F418376
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 350 | 257 | 177 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300046694|Ga0495649_0102773|Ga0495649_0102773_159_1019 |
| Length | 286 |
| Sequence | LLWEKKVCKKFKKRRWLGIMSIPVIYVVSDSVGETAELVTKAAITQFNGSGMILKRFPYVEDKEHIDEVISLVKMDKGMIAFTLVKPDMREYIQNAAEKEGIYACDLIGPLMDQIQELTGKVPLCEPGLVRKLDEDYFKKVEAIEFAVKYDDGRDPRGIMKADIVLIGVSRTSKTPLSQYLALKRLKVANVPLVPEVEPPEELYKVPPEKCFGLKISPEKLNNIRRERLISLGLNDQASYANIERIKEELVFFEKVVSRINCPIIDVTNKAVEETANEILNFIHKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917027 | Brevibacillus sp. CF112 | Isolate | Rhizosphere |
| 2 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 3 | 2512564013 | Brevibacillus sp. BC25 | Isolate | Rhizosphere |
| 4 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
| 5 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 6 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 7 | 2551306519 | Bacillus sp. WBUNB004 | Isolate | Rhizosphere |
| 8 | 2554235283 | Bacillus safensis VK | Isolate | Rhizosphere |
| 9 | 2571042588 | Paenibacillus zanthoxyli JH29 | Isolate | Unclassified |
| 10 | 2576861424 | Paenibacillus sabinae T27 | Isolate | Rhizosphere |
| 11 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 12 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 13 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 14 | 2593339198 | Paenibacillus sp. UNCCL117 | Isolate | Unclassified |
| 15 | 2599185353 | Staphylococcus sp. NFPP34 | Isolate | Rhizoplane |
| 16 | 2600254943 | Staphylococcus pasteuri NFIX07 | Isolate | Rhizoplane |
| 17 | 2619619294 | Paenibacillus durus ATCC 35681 | Isolate | Unclassified |
| 18 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 19 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 20 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 21 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 22 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 23 | 2643221735 | Bacillus sp. Root920 | Isolate | Unclassified |
| 24 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 25 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 26 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 27 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 28 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 29 | 2684623153 | Bacillus pumilus SH-B9 | Isolate | Unclassified |
| 30 | 2687453109 | Bacillus pumilus SH-B11 | Isolate | Unclassified |
| 31 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 32 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 33 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 34 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 35 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 36 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 37 | 2738541299 | Paenisporosarcina sp. OV554 | Isolate | Unclassified |
| 38 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 39 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 40 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 41 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 42 | 2744054657 | Brevibacillus sp. SKDU10 | Isolate | Unclassified |
| 43 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 44 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 45 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 46 | 2788500588 | Lysinibacillus sp. YS11 | Isolate | Unclassified |
| 47 | 2808606364 | Bacillus sp. SLBN-3 | Isolate | Unclassified |
| 48 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 49 | 2811994870 | Bacillus sp. JB4 | Isolate | Unclassified |
| 50 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 51 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 52 | 2816332336 | Brevibacillus laterosporus ZQ2 | Isolate | Unclassified |
| 53 | 2818991441 | Niallia circulans 3243 | Isolate | Rhizosphere |
| 54 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 55 | 2818991451 | Lysinibacillus fusiformis 3193 | Isolate | Unclassified |
| 56 | 2818991459 | Paenibacillus sp. 597 | Isolate | Unclassified |
| 57 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 58 | 2818991468 | Bacillus safensis 3300 | Isolate | Rhizosphere |
| 59 | 2823526263 | Bacillus altitudinis P-10 | Isolate | Unclassified |
| 60 | 2831905167 | Ammoniphilus oxalaticus RAOx-1 | Isolate | Rhizosphere |
| 61 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 62 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 63 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 64 | 2852673933 | Sporosarcina sp. JAI121 | Isolate | Rhizosphere |
| 65 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 66 | 2857460504 | Brevibacillus sp. R-74223 | Isolate | Unclassified |
| 67 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 68 | 2857472729 | Cohnella sp. R-74144 | Isolate | Unclassified |
| 69 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 70 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 71 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 72 | 2857604169 | Domibacillus sp. R-71921 | Isolate | Unclassified |
| 73 | 2857609550 | Domibacillus sp. R-71929 | Isolate | Unclassified |
| 74 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 75 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 76 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 77 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 78 | 2881636855 | Paenibacillus sp. 7197 | Isolate | Rhizosphere |
| 79 | 2881644220 | Siminovitchia terrae LMG 29736 | Isolate | Rhizosphere |
| 80 | 2889295896 | Paenibacillus sp. PvR098 | Isolate | Rhizosphere |
| 81 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 82 | 2898907183 | Brevibacillus sp. SYP-B805 | Isolate | Rhizosphere |
| 83 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 84 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 85 | 2904606771 | Lysinibacillus macroides 1284 | Isolate | Rhizosphere |
| 86 | 2904755435 | Paenibacillus aceris KACC 19194 | Isolate | Rhizosphere |
| 87 | 2908665501 | Bacillus pumilus 1391 | Isolate | Rhizosphere |
| 88 | 2915597211 | Brevibacillus brevis Ag35 | Isolate | Nodule |
| 89 | 2915606848 | Brevibacillus sp. HD1.4A | Isolate | Rhizosphere |
| 90 | 2916971899 | Alkalihalobacillus miscanthi AK13 | Isolate | Rhizosphere |
| 91 | 2919093281 | Bacillus safensis 1383 | Isolate | Rhizosphere |
| 92 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 93 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 94 | 2919425241 | Bacillus sp. 3255 | Isolate | Rhizosphere |
| 95 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 96 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 97 | 2919726948 | Bacillus pumilus 4489 | Isolate | Unclassified |
| 98 | 2925326138 | Paenibacillus hemerocallicola KCTC 33185 | Isolate | Unclassified |
| 99 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 100 | 2928510474 | Sporosarcina psychrophila 1288 | Isolate | Rhizosphere |
| 101 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 102 | 2929183550 | Brevibacillus sp. R-71971 Hybrid assembly | Isolate | Unclassified |
| 103 | 2929206907 | Paenibacillus sp. R-74146 Hybrid assembly | Isolate | Unclassified |
| 104 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 105 | 2929297113 | Heliophilum fasciatum MTM | Isolate | Rhizosphere |
| 106 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 107 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 108 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 109 | 2939593269 | Lysinibacillus parviboronicapiens 736 | Isolate | Rhizosphere |
| 110 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 111 | 2954773129 | Bacillus sp. TBS-096 | Isolate | Rhizosphere |
| 112 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 113 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 114 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 115 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 116 | 2964375228 | Anaerobacillus alkaliphilus B16-10 | Isolate | Rhizosphere |
| 117 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 118 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 119 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 120 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 121 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 122 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 123 | 2971511577 | Paenibacillus apii 7124 | Isolate | Rhizosphere |
| 124 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 125 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 126 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 127 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 128 | 2980176882 | Paenibacillus apii 7028 | Isolate | Rhizosphere |
| 129 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 130 | 2981284811 | Paenibacillus sp. PvR052 | Isolate | Rhizosphere |
| 131 | 2981289755 | Paenibacillus sp. PvR148 | Isolate | Rhizosphere |
| 132 | 2981980479 | Paenibacillus sp. PvR018 | Isolate | Rhizosphere |
| 133 | 2981985349 | Paenibacillus sp. PvR053 | Isolate | Rhizosphere |
| 134 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 135 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 136 | 3001272096 | Lederbergia citrisecunda FJAT-49732 | Isolate | Rhizosphere |
| 137 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 138 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 139 | 3006879489 | Bacillus atrophaeus UCMB-5137 | Isolate | Rhizosphere |
| 140 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 141 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 142 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 143 | 3006984091 | Lederbergia citrea FJAT-49754 | Isolate | Rhizosphere |
| 144 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 145 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 146 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 147 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 148 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 149 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 150 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 151 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 152 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 153 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 154 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 181 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 189 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 190 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 191 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 192 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 193 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 194 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 206 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 207 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 208 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 209 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 210 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 211 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 214 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 215 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 216 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 217 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 218 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 219 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 220 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 221 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 222 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 223 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 239 | 8002317523 | Cohnella sp. GbtcB17 | Isolate | Unclassified |
| 240 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 241 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 242 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 243 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 244 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 245 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 246 | 8022948649 | Bacillus endophyticus FH5 | Isolate | Rhizosphere |
| 247 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 248 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 249 | 8046991243 | Cohnella rhizosphaerae DSM 28161 | Isolate | Rhizosphere |
| 250 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 251 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 252 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
| 253 | 8054795415 | Paenibacillus periandrae PM10 | Isolate | Nodule |
| 254 | 8055531788 | Lysinibacillus pakistanensis LY1 | Isolate | Rhizosphere |
| 255 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 256 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
| 257 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 42.57 |
| Metatranscriptomes | 8 |
| Isolates | 49.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.86 |
| Nodule | 0.57 |
| Rhizoplane | 7.14 |
| Rhizosphere | 47.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 30 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000006 | 3300003187 | Bacteria | 419711 |
| 2 | JGI25151J46595_10006593 | 3300003187 | Bacteria | 5806 |
| 3 | JGI25151J46595_10008020 | 3300003187 | Bacteria | 5119 |
| 4 | JGI25151J46595_10009449 | 3300003187 | Bacteria | 4615 |
| 5 | JGI25151J46595_10011908 | 3300003187 | Bacteria | 3977 |
| 6 | JGI25151J46595_10014848 | 3300003187 | Bacteria | 3456 |
| 7 | JGI25151J46595_10018886 | 3300003187 | Bacteria | 2945 |
| 8 | JGI25151J46595_10049893 | 3300003187 | Bacteria | 1431 |
| 9 | JGI25151J46595_10057001 | 3300003187 | Bacteria | 1277 |
| 10 | JGI25151J46595_10075917 | 3300003187 | Bacteria | 995 |
| 11 | JGI25151J46595_10089862 | 3300003187 | Bacteria | 859 |
| 12 | rootH1_10000457 | 3300003316 | Bacteria | 39363 |
| 13 | rootH2_10056773 | 3300003320 | Bacteria | 5708 |
| 14 | rootL2_10004995 | 3300003322 | Bacteria | 33898 |
| 15 | Ga0006562J51391_1001146 | 3300003578 | Bacteria | 47560 |
| 16 | Ga0006562J51391_1001176 | 3300003578 | Bacteria | 6340 |
| 17 | Ga0006562J51391_1001442 | 3300003578 | Bacteria | 20940 |
| 18 | Ga0006562J51391_1004050 | 3300003578 | Bacteria | 4220 |
| 19 | Ga0055538_1000233 | 3300003751 | Bacteria | 30999 |
| 20 | Ga0055532_1000046 | 3300003758 | Bacteria | 182389 |
| 21 | Ga0055532_1002155 | 3300003758 | Bacteria | 4396 |
| 22 | Ga0055536_1027134 | 3300003781 | Bacteria | 1591 |
| 23 | Ga0055528_1001481 | 3300003790 | Bacteria | 14268 |
| 24 | Ga0105251_10057237 | 3300009011 | Bacteria | 1843 |
| 25 | Ga0105244_10042031 | 3300009036 | Bacteria | 2366 |
| 26 | Ga0105244_10065846 | 3300009036 | Bacteria | 1814 |
| 27 | Ga0105244_10081969 | 3300009036 | Bacteria | 1595 |
| 28 | Ga0105244_10109846 | 3300009036 | Bacteria | 1342 |
| 29 | Ga0105250_10001260 | 3300009092 | Bacteria | 13993 |
| 30 | Ga0105250_10044980 | 3300009092 | Bacteria | 1770 |
| 31 | Ga0105250_10101796 | 3300009092 | Bacteria | 1172 |
| 32 | Ga0105247_10004353 | 3300009101 | Bacteria | 9053 |
| 33 | Ga0105243_10002181 | 3300009148 | Bacteria | 16523 |
| 34 | Ga0105242_10001993 | 3300009176 | Bacteria | 16071 |
| 35 | Ga0105239_11103572 | 3300010375 | Bacteria | 913 |
| 36 | Ga0105246_10000276 | 3300011119 | Bacteria | 26748 |
| 37 | Ga0105246_10078381 | 3300011119 | Bacteria | 2346 |
| 38 | Ga0157371_10002286 | 3300013102 | Bacteria | 18467 |
| 39 | Ga0157374_10276520 | 3300013296 | Bacteria | 1657 |
| 40 | Ga0157378_10003046 | 3300013297 | Bacteria | 14903 |
| 41 | Ga0157377_10006785 | 3300014745 | Bacteria | 5485 |
| 42 | Ga0209784_100099 | 3300025224 | Bacteria | 101738 |
| 43 | Ga0209566_100022 | 3300025225 | Bacteria | 403259 |
| 44 | Ga0209566_100248 | 3300025225 | Bacteria | 51716 |
| 45 | Ga0209147_100014 | 3300025229 | Bacteria | 597841 |
| 46 | Ga0209147_100068 | 3300025229 | Bacteria | 230150 |
| 47 | Ga0209147_100519 | 3300025229 | Bacteria | 22359 |
| 48 | Ga0209147_100618 | 3300025229 | Bacteria | 19323 |
| 49 | Ga0209147_109705 | 3300025229 | Bacteria | 1133 |
| 50 | Ga0209673_1002814 | 3300025273 | Bacteria | 11246 |
| 51 | Ga0209130_1002012 | 3300025284 | Bacteria | 11080 |
| 52 | Ga0209130_1005420 | 3300025284 | Bacteria | 4426 |
| 53 | Ga0209130_1008340 | 3300025284 | Bacteria | 3070 |
| 54 | Ga0209130_1009149 | 3300025284 | Bacteria | 2853 |
| 55 | Ga0209130_1012990 | 3300025284 | Bacteria | 2152 |
| 56 | Ga0209676_1000783 | 3300025292 | Bacteria | 42336 |
| 57 | Ga0209676_1002921 | 3300025292 | Bacteria | 11176 |
| 58 | Ga0209676_1014882 | 3300025292 | Bacteria | 2896 |
| 59 | Ga0209676_1023851 | 3300025292 | Bacteria | 1994 |
| 60 | Ga0209025_1000001 | 3300025294 | Bacteria | 1888151 |
| 61 | Ga0209025_1000539 | 3300025294 | Bacteria | 71638 |
| 62 | Ga0209025_1001023 | 3300025294 | Bacteria | 41159 |
| 63 | Ga0209025_1003755 | 3300025294 | Bacteria | 13922 |
| 64 | Ga0209025_1004088 | 3300025294 | Bacteria | 13010 |
| 65 | Ga0209025_1004904 | 3300025294 | Bacteria | 11258 |
| 66 | Ga0209025_1005331 | 3300025294 | Bacteria | 10551 |
| 67 | Ga0209025_1008720 | 3300025294 | Bacteria | 7230 |
| 68 | Ga0209025_1015244 | 3300025294 | Bacteria | 4652 |
| 69 | Ga0209025_1015420 | 3300025294 | Bacteria | 4606 |
| 70 | Ga0209025_1020687 | 3300025294 | Bacteria | 3582 |
| 71 | Ga0209025_1021371 | 3300025294 | Bacteria | 3489 |
| 72 | Ga0209025_1033756 | 3300025294 | Bacteria | 2356 |
| 73 | Ga0209025_1037420 | 3300025294 | Bacteria | 2153 |
| 74 | Ga0209025_1050085 | 3300025294 | Bacteria | 1673 |
| 75 | Ga0209025_1067542 | 3300025294 | Bacteria | 1291 |
| 76 | Ga0209025_1077674 | 3300025294 | Bacteria | 1143 |
| 77 | Ga0207426_1043198 | 3300025302 | Bacteria | 1386 |
| 78 | Ga0207696_1001570 | 3300025711 | Bacteria | 12152 |
| 79 | Ga0207696_1013027 | 3300025711 | Bacteria | 2916 |
| 80 | Ga0207696_1013132 | 3300025711 | Bacteria | 2901 |
| 81 | Ga0207655_1021566 | 3300025728 | Bacteria | 3265 |
| 82 | Ga0207655_1101096 | 3300025728 | Bacteria | 993 |
| 83 | Ga0207713_1002283 | 3300025735 | Bacteria | 14125 |
| 84 | Ga0207713_1046513 | 3300025735 | Bacteria | 1764 |
| 85 | Ga0207686_10008660 | 3300025934 | Bacteria | 5494 |
| 86 | Ga0207709_10009372 | 3300025935 | Bacteria | 5387 |
| 87 | Ga0209371_1002323 | 3300027312 | Bacteria | 10815 |
| 88 | Ga0237817_10022 | 3300030083 | Bacteria | 62837 |
| 89 | Ga0237817_10093 | 3300030083 | Bacteria | 27814 |
| 90 | Ga0268256_1002064 | 3300030500 | Bacteria | 10815 |
| 91 | Ga0307408_100007718 | 3300031548 | Bacteria | 7117 |
| 92 | Ga0307408_100007773 | 3300031548 | Bacteria | 7085 |
| 93 | Ga0307408_100079238 | 3300031548 | Bacteria | 2450 |
| 94 | Ga0307405_10382420 | 3300031731 | Bacteria | 1096 |
| 95 | Ga0307409_100349934 | 3300031995 | Bacteria | 1394 |
| 96 | Ga0307416_100129396 | 3300032002 | Bacteria | 2269 |
| 97 | Ga0307416_100277041 | 3300032002 | Bacteria | 1651 |
| 98 | Ga0307416_100441200 | 3300032002 | Bacteria | 1352 |
| 99 | Ga0316583_10000017 | 3300032133 | Bacteria | 32029 |
| 100 | Ga0316583_10022209 | 3300032133 | Bacteria | 2273 |
| 101 | Ga0395898_0214670 | 3300037466 | Bacteria | 1835 |
| 102 | Ga0237819_00614 | 3300038705 | Bacteria | 11715 |
| 103 | Ga0439449_0007880 | 3300042007 | Bacteria | 4045 |
| 104 | Ga0439462_0007544 | 3300042015 | Bacteria | 2725 |
| 105 | Ga0466969_0005019 | 3300044656 | Bacteria | 7043 |
| 106 | Ga0466961_0315629 | 3300044693 | Bacteria | 953 |
| 107 | Ga0466959_0007024 | 3300045049 | Bacteria | 7870 |
| 108 | Ga0451576_0081089 | 3300045051 | Bacteria | 3375 |
| 109 | Ga0466967_0000144 | 3300045976 | Bacteria | 27783 |
| 110 | Ga0495603_0059502 | 3300046455 | Bacteria | 2258 |
| 111 | Ga0495605_0116015 | 3300046474 | Bacteria | 1218 |
| 112 | Ga0495584_0008087 | 3300046491 | Bacteria | 5467 |
| 113 | Ga0495585_0006773 | 3300046492 | Bacteria | 7073 |
| 114 | Ga0495661_0063086 | 3300046665 | Bacteria | 2192 |
| 115 | Ga0495661_0219354 | 3300046665 | Bacteria | 986 |
| 116 | Ga0495649_0102773 | 3300046694 | Bacteria | 1518 |
| 117 | Ga0495649_0113993 | 3300046694 | Bacteria | 1432 |
| 118 | Ga0495683_0005029 | 3300047323 | Bacteria | 7408 |
| 119 | Ga0496100_0000790 | 3300048903 | Bacteria | 15074 |
| 120 | Ga0496100_0158489 | 3300048903 | Bacteria | 1621 |
| 121 | Ga0496101_0038190 | 3300048904 | Bacteria | 3409 |
| 122 | Ga0496101_0149947 | 3300048904 | Bacteria | 1783 |
| 123 | Ga0496102_0019905 | 3300048905 | Bacteria | 5918 |
| 124 | Ga0496102_0159125 | 3300048905 | Bacteria | 2124 |
| 125 | Ga0496103_0012475 | 3300048906 | Bacteria | 5039 |
| 126 | Ga0496104_0001771 | 3300048907 | Bacteria | 18674 |
| 127 | Ga0496105_0000412 | 3300048908 | Bacteria | 28052 |
| 128 | Ga0496106_0000567 | 3300048909 | Bacteria | 26325 |
| 129 | Ga0496107_0000227 | 3300048910 | Bacteria | 29794 |
| 130 | Ga0496108_0002371 | 3300048911 | Bacteria | 15087 |
| 131 | Ga0496109_0001823 | 3300048912 | Bacteria | 17696 |
| 132 | Ga0496110_0018130 | 3300048913 | Bacteria | 5896 |
| 133 | Ga0496110_0033997 | 3300048913 | Bacteria | 4412 |
| 134 | Ga0496110_0069531 | 3300048913 | Bacteria | 3118 |
| 135 | Ga0496111_0000205 | 3300048914 | Bacteria | 27749 |
| 136 | Ga0496112_0005112 | 3300048915 | Bacteria | 11271 |
| 137 | Ga0496112_0066480 | 3300048915 | Bacteria | 3557 |
| 138 | Ga0496113_0079813 | 3300048916 | Bacteria | 2505 |
| 139 | Ga0496113_0230230 | 3300048916 | Bacteria | 1478 |
| 140 | Ga0496113_0364945 | 3300048916 | Bacteria | 1159 |
| 141 | Ga0496116_0015025 | 3300048919 | Bacteria | 6140 |
| 142 | Ga0496116_0036628 | 3300048919 | Bacteria | 3430 |
| 143 | Ga0496119_0001436 | 3300048922 | Bacteria | 28717 |
| 144 | Ga0496122_0003585 | 3300048925 | Bacteria | 20260 |
| 145 | Ga0496122_0094227 | 3300048925 | Unclassified | 2028 |
| 146 | Ga0496123_0075946 | 3300048926 | Bacteria | 2071 |
| 147 | Ga0496125_0001194 | 3300048928 | Bacteria | 39236 |
| 148 | Ga0496125_0010715 | 3300048928 | Bacteria | 9239 |
| 149 | Ga0496125_0032992 | 3300048928 | Bacteria | 4589 |
| 150 | Ga0496125_0121287 | 3300048928 | Bacteria | 1864 |
| 151 | Ga0496126_0008542 | 3300048929 | Bacteria | 11039 |
| 152 | Ga0501341_00478 | 3300049131 | Bacteria | 1693 |
| 153 | Ga0501305_003814 | 3300049161 | Bacteria | 1734 |
| 154 | Ga0501305_015465 | 3300049161 | Bacteria | 1078 |
| 155 | Ga0501305_021999 | 3300049161 | Bacteria | 946 |
| 156 | Ga0501315_000399 | 3300049531 | Bacteria | 2941 |
| 157 | Ga0501316_002695 | 3300049532 | Bacteria | 1666 |
| 158 | Ga0501317_000077 | 3300049533 | Bacteria | 4820 |
| 159 | Ga0501317_000213 | 3300049533 | Bacteria | 3564 |
| 160 | Ga0501317_005331 | 3300049533 | Bacteria | 1373 |
| 161 | Ga0501317_016901 | 3300049533 | Bacteria | 951 |
| 162 | Ga0501318_000051 | 3300049534 | Bacteria | 4702 |
| 163 | Ga0501320_014976 | 3300049536 | Bacteria | 843 |
| 164 | Ga0501321_000045 | 3300049537 | Bacteria | 5432 |
| 165 | Ga0501321_010839 | 3300049537 | Bacteria | 1007 |
| 166 | Ga0501326_00770 | 3300049542 | Bacteria | 1352 |
| 167 | Ga0501332_00094 | 3300049548 | Bacteria | 2774 |
| 168 | Ga0501334_01047 | 3300049550 | Bacteria | 1455 |
| 169 | Ga0501335_000021 | 3300049551 | Bacteria | 6525 |
| 170 | Ga0501335_000130 | 3300049551 | Bacteria | 3723 |
| 171 | Ga0501335_000348 | 3300049551 | Bacteria | 2819 |
| 172 | Ga0501335_007889 | 3300049551 | Bacteria | 991 |
| 173 | Ga0501335_009116 | 3300049551 | Bacteria | 942 |
| 174 | Ga0501337_000035 | 3300049553 | Bacteria | 4711 |
| 175 | Ga0501338_00197 | 3300049554 | Bacteria | 2386 |
| 176 | Ga0501072_0404931 | 3300049588 | Bacteria | 1082 |
| 177 | Ga0501198_011151 | 3300049649 | Bacteria | 1337 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049551 | Ga0501335_009116 | Ga0501335_009116_27_740 | 237 |
| 2 | 3300049542 | Ga0501326_00770 | Ga0501326_00770_615_1331 | 238 |
| 3 | 3300042007 | Ga0439449_0007880 | Ga0439449_0007880_1532_2263 | 243 |
| 4 | 3300042015 | Ga0439462_0007544 | Ga0439462_0007544_734_1465 | 243 |
| 5 | iso_pu_bacteria | 2643221676 | 2644423147 | 244 |
| 6 | 3300048928 | Ga0496125_0032992 | Ga0496125_0032992_2459_3292 | 247 |
| 7 | 3300025292 | Ga0209676_1002921 | Ga0209676_100292113 | 251 |
| 8 | 3300048928 | Ga0496125_0121287 | Ga0496125_0121287_186_977 | 252 |
| 9 | 3300003758 | Ga0055532_1000046 | Ga0055532_100004629 | 255 |
| 10 | 3300025229 | Ga0209147_100014 | Ga0209147_10001490 | 255 |
| 11 | 3300048905 | Ga0496102_0159125 | Ga0496102_0159125_731_1543 | 255 |
| 12 | 3300003187 | JGI25151J46595_10009449 | JGI25151J46595_100094492 | 256 |
| 13 | 3300025294 | Ga0209025_1001023 | Ga0209025_100102350 | 256 |
| 14 | 3300003187 | JGI25151J46595_10049893 | JGI25151J46595_100498932 | 257 |
| 15 | 3300025294 | Ga0209025_1015244 | Ga0209025_10152443 | 257 |
| 16 | 3300049536 | Ga0501320_014976 | Ga0501320_014976_55_828 | 257 |
| 17 | 3300003187 | JGI25151J46595_10057001 | JGI25151J46595_100570011 | 258 |
| 18 | 3300025284 | Ga0209130_1008340 | Ga0209130_10083402 | 258 |
| 19 | 3300025294 | Ga0209025_1005331 | Ga0209025_100533113 | 258 |
| 20 | iso_pu_bacteria | 2929297113 | 2929298715 | 259 |
| 21 | 3300032002 | Ga0307416_100277041 | Ga0307416_1002770412 | 263 |
| 22 | iso_pu_bacteria | 2643221731 | 2644715771 | 263 |
| 23 | iso_pu_bacteria | 2643221732 | 2644727493 | 263 |
| 24 | iso_pu_bacteria | 2738541299 | 2738839238 | 263 |
| 25 | iso_pu_bacteria | 2818991465 | 2819709242 | 263 |
| 26 | iso_pu_bacteria | 2842882022 | 2842884512 | 263 |
| 27 | iso_pu_bacteria | 2904524088 | 2904524458 | 263 |
| 28 | iso_pu_bacteria | 2919143609 | 2919146965 | 263 |
| 29 | iso_pu_bacteria | 2919517244 | 2919518869 | 263 |
| 30 | iso_pu_bacteria | 2919720352 | 2919723236 | 263 |
| 31 | iso_pu_bacteria | 2928093941 | 2928096237 | 263 |
| 32 | iso_pu_bacteria | 2929004312 | 2929006392 | 263 |
| 33 | iso_pu_bacteria | 2960319331 | 2960319857 | 263 |
| 34 | iso_pu_bacteria | 2960375949 | 2960380932 | 263 |
| 35 | iso_pu_bacteria | 8002317523 | 8002321850 | 263 |
| 36 | iso_pu_bacteria | 8022893055 | 8022898186 | 263 |
| 37 | iso_pu_bacteria | 8022914991 | 8022917365 | 263 |
| 38 | iso_pu_bacteria | 8046991243 | 8046999146 | 263 |
| 39 | 3300025225 | Ga0209566_100022 | Ga0209566_100022125 | 264 |
| 40 | iso_pu_bacteria | 2808606364 | 2808869477 | 264 |
| 41 | iso_pu_bacteria | 2818991459 | 2819669380 | 264 |
| 42 | iso_pu_bacteria | 2919425241 | 2919429775 | 264 |
| 43 | iso_pu_bacteria | 3001267043 | 3001268420 | 264 |
| 44 | iso_pu_bacteria | 3006969106 | 3006972221 | 264 |
| 45 | iso_pu_bacteria | 3006973921 | 3006975962 | 264 |
| 46 | iso_pu_bacteria | 3006984091 | 3006984523 | 264 |
| 47 | iso_pu_bacteria | 3006988479 | 3006988941 | 264 |
| 48 | iso_pu_bacteria | 2551306519 | 2553393333 | 265 |
| 49 | iso_pu_bacteria | 2571042588 | 2573041239 | 265 |
| 50 | iso_pu_bacteria | 2576861424 | 2578335590 | 265 |
| 51 | iso_pu_bacteria | 2593339131 | 2595089484 | 265 |
| 52 | iso_pu_bacteria | 2619619294 | 2621273823 | 265 |
| 53 | iso_pu_bacteria | 2643221729 | 2644708071 | 265 |
| 54 | iso_pu_bacteria | 2643221730 | 2644714800 | 265 |
| 55 | iso_pu_bacteria | 2684622632 | 2685152269 | 265 |
| 56 | iso_pu_bacteria | 2695420987 | 2698320892 | 265 |
| 57 | iso_pu_bacteria | 2703719227 | 2705996209 | 265 |
| 58 | iso_pu_bacteria | 2718218445 | 2721507428 | 265 |
| 59 | iso_pu_bacteria | 2738541295 | 2738813901 | 265 |
| 60 | iso_pu_bacteria | 2738541358 | 2739154530 | 265 |
| 61 | iso_pu_bacteria | 2738543006 | 2739208098 | 265 |
| 62 | iso_pu_bacteria | 2738543017 | 2739270419 | 265 |
| 63 | iso_pu_bacteria | 2757320391 | 2757567937 | 265 |
| 64 | iso_pu_bacteria | 2775507177 | 2777761054 | 265 |
| 65 | iso_pu_bacteria | 2775507192 | 2777839328 | 265 |
| 66 | iso_pu_bacteria | 2818991441 | 2819571541 | 265 |
| 67 | iso_pu_bacteria | 2818991443 | 2819583188 | 265 |
| 68 | iso_pu_bacteria | 2857472729 | 2857478744 | 265 |
| 69 | iso_pu_bacteria | 2857586860 | 2857590616 | 265 |
| 70 | iso_pu_bacteria | 2881636855 | 2881640526 | 265 |
| 71 | iso_pu_bacteria | 2919414237 | 2919417171 | 265 |
| 72 | iso_pu_bacteria | 2929233124 | 2929237970 | 265 |
| 73 | iso_pu_bacteria | 2936340661 | 2936341214 | 265 |
| 74 | iso_pu_bacteria | 2936361878 | 2936367403 | 265 |
| 75 | iso_pu_bacteria | 2938917290 | 2938922159 | 265 |
| 76 | iso_pu_bacteria | 2947426588 | 2947431055 | 265 |
| 77 | iso_pu_bacteria | 2956897341 | 2956902084 | 265 |
| 78 | iso_pu_bacteria | 2965761152 | 2965765572 | 265 |
| 79 | iso_pu_bacteria | 2971511577 | 2971514982 | 265 |
| 80 | iso_pu_bacteria | 2977254563 | 2977256562 | 265 |
| 81 | iso_pu_bacteria | 2979083700 | 2979087958 | 265 |
| 82 | iso_pu_bacteria | 2980176882 | 2980181088 | 265 |
| 83 | iso_pu_bacteria | 2990275345 | 2990277431 | 265 |
| 84 | iso_pu_bacteria | 3001892409 | 3001897756 | 265 |
| 85 | iso_pu_bacteria | 8022621104 | 8022624201 | 265 |
| 86 | iso_pu_bacteria | 8022792930 | 8022796894 | 265 |
| 87 | iso_pu_bacteria | 8022948649 | 8022949866 | 265 |
| 88 | iso_pu_bacteria | 8023438354 | 8023443117 | 265 |
| 89 | iso_pu_bacteria | 8023444577 | 8023445164 | 265 |
| 90 | iso_pu_bacteria | 8057582654 | 8057586730 | 265 |
| 91 | 3300032133 | Ga0316583_10000017 | Ga0316583_1000001725 | 266 |
| 92 | 3300032133 | Ga0316583_10022209 | Ga0316583_100222091 | 266 |
| 93 | 3300046694 | Ga0495649_0113993 | Ga0495649_0113993_490_1323 | 266 |
| 94 | 3300048919 | Ga0496116_0015025 | Ga0496116_0015025_584_1393 | 266 |
| 95 | iso_pu_bacteria | 2511231119 | 2511700314 | 266 |
| 96 | iso_pu_bacteria | 2512564039 | 2512735005 | 266 |
| 97 | iso_pu_bacteria | 2540341094 | 2540607457 | 266 |
| 98 | iso_pu_bacteria | 2545555800 | 2545556996 | 266 |
| 99 | iso_pu_bacteria | 2576861599 | 2578931252 | 266 |
| 100 | iso_pu_bacteria | 2593339198 | 2595316421 | 266 |
| 101 | iso_pu_bacteria | 2599185353 | 2600198517 | 266 |
| 102 | iso_pu_bacteria | 2648501850 | 2651531808 | 266 |
| 103 | iso_pu_bacteria | 2671180694 | 2673823179 | 266 |
| 104 | iso_pu_bacteria | 2671180844 | 2674418874 | 266 |
| 105 | iso_pu_bacteria | 2695420354 | 2695628292 | 266 |
| 106 | iso_pu_bacteria | 2716884898 | 2717916005 | 266 |
| 107 | iso_pu_bacteria | 2788500588 | 2791214373 | 266 |
| 108 | iso_pu_bacteria | 2808606399 | 2809055857 | 266 |
| 109 | iso_pu_bacteria | 2816332295 | 2817480812 | 266 |
| 110 | iso_pu_bacteria | 2818991451 | 2819628549 | 266 |
| 111 | iso_pu_bacteria | 2857453340 | 2857459322 | 266 |
| 112 | iso_pu_bacteria | 2857604169 | 2857606334 | 266 |
| 113 | iso_pu_bacteria | 2857609550 | 2857610770 | 266 |
| 114 | iso_pu_bacteria | 2860837431 | 2860840150 | 266 |
| 115 | iso_pu_bacteria | 2864997549 | 2864999989 | 266 |
| 116 | iso_pu_bacteria | 2877768649 | 2877771198 | 266 |
| 117 | iso_pu_bacteria | 2880169592 | 2880172062 | 266 |
| 118 | iso_pu_bacteria | 2889295896 | 2889296092 | 266 |
| 119 | iso_pu_bacteria | 2897109615 | 2897112275 | 266 |
| 120 | iso_pu_bacteria | 2904560550 | 2904562152 | 266 |
| 121 | iso_pu_bacteria | 2904606771 | 2904607806 | 266 |
| 122 | iso_pu_bacteria | 2916971899 | 2916973762 | 266 |
| 123 | iso_pu_bacteria | 2925326138 | 2925330115 | 266 |
| 124 | iso_pu_bacteria | 2939593269 | 2939594859 | 266 |
| 125 | iso_pu_bacteria | 2962290636 | 2962293428 | 266 |
| 126 | iso_pu_bacteria | 2964375228 | 2964378249 | 266 |
| 127 | iso_pu_bacteria | 2969136845 | 2969139436 | 266 |
| 128 | iso_pu_bacteria | 2969141011 | 2969143645 | 266 |
| 129 | iso_pu_bacteria | 2969765954 | 2969767405 | 266 |
| 130 | iso_pu_bacteria | 2969770375 | 2969773282 | 266 |
| 131 | iso_pu_bacteria | 2971410472 | 2971417336 | 266 |
| 132 | iso_pu_bacteria | 2971893375 | 2971895844 | 266 |
| 133 | iso_pu_bacteria | 2980125574 | 2980125857 | 266 |
| 134 | iso_pu_bacteria | 2980492589 | 2980495191 | 266 |
| 135 | iso_pu_bacteria | 2981284811 | 2981287835 | 266 |
| 136 | iso_pu_bacteria | 2981289755 | 2981292453 | 266 |
| 137 | iso_pu_bacteria | 2981980479 | 2981983454 | 266 |
| 138 | iso_pu_bacteria | 2981985349 | 2981988509 | 266 |
| 139 | iso_pu_bacteria | 3001272096 | 3001273892 | 266 |
| 140 | iso_pu_bacteria | 3006858327 | 3006861171 | 266 |
| 141 | iso_pu_bacteria | 3006879489 | 3006881656 | 266 |
| 142 | iso_pu_bacteria | 8022630665 | 8022631939 | 266 |
| 143 | iso_pu_bacteria | 8022653035 | 8022654317 | 266 |
| 144 | iso_pu_bacteria | 8051952484 | 8051955229 | 266 |
| 145 | iso_pu_bacteria | 8052174270 | 8052176121 | 266 |
| 146 | iso_pu_bacteria | 8054280661 | 8054281160 | 266 |
| 147 | iso_pu_bacteria | 8055531788 | 8055535382 | 266 |
| 148 | iso_pu_bacteria | 8056533031 | 8056540042 | 266 |
| 149 | 3300003187 | JGI25151J46595_10008020 | JGI25151J46595_100080205 | 267 |
| 150 | 3300003187 | JGI25151J46595_10075917 | JGI25151J46595_100759171 | 267 |
| 151 | 3300003316 | rootH1_10000457 | rootH1_1000045726 | 267 |
| 152 | 3300003320 | rootH2_10056773 | rootH2_100567736 | 267 |
| 153 | 3300003322 | rootL2_10004995 | rootL2_1000499522 | 267 |
| 154 | 3300003578 | Ga0006562J51391_1001442 | Ga0006562J51391_100144215 | 267 |
| 155 | 3300003790 | Ga0055528_1001481 | Ga0055528_10014815 | 267 |
| 156 | 3300009101 | Ga0105247_10004353 | Ga0105247_100043539 | 267 |
| 157 | 3300009148 | Ga0105243_10002181 | Ga0105243_100021815 | 267 |
| 158 | 3300009176 | Ga0105242_10001993 | Ga0105242_1000199310 | 267 |
| 159 | 3300010375 | Ga0105239_11103572 | Ga0105239_111035721 | 267 |
| 160 | 3300011119 | Ga0105246_10000276 | Ga0105246_1000027621 | 267 |
| 161 | 3300013296 | Ga0157374_10276520 | Ga0157374_102765202 | 267 |
| 162 | 3300013297 | Ga0157378_10003046 | Ga0157378_100030468 | 267 |
| 163 | 3300014745 | Ga0157377_10006785 | Ga0157377_100067855 | 267 |
| 164 | 3300025229 | Ga0209147_100618 | Ga0209147_1006181 | 267 |
| 165 | 3300025229 | Ga0209147_109705 | Ga0209147_1097051 | 267 |
| 166 | 3300025273 | Ga0209673_1002814 | Ga0209673_10028148 | 267 |
| 167 | 3300025294 | Ga0209025_1015420 | Ga0209025_10154206 | 267 |
| 168 | 3300025302 | Ga0207426_1043198 | Ga0207426_10431982 | 267 |
| 169 | 3300025711 | Ga0207696_1001570 | Ga0207696_10015709 | 267 |
| 170 | 3300025728 | Ga0207655_1101096 | Ga0207655_11010961 | 267 |
| 171 | 3300025735 | Ga0207713_1002283 | Ga0207713_10022838 | 267 |
| 172 | 3300025934 | Ga0207686_10008660 | Ga0207686_100086605 | 267 |
| 173 | 3300025935 | Ga0207709_10009372 | Ga0207709_100093721 | 267 |
| 174 | 3300031548 | Ga0307408_100007718 | Ga0307408_1000077182 | 267 |
| 175 | 3300032002 | Ga0307416_100441200 | Ga0307416_1004412002 | 267 |
| 176 | 3300046455 | Ga0495603_0059502 | Ga0495603_0059502_786_1589 | 267 |
| 177 | 3300046491 | Ga0495584_0008087 | Ga0495584_0008087_2323_3126 | 267 |
| 178 | 3300046492 | Ga0495585_0006773 | Ga0495585_0006773_4245_5048 | 267 |
| 179 | 3300046694 | Ga0495649_0102773 | Ga0495649_0102773_159_1019 | 267 |
| 180 | 3300047323 | Ga0495683_0005029 | Ga0495683_0005029_5208_6011 | 267 |
| 181 | 3300048903 | Ga0496100_0000790 | Ga0496100_0000790_6491_7294 | 267 |
| 182 | 3300048904 | Ga0496101_0038190 | Ga0496101_0038190_477_1280 | 267 |
| 183 | 3300048905 | Ga0496102_0019905 | Ga0496102_0019905_3890_4693 | 267 |
| 184 | 3300048906 | Ga0496103_0012475 | Ga0496103_0012475_477_1280 | 267 |
| 185 | 3300048907 | Ga0496104_0001771 | Ga0496104_0001771_8206_9009 | 267 |
| 186 | 3300048908 | Ga0496105_0000412 | Ga0496105_0000412_477_1280 | 267 |
| 187 | 3300048909 | Ga0496106_0000567 | Ga0496106_0000567_1380_2183 | 267 |
| 188 | 3300048910 | Ga0496107_0000227 | Ga0496107_0000227_19326_20129 | 267 |
| 189 | 3300048911 | Ga0496108_0002371 | Ga0496108_0002371_6260_7063 | 267 |
| 190 | 3300048912 | Ga0496109_0001823 | Ga0496109_0001823_1143_1946 | 267 |
| 191 | 3300048913 | Ga0496110_0018130 | Ga0496110_0018130_817_1620 | 267 |
| 192 | 3300048914 | Ga0496111_0000205 | Ga0496111_0000205_7566_8369 | 267 |
| 193 | 3300048915 | Ga0496112_0005112 | Ga0496112_0005112_3978_4781 | 267 |
| 194 | 3300048916 | Ga0496113_0079813 | Ga0496113_0079813_477_1280 | 267 |
| 195 | 3300048919 | Ga0496116_0036628 | Ga0496116_0036628_1619_2422 | 267 |
| 196 | 3300048922 | Ga0496119_0001436 | Ga0496119_0001436_701_1504 | 267 |
| 197 | 3300048925 | Ga0496122_0003585 | Ga0496122_0003585_205_1008 | 267 |
| 198 | 3300048925 | Ga0496122_0094227 | Ga0496122_0094227_720_1535 | 267 |
| 199 | 3300048926 | Ga0496123_0075946 | Ga0496123_0075946_1201_2004 | 267 |
| 200 | 3300048928 | Ga0496125_0001194 | Ga0496125_0001194_3055_3888 | 267 |
| 201 | 3300048928 | Ga0496125_0010715 | Ga0496125_0010715_7712_8515 | 267 |
| 202 | 3300048929 | Ga0496126_0008542 | Ga0496126_0008542_9228_10031 | 267 |
| 203 | 3300049161 | Ga0501305_021999 | Ga0501305_021999_16_819 | 267 |
| 204 | 3300049533 | Ga0501317_000213 | Ga0501317_000213_534_1337 | 267 |
| 205 | 3300049537 | Ga0501321_010839 | Ga0501321_010839_99_902 | 267 |
| 206 | 3300049649 | Ga0501198_011151 | Ga0501198_011151_506_1309 | 267 |
| 207 | iso_pu_bacteria | 2585428059 | 2587737767 | 267 |
| 208 | iso_pu_bacteria | 2738541295 | 2738816157 | 267 |
| 209 | iso_pu_bacteria | 2738543010 | 2739230120 | 267 |
| 210 | iso_pu_bacteria | 2818991459 | 2819670571 | 267 |
| 211 | iso_pu_bacteria | 2904755435 | 2904760047 | 267 |
| 212 | iso_pu_bacteria | 2919425241 | 2919427112 | 267 |
| 213 | iso_pu_bacteria | 2928510474 | 2928513972 | 267 |
| 214 | iso_pu_bacteria | 2936361878 | 2936366810 | 267 |
| 215 | iso_pu_bacteria | 2977254563 | 2977257185 | 267 |
| 216 | iso_pu_bacteria | 2990275345 | 2990278080 | 267 |
| 217 | iso_pu_bacteria | 3001892409 | 3001898690 | 267 |
| 218 | iso_pu_bacteria | 3006978542 | 3006979969 | 267 |
| 219 | iso_pu_bacteria | 3006978542 | 3006981865 | 267 |
| 220 | iso_pu_bacteria | 8054795415 | 8054804784 | 267 |
| 221 | iso_pu_bacteria | 8057632132 | 8057635467 | 267 |
| 222 | 3300044656 | Ga0466969_0005019 | Ga0466969_0005019_507_1316 | 268 |
| 223 | 3300044693 | Ga0466961_0315629 | Ga0466961_0315629_89_898 | 268 |
| 224 | 3300045049 | Ga0466959_0007024 | Ga0466959_0007024_6744_7553 | 268 |
| 225 | iso_pu_bacteria | 2600254943 | 2600401228 | 268 |
| 226 | iso_pu_bacteria | 2744054657 | 2745169494 | 268 |
| 227 | iso_pu_bacteria | 2816332336 | 2817617774 | 268 |
| 228 | iso_pu_bacteria | 2852673933 | 2852675337 | 268 |
| 229 | iso_pu_bacteria | 2857460504 | 2857462865 | 268 |
| 230 | iso_pu_bacteria | 2881644220 | 2881644414 | 268 |
| 231 | 3300003187 | JGI25151J46595_10006593 | JGI25151J46595_100065933 | 269 |
| 232 | 3300003187 | JGI25151J46595_10014848 | JGI25151J46595_100148483 | 269 |
| 233 | 3300003187 | JGI25151J46595_10018886 | JGI25151J46595_100188862 | 269 |
| 234 | 3300003187 | JGI25151J46595_10089862 | JGI25151J46595_100898621 | 269 |
| 235 | 3300009011 | Ga0105251_10057237 | Ga0105251_100572372 | 269 |
| 236 | 3300009036 | Ga0105244_10042031 | Ga0105244_100420312 | 269 |
| 237 | 3300009036 | Ga0105244_10065846 | Ga0105244_100658462 | 269 |
| 238 | 3300009036 | Ga0105244_10081969 | Ga0105244_100819692 | 269 |
| 239 | 3300009036 | Ga0105244_10109846 | Ga0105244_101098461 | 269 |
| 240 | 3300009092 | Ga0105250_10001260 | Ga0105250_100012604 | 269 |
| 241 | 3300009092 | Ga0105250_10044980 | Ga0105250_100449801 | 269 |
| 242 | 3300009092 | Ga0105250_10101796 | Ga0105250_101017961 | 269 |
| 243 | 3300011119 | Ga0105246_10078381 | Ga0105246_100783812 | 269 |
| 244 | 3300013102 | Ga0157371_10002286 | Ga0157371_100022863 | 269 |
| 245 | 3300025229 | Ga0209147_100519 | Ga0209147_10051912 | 269 |
| 246 | 3300025284 | Ga0209130_1002012 | Ga0209130_100201213 | 269 |
| 247 | 3300025284 | Ga0209130_1005420 | Ga0209130_10054202 | 269 |
| 248 | 3300025284 | Ga0209130_1009149 | Ga0209130_10091493 | 269 |
| 249 | 3300025284 | Ga0209130_1012990 | Ga0209130_10129902 | 269 |
| 250 | 3300025294 | Ga0209025_1000539 | Ga0209025_100053913 | 269 |
| 251 | 3300025294 | Ga0209025_1003755 | Ga0209025_100375512 | 269 |
| 252 | 3300025294 | Ga0209025_1004088 | Ga0209025_10040889 | 269 |
| 253 | 3300025294 | Ga0209025_1008720 | Ga0209025_10087202 | 269 |
| 254 | 3300025294 | Ga0209025_1021371 | Ga0209025_10213713 | 269 |
| 255 | 3300025294 | Ga0209025_1033756 | Ga0209025_10337562 | 269 |
| 256 | 3300025294 | Ga0209025_1050085 | Ga0209025_10500851 | 269 |
| 257 | 3300025294 | Ga0209025_1067542 | Ga0209025_10675422 | 269 |
| 258 | 3300025294 | Ga0209025_1077674 | Ga0209025_10776741 | 269 |
| 259 | 3300025711 | Ga0207696_1013027 | Ga0207696_10130271 | 269 |
| 260 | 3300025711 | Ga0207696_1013132 | Ga0207696_10131322 | 269 |
| 261 | 3300025728 | Ga0207655_1021566 | Ga0207655_10215663 | 269 |
| 262 | 3300025735 | Ga0207713_1046513 | Ga0207713_10465132 | 269 |
| 263 | 3300030083 | Ga0237817_10022 | Ga0237817_100221 | 269 |
| 264 | 3300030083 | Ga0237817_10093 | Ga0237817_1009331 | 269 |
| 265 | 3300031548 | Ga0307408_100007773 | Ga0307408_1000077733 | 269 |
| 266 | 3300031995 | Ga0307409_100349934 | Ga0307409_1003499342 | 269 |
| 267 | 3300038705 | Ga0237819_00614 | Ga0237819_00614_10649_11461 | 269 |
| 268 | 3300045976 | Ga0466967_0000144 | Ga0466967_0000144_25483_26295 | 269 |
| 269 | 3300046474 | Ga0495605_0116015 | Ga0495605_0116015_287_1096 | 269 |
| 270 | 3300046665 | Ga0495661_0063086 | Ga0495661_0063086_568_1377 | 269 |
| 271 | 3300046665 | Ga0495661_0219354 | Ga0495661_0219354_34_843 | 269 |
| 272 | 3300048903 | Ga0496100_0158489 | Ga0496100_0158489_184_993 | 269 |
| 273 | 3300048904 | Ga0496101_0149947 | Ga0496101_0149947_269_1078 | 269 |
| 274 | 3300048913 | Ga0496110_0033997 | Ga0496110_0033997_272_1123 | 269 |
| 275 | 3300048913 | Ga0496110_0069531 | Ga0496110_0069531_2104_2922 | 269 |
| 276 | 3300048915 | Ga0496112_0066480 | Ga0496112_0066480_1978_2787 | 269 |
| 277 | 3300048916 | Ga0496113_0230230 | Ga0496113_0230230_38_847 | 269 |
| 278 | 3300049131 | Ga0501341_00478 | Ga0501341_00478_259_1068 | 269 |
| 279 | 3300049161 | Ga0501305_015465 | Ga0501305_015465_109_918 | 269 |
| 280 | 3300049531 | Ga0501315_000399 | Ga0501315_000399_1995_2804 | 269 |
| 281 | 3300049533 | Ga0501317_000077 | Ga0501317_000077_1995_2804 | 269 |
| 282 | 3300049533 | Ga0501317_016901 | Ga0501317_016901_16_825 | 269 |
| 283 | 3300049534 | Ga0501318_000051 | Ga0501318_000051_1934_2743 | 269 |
| 284 | 3300049537 | Ga0501321_000045 | Ga0501321_000045_644_1453 | 269 |
| 285 | 3300049548 | Ga0501332_00094 | Ga0501332_00094_60_869 | 269 |
| 286 | 3300049550 | Ga0501334_01047 | Ga0501334_01047_602_1411 | 269 |
| 287 | 3300049551 | Ga0501335_000021 | Ga0501335_000021_3202_4011 | 269 |
| 288 | 3300049551 | Ga0501335_000348 | Ga0501335_000348_1686_2495 | 269 |
| 289 | 3300049551 | Ga0501335_007889 | Ga0501335_007889_32_874 | 269 |
| 290 | 3300049553 | Ga0501337_000035 | Ga0501337_000035_1682_2491 | 269 |
| 291 | 3300049554 | Ga0501338_00197 | Ga0501338_00197_1513_2322 | 269 |
| 292 | iso_pu_bacteria | 2554235283 | 2555467704 | 269 |
| 293 | iso_pu_bacteria | 2643221735 | 2644740869 | 269 |
| 294 | iso_pu_bacteria | 2671180330 | 2672337012 | 269 |
| 295 | iso_pu_bacteria | 2684623153 | 2686997526 | 269 |
| 296 | iso_pu_bacteria | 2687453109 | 2687498833 | 269 |
| 297 | iso_pu_bacteria | 2811994870 | 2812316721 | 269 |
| 298 | iso_pu_bacteria | 2816332186 | 2816862564 | 269 |
| 299 | iso_pu_bacteria | 2818991441 | 2819569303 | 269 |
| 300 | iso_pu_bacteria | 2818991468 | 2819723781 | 269 |
| 301 | iso_pu_bacteria | 2823526263 | 2823528703 | 269 |
| 302 | iso_pu_bacteria | 2842682962 | 2842684519 | 269 |
| 303 | iso_pu_bacteria | 2849139964 | 2849142542 | 269 |
| 304 | iso_pu_bacteria | 2857581216 | 2857585706 | 269 |
| 305 | iso_pu_bacteria | 2908665501 | 2908668095 | 269 |
| 306 | iso_pu_bacteria | 2919093281 | 2919095863 | 269 |
| 307 | iso_pu_bacteria | 2919726948 | 2919728417 | 269 |
| 308 | iso_pu_bacteria | 2929206907 | 2929210638 | 269 |
| 309 | iso_pu_bacteria | 2954773129 | 2954773778 | 269 |
| 310 | 3300003187 | JGI25151J46595_10011908 | JGI25151J46595_100119082 | 270 |
| 311 | 3300003578 | Ga0006562J51391_1004050 | Ga0006562J51391_10040502 | 270 |
| 312 | 3300003751 | Ga0055538_1000233 | Ga0055538_10002339 | 270 |
| 313 | 3300003758 | Ga0055532_1002155 | Ga0055532_10021551 | 270 |
| 314 | 3300003781 | Ga0055536_1027134 | Ga0055536_10271342 | 270 |
| 315 | 3300025224 | Ga0209784_100099 | Ga0209784_10009977 | 270 |
| 316 | 3300025225 | Ga0209566_100248 | Ga0209566_10024842 | 270 |
| 317 | 3300025229 | Ga0209147_100068 | Ga0209147_100068123 | 270 |
| 318 | 3300025292 | Ga0209676_1000783 | Ga0209676_100078315 | 270 |
| 319 | 3300025292 | Ga0209676_1014882 | Ga0209676_10148822 | 270 |
| 320 | 3300025292 | Ga0209676_1023851 | Ga0209676_10238512 | 270 |
| 321 | 3300025294 | Ga0209025_1004904 | Ga0209025_100490413 | 270 |
| 322 | 3300025294 | Ga0209025_1020687 | Ga0209025_10206872 | 270 |
| 323 | 3300025294 | Ga0209025_1037420 | Ga0209025_10374202 | 270 |
| 324 | 3300031548 | Ga0307408_100079238 | Ga0307408_1000792382 | 270 |
| 325 | 3300031731 | Ga0307405_10382420 | Ga0307405_103824202 | 270 |
| 326 | 3300032002 | Ga0307416_100129396 | Ga0307416_1001293962 | 270 |
| 327 | 3300037466 | Ga0395898_0214670 | Ga0395898_0214670_939_1754 | 270 |
| 328 | 3300045051 | Ga0451576_0081089 | Ga0451576_0081089_248_1081 | 270 |
| 329 | 3300048916 | Ga0496113_0364945 | Ga0496113_0364945_43_858 | 270 |
| 330 | 3300049532 | Ga0501316_002695 | Ga0501316_002695_765_1592 | 270 |
| 331 | 3300049588 | Ga0501072_0404931 | Ga0501072_0404931_112_933 | 270 |
| 332 | iso_pu_bacteria | 2510917027 | 2511176569 | 270 |
| 333 | iso_pu_bacteria | 2512564013 | 2512640472 | 270 |
| 334 | iso_pu_bacteria | 2831905167 | 2831906791 | 270 |
| 335 | iso_pu_bacteria | 2857465823 | 2857469154 | 270 |
| 336 | iso_pu_bacteria | 2857591370 | 2857596192 | 270 |
| 337 | iso_pu_bacteria | 2898907183 | 2898909007 | 270 |
| 338 | iso_pu_bacteria | 2915597211 | 2915600681 | 270 |
| 339 | iso_pu_bacteria | 2915606848 | 2915607890 | 270 |
| 340 | iso_pu_bacteria | 2919414237 | 2919419261 | 270 |
| 341 | iso_pu_bacteria | 2929183550 | 2929185817 | 270 |
| 342 | 3300049161 | Ga0501305_003814 | Ga0501305_003814_748_1563 | 271 |
| 343 | 3300049533 | Ga0501317_005331 | Ga0501317_005331_542_1357 | 271 |
| 344 | 3300049551 | Ga0501335_000130 | Ga0501335_000130_2704_3519 | 271 |
| 345 | 3300027312 | Ga0209371_1002323 | Ga0209371_10023235 | 272 |
| 346 | 3300030500 | Ga0268256_1002064 | Ga0268256_10020645 | 272 |
| 347 | 3300003187 | JGI25151J46595_10000006 | JGI25151J46595_10000006423 | 273 |
| 348 | 3300003578 | Ga0006562J51391_1001146 | Ga0006562J51391_100114633 | 273 |
| 349 | 3300003578 | Ga0006562J51391_1001176 | Ga0006562J51391_10011763 | 273 |
| 350 | 3300025294 | Ga0209025_1000001 | Ga0209025_1000001574 | 273 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8pbj-assembly1.cif.gz_A | mutant r1722w of the dihydroorotase domain of human cad protein bound to the substrate carbamoyl aspartate | 0.6745 | 38 | 88 |
| 8pbh-assembly1.cif.gz_A | mutant r1617q of the dihydroorotase domain of human cad protein bound to the substrate carbamoyl aspartate | 0.6729 | 38 | 88 |
| 3gri-assembly1.cif.gz_A | the crystal structure of a dihydroorotase from staphylococcus aureus | 0.6647 | 38 | 88 |
| 7yor-assembly1.cif.gz_B | recj2 and dcmp complex from methanocaldococcus jannaschii | 0.6534 | 4 | 88 |
| 7owk-assembly1.cif.gz_C | odinarchaeota adenylate kinase (odinak) in complex with dttp | 0.6123 | 148 | 268 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ep1B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase | 0.6651 | 4 | 88 | 3.40.50.1370 |
| 4m88A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.6563 | 4 | 85 | 3.40.50.2300 |
| 6hl7B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase | 0.6506 | 4 | 90 | 3.40.50.1370 |
| af_A0A5K1K910_58_191_3.40.50.1370 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase | 0.6506 | 1 | 88 | 3.40.50.1370 |
| 1gq3A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase | 0.646 | 1 | 88 | 3.40.50.1370 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-E1NNZ4-F1-model_v4 | deleted | 0.9934 | 115 | 199 |
|
| AF-A0A7Z7YSP8-F1-model_v4 | Phosphoenolpyruvate synthase regulatory protein | 0.9868 | 171 | 270 |
GO:0004674
GO:0005524 |
| AF-A0A3D0MRX8-F1-model_v4 | Phosphoenolpyruvate synthase regulatory protein | 0.9812 | 121 | 268 |
GO:0004674
GO:0005524 |
| AF-A0A3D1JBM7-F1-model_v4 | Phosphoenolpyruvate synthase regulatory protein | 0.9808 | 166 | 268 |
GO:0004674
GO:0005524 |
| AF-A0A645HR73-F1-model_v4 | Putative pyruvate, phosphate dikinase regulatory protein (EC 2.7.11.32) | 0.9803 | 144 | 271 |
GO:0004674
GO:0005524 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar