745169494 268
227 iso_pu_bacteria 2816332336 2817617774 268
228 iso_pu_bacteria 2852673933 2852675337 268
229 iso_pu_bacteria 2857460504 2857462865 268
230 iso_pu_bacteria 2881644220 2881644414 268
231 3300003187 JGI25151J46595_10006593 JGI25151J46595_100065933 269
232 3300003187 JGI25151J46595_10014848 JGI25151J46595_100148483 269
233 3300003187 JGI25151J46595_10018886 JGI25151J46595_100188862 269
234 3300003187 JGI25151J46595_10089862 JGI25151J46595_100898621 269
235 3300009011 Ga0105251_10057237 Ga0105251_100572372 269
236 3300009036 Ga0105244_10042031 Ga0105244_100420312 269
237 3300009036 Ga0105244_10065846 Ga0105244_100658462 269
238 3300009036 Ga0105244_10081969 Ga0105244_100819692 269
239 3300009036 Ga0105244_10109846 Ga0105244_101098461 269
240 3300009092 Ga0105250_10001260 Ga0105250_100012604 269
241 3300009092 Ga0105250_10044980 Ga0105250_100449801 269
242 3300009092 Ga0105250_10101796 Ga0105250_101017961 269
243 3300011119 Ga0105246_10078381 Ga0105246_100783812 269
244 3300013102 Ga0157371_10002286 Ga0157371_100022863 269
245 3300025229 Ga0209147_100519 Ga0209147_10051912 269
246 3300025284 Ga0209130_1002012 Ga0209130_100201213 269
247 3300025284 Ga0209130_1005420 Ga0209130_10054202 269
248 3300025284 Ga0209130_1009149 Ga0209130_10091493 269
249 3300025284 Ga0209130_1012990 Ga0209130_10129902 269
250 3300025294 Ga0209025_1000539 Ga0209025_100053913 269
251 3300025294 Ga0209025_1003755 Ga0209025_100375512 269
252 3300025294 Ga0209025_1004088 Ga0209025_10040889 269
253 3300025294 Ga0209025_1008720 Ga0209025_10087202 269
254 3300025294 Ga0209025_1021371 Ga0209025_10213713 269
255 3300025294 Ga0209025_1033756 Ga0209025_10337562 269
256 3300025294 Ga0209025_1050085 Ga0209025_10500851 269
257 3300025294 Ga0209025_1067542 Ga0209025_10675422 269
258 3300025294 Ga0209025_1077674 Ga0209025_10776741 269
259 3300025711 Ga0207696_1013027 Ga0207696_10130271 269
260 3300025711 Ga0207696_1013132 Ga0207696_10131322 269
261 3300025728 Ga0207655_1021566 Ga0207655_10215663 269
262 3300025735 Ga0207713_1046513 Ga0207713_10465132 269
263 3300030083 Ga0237817_10022 Ga0237817_100221 269
264 3300030083 Ga0237817_10093 Ga0237817_1009331 269
265 3300031548 Ga0307408_100007773 Ga0307408_1000077733 269
266 3300031995 Ga0307409_100349934 Ga0307409_1003499342 269
267 3300038705 Ga0237819_00614 Ga0237819_00614_10649_11461 269
268 3300045976 Ga0466967_0000144 Ga0466967_0000144_25483_26295 269
269 3300046474 Ga0495605_0116015 Ga0495605_0116015_287_1096 269
270 3300046665 Ga0495661_0063086 Ga0495661_0063086_568_1377 269
271 3300046665 Ga0495661_0219354 Ga0495661_0219354_34_843 269
272 3300048903 Ga0496100_0158489 Ga0496100_0158489_184_993 269
273 3300048904 Ga0496101_0149947 Ga0496101_0149947_269_1078 269
274 3300048913 Ga0496110_0033997 Ga0496110_0033997_272_1123 269
275 3300048913 Ga0496110_0069531 Ga0496110_0069531_2104_2922 269
276 3300048915 Ga0496112_0066480 Ga0496112_0066480_1978_2787 269
277 3300048916 Ga0496113_0230230 Ga0496113_0230230_38_847 269
278 3300049131 Ga0501341_00478 Ga0501341_00478_259_1068 269
279 3300049161 Ga0501305_015465 Ga0501305_015465_109_918 269
280 3300049531 Ga0501315_000399 Ga0501315_000399_1995_2804 269
281 3300049533 Ga0501317_000077 Ga0501317_000077_1995_2804 269
282 3300049533 Ga0501317_016901 Ga0501317_016901_16_825 269
283 3300049534 Ga0501318_000051 Ga0501318_000051_1934_2743 269
284 3300049537 Ga0501321_000045 Ga0501321_000045_644_1453 269
285 3300049548 Ga0501332_00094 Ga0501332_00094_60_869 269
286 3300049550 Ga0501334_01047 Ga0501334_01047_602_1411 269
287 3300049551 Ga0501335_000021 Ga0501335_000021_3202_4011 269
288 3300049551 Ga0501335_000348 Ga0501335_000348_1686_2495 269
289 3300049551 Ga0501335_007889 Ga0501335_007889_32_874 269
290 3300049553 Ga0501337_000035 Ga0501337_000035_1682_2491 269
291 3300049554 Ga0501338_00197 Ga0501338_00197_1513_2322 269
292 iso_pu_bacteria 2554235283 2555467704 269
293 iso_pu_bacteria 2643221735 2644740869 269
294 iso_pu_bacteria 2671180330 2672337012 269
295 iso_pu_bacteria 2684623153 2686997526 269
296 iso_pu_bacteria 2687453109 2687498833 269
297 iso_pu_bacteria 2811994870 2812316721 269
298 iso_pu_bacteria 2816332186 2816862564 269
299 iso_pu_bacteria 2818991441 2819569303 269
300 iso_pu_bacteria 2818991468 2819723781 269
301 iso_pu_bacteria 2823526263 2823528703 269
302 iso_pu_bacteria 2842682962 2842684519 269
303 iso_pu_bacteria 2849139964 2849142542 269
304 iso_pu_bacteria 2857581216 2857585706 269
305 iso_pu_bacteria 2908665501 2908668095 269
306 iso_pu_bacteria 2919093281 2919095863 269
307 iso_pu_bacteria 2919726948 2919728417 269
308 iso_pu_bacteria 2929206907 2929210638 269
309 iso_pu_bacteria 2954773129 2954773778 269
310 3300003187 JGI25151J46595_10011908 JGI25151J46595_100119082 270
311 3300003578 Ga0006562J51391_1004050 Ga0006562J51391_10040502 270
312 3300003751 Ga0055538_1000233 Ga0055538_10002339 270
313 3300003758 Ga0055532_1002155 Ga0055532_10021551 270
314 3300003781 Ga0055536_1027134 Ga0055536_10271342 270
315 3300025224 Ga0209784_100099 Ga0209784_10009977 270
316 3300025225 Ga0209566_100248 Ga0209566_10024842 270
317 3300025229 Ga0209147_100068 Ga0209147_100068123 270
318 3300025292 Ga0209676_1000783 Ga0209676_100078315 270
319 3300025292 Ga0209676_1014882 Ga0209676_10148822 270
320 3300025292 Ga0209676_1023851 Ga0209676_10238512 270
321 3300025294 Ga0209025_1004904 Ga0209025_100490413 270
322 3300025294 Ga0209025_1020687 Ga0209025_10206872 270
323 3300025294 Ga0209025_1037420 Ga0209025_10374202 270
324 3300031548 Ga0307408_100079238 Ga0307408_1000792382 270
325 3300031731 Ga0307405_10382420 Ga0307405_103824202 270
326 3300032002 Ga0307416_100129396 Ga0307416_1001293962 270
327 3300037466 Ga0395898_0214670 Ga0395898_0214670_939_1754 270
328 3300045051 Ga0451576_0081089 Ga0451576_0081089_248_1081 270
329 3300048916 Ga0496113_0364945 Ga0496113_0364945_43_858 270
330 3300049532 Ga0501316_002695 Ga0501316_002695_765_1592 270
331 3300049588 Ga0501072_0404931 Ga0501072_0404931_112_933 270
332 iso_pu_bacteria 2510917027 2511176569 270
333 iso_pu_bacteria 2512564013 2512640472 270
334 iso_pu_bacteria 2831905167 2831906791 270
335 iso_pu_bacteria 2857465823 2857469154 270
336 iso_pu_bacteria 2857591370 2857596192 270
337 iso_pu_bacteria 2898907183 2898909007 270
338 iso_pu_bacteria 2915597211 2915600681 270
339 iso_pu_bacteria 2915606848 2915607890 270
340 iso_pu_bacteria 2919414237 2919419261 270
341 iso_pu_bacteria 2929183550 2929185817 270
342 3300049161 Ga0501305_003814 Ga0501305_003814_748_1563 271
343 3300049533 Ga0501317_005331 Ga0501317_005331_542_1357 271
344 3300049551 Ga0501335_000130 Ga0501335_000130_2704_3519 271
345 3300027312 Ga0209371_1002323 Ga0209371_10023235 272
346 3300030500 Ga0268256_1002064 Ga0268256_10020645 272
347 3300003187 JGI25151J46595_10000006 JGI25151J46595_10000006423 273
348 3300003578 Ga0006562J51391_1001146 Ga0006562J51391_100114633 273
349 3300003578 Ga0006562J51391_1001176 Ga0006562J51391_10011763 273
350 3300025294 Ga0209025_1000001 Ga0209025_1000001574 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03618

Kinase-PPPase

Kinase/pyrophosphorylase

25

280

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
8pbj-assembly1.cif.gz_A mutant r1722w of the dihydroorotase domain of human cad protein bound to the substrate carbamoyl aspartate 0.6745 38 88
8pbh-assembly1.cif.gz_A mutant r1617q of the dihydroorotase domain of human cad protein bound to the substrate carbamoyl aspartate 0.6729 38 88
3gri-assembly1.cif.gz_A the crystal structure of a dihydroorotase from staphylococcus aureus 0.6647 38 88
7yor-assembly1.cif.gz_B recj2 and dcmp complex from methanocaldococcus jannaschii 0.6534 4 88
7owk-assembly1.cif.gz_C odinarchaeota adenylate kinase (odinak) in complex with dttp 0.6123 148 268
ID Description Score Start End Superfamily
4ep1B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.6651 4 88 3.40.50.1370
4m88A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6563 4 85 3.40.50.2300
6hl7B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.6506 4 90 3.40.50.1370
af_A0A5K1K910_58_191_3.40.50.1370 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.6506 1 88 3.40.50.1370
1gq3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.646 1 88 3.40.50.1370
ID Description Score Start End GO Terms
AF-E1NNZ4-F1-model_v4 deleted 0.9934 115 199
AF-A0A7Z7YSP8-F1-model_v4 Phosphoenolpyruvate synthase regulatory protein 0.9868 171 270 GO:0004674
GO:0005524
AF-A0A3D0MRX8-F1-model_v4 Phosphoenolpyruvate synthase regulatory protein 0.9812 121 268 GO:0004674
GO:0005524
AF-A0A3D1JBM7-F1-model_v4 Phosphoenolpyruvate synthase regulatory protein 0.9808 166 268 GO:0004674
GO:0005524
AF-A0A645HR73-F1-model_v4 Putative pyruvate, phosphate dikinase regulatory protein (EC 2.7.11.32) 0.9803 144 271 GO:0004674
GO:0005524

Feature Viewer

pLDDT pTM Quality
89.77 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map