F418396

General Info

Members Datasets Scaffolds Average Seq Length
350 241 701 158

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0000212|Ga0496126_0000212_103905_104441
Length 178
Sequence MPAVSVSKNPAGPKAGEGSDMLPYPLLSASLVIMWLALNGFTLGHLILGCIVAVFASWGMASLRPAKPRLRKWYLLPKLVGIVLYDIVRSNIAVASIILGGHRRQFKSGFITVPLDVESPMALAVLAVVVTSTPGTAWLEYNSLNRTVLIHVLDLVDEAEWQTLIKGRYEALLMEIFE

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
40 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
51 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
53 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
54 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
55 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
56 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
57 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
77 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
80 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
87 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
88 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
89 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
90 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
91 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
92 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
93 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
104 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
105 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
106 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
107 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
108 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
109 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
110 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
118 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
119 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
120 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
121 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
122 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
123 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
124 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
134 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
138 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
143 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
144 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
145 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
146 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
147 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
150 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
151 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
152 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
153 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
154 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
155 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
156 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
157 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
158 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
159 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
160 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
161 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
162 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
163 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
164 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
165 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
166 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
167 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
168 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
169 2643221558 Rhizobium sp. Root149 Isolate Unclassified
170 2643221568 Rhizobium sp. Root564 Isolate Unclassified
171 2643221582 Rhizobium sp. Root651 Isolate Unclassified
172 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
173 2643221693 Rhizobium sp. Root491 Isolate Unclassified
174 2643221719 Rhizobium sp. Root274 Isolate Unclassified
175 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
176 2738541293 Rhizobium sp. GV031 Isolate Unclassified
177 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
178 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
179 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
180 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
181 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
182 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
183 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
184 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
185 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
186 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
187 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
188 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
189 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
190 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
191 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
192 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
193 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
194 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
195 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
196 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
197 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
198 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
199 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
200 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
201 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
202 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
203 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
204 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
205 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
206 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
207 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
208 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
209 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
210 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
211 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
212 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
213 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
214 2932401849 Devosia sp. 2618 Isolate Rhizosphere
215 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
216 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
217 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
218 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
219 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
220 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
221 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
222 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
223 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
224 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
225 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
226 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
227 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
228 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
229 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
230 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
231 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
232 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
233 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
234 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
235 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
236 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
237 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
238 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
239 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
240 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
241 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74
Metatranscriptomes 0
Isolates 26

Biome Distribution

Category Percentage (%)
Aerial Root 1.43
Bulb 0
Endosphere 26
Nodule 9.14
Rhizoplane 3.71
Rhizosphere 26.29
Stem 0
Stem Tuber 0
Unclassified 2.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0000212 3300048929 Bacteria 128871
2 JGI25155J39150_1000003 3300002704 Bacteria 279666
3 JGI25156J39149_1000004 3300002705 Bacteria 273027
4 JGI25162J39368_1000570 3300002737 Bacteria 27083
5 JGI25162J39368_1006124 3300002737 Bacteria 2152
6 JGI25154J39366_1000013 3300002738 Bacteria 268260
7 JGI25157J39369_1000004 3300002741 Bacteria 273009
8 JGI25163J39215_1007053 3300002771 Bacteria 642
9 JGI25150J39212_1000155 3300002774 Bacteria 38722
10 JGI25159J45721_1000308 3300002987 Bacteria 22894
11 JGI25151J46595_10000007 3300003187 Bacteria 411751
12 JGI25151J46595_10011697 3300003187 Bacteria 4023
13 JGI25165J46597_1000263 3300003214 Bacteria 68906
14 JGI25165J46597_1001021 3300003214 Bacteria 18446
15 JGI25153J46596_10000569 3300003215 Bacteria 22766
16 JGI25153J46596_10031347 3300003215 Bacteria 1792
17 rootH1_10007216 3300003316 Bacteria 10392
18 rootH2_10026419 3300003320 Bacteria 4589
19 rootH2_10099275 3300003320 Bacteria 3899
20 rootH2_10171268 3300003320 Bacteria 1476
21 rootL2_10002196 3300003322 Bacteria 46229
22 rootL2_10338264 3300003322 Bacteria 2240
23 rootH1_10016790 3300003316 Bacteria 7037
24 rootH1_10016790 3300003323 Bacteria 4803
25 rootH1_10185923 3300003323 Bacteria 1454
26 rootH1_10269314 3300003323 Bacteria 2525
27 JGI25160J50197_1019408 3300003354 Bacteria 2084
28 JGI25161J50226_1000231 3300003374 Bacteria 34155
29 Ga0055526_1002902 3300003771 Bacteria 11291
30 Ga0055524_1004464 3300003775 Bacteria 6460
31 Ga0055528_1002564 3300003790 Bacteria 9624
32 Ga0055530_10027113 3300003791 Bacteria 1569
33 Ga0055540_1014842 3300003792 Bacteria 2300
34 Ga0055531_10033074 3300003794 Bacteria 1674
35 Ga0058692_1000651 3300003856 Bacteria 14332
36 Ga0058692_1003220 3300003856 Bacteria 5127
37 Ga0058692_1029020 3300003856 Bacteria 1062
38 Ga0055543_1000190 3300004625 Bacteria 50170
39 Ga0065165_1006054 3300005262 Bacteria 6496
40 Ga0065704_10132416 3300005289 Bacteria 1613
41 Ga0070668_100009809 3300005347 Bacteria 7095
42 Ga0070663_100326172 3300005455 Unclassified 1236
43 Ga0070665_100005844 3300005548 Bacteria 12621
44 Ga0070665_100205555 3300005548 Bacteria 1970
45 Ga0075365_10008409 3300006038 Bacteria 5856
46 Ga0075365_10115788 3300006038 Bacteria 1845
47 Ga0075368_10034526 3300006042 Bacteria 1971
48 Ga0075368_10038934 3300006042 Bacteria 1862
49 Ga0075363_100232122 3300006048 Bacteria 1059
50 Ga0075364_10016127 3300006051 Bacteria 4644
51 Ga0075364_10142493 3300006051 Bacteria 1613
52 Ga0075367_10442803 3300006178 Bacteria 823
53 Ga0075369_10029183 3300006186 Bacteria 2316
54 Ga0075369_10051697 3300006186 Bacteria 1779
55 Ga0075369_10226173 3300006186 Bacteria 866
56 Ga0075369_10404567 3300006186 Bacteria 644
57 Ga0075366_10226363 3300006195 Bacteria 1139
58 Ga0099826_10000109 3300006948 Bacteria 38139
59 Ga0099826_10092557 3300006948 Bacteria 1845
60 Ga0105244_10244862 3300009036 Bacteria 837
61 Ga0105240_10649075 3300009093 Bacteria 1157
62 Ga0105243_10014434 3300009148 Bacteria 5980
63 Ga0105238_10533790 3300009551 Bacteria 1177
64 Ga0157314_1004049 3300012500 Unclassified 1064
65 Ga0157373_10012386 3300013100 Bacteria 6271
66 Ga0157373_10210739 3300013100 Bacteria 1370
67 Ga0157373_10221544 3300013100 Bacteria 1335
68 Ga0157371_10000004 3300013102 Bacteria 512593
69 Ga0157371_10032139 3300013102 Bacteria 3778
70 Ga0157370_10000185 3300013104 Bacteria 78153
71 Ga0157370_10134690 3300013104 Bacteria 2303
72 Ga0157369_10069466 3300013105 Bacteria 3784
73 Ga0157369_10565494 3300013105 Bacteria 1175
74 Ga0163161_10047981 3300017792 Bacteria 3083
75 Ga0209435_100006 3300025206 Bacteria 542459
76 Ga0209436_100012 3300025208 Bacteria 136927
77 Ga0207427_113986 3300025231 Bacteria 777
78 Ga0209437_100062 3300025233 Bacteria 336900
79 Ga0209437_100104 3300025233 Bacteria 220736
80 Ga0207425_1000018 3300025245 Bacteria 411841
81 Ga0209646_1000015 3300025246 Bacteria 542459
82 Ga0209646_1001639 3300025246 Bacteria 5745
83 Ga0209026_1000039 3300025250 Bacteria 280608
84 Ga0209148_1033094 3300025254 Bacteria 757
85 Ga0209759_1000005 3300025256 Bacteria 542459
86 Ga0209129_1000026 3300025258 Bacteria 411839
87 Ga0209233_1000054 3300025261 Bacteria 439669
88 Ga0209233_1000082 3300025261 Bacteria 336320
89 Ga0209455_1014236 3300025272 Bacteria 1809
90 Ga0209673_1002129 3300025273 Bacteria 14782
91 Ga0209673_1004049 3300025273 Bacteria 8106
92 Ga0209130_1000022 3300025284 Bacteria 361244
93 Ga0209676_1010558 3300025292 Bacteria 3828
94 Ga0209025_1000035 3300025294 Bacteria 411841
95 Ga0209025_1000060 3300025294 Bacteria 305017
96 Ga0209025_1000436 3300025294 Bacteria 82202
97 Ga0209564_1003976 3300025295 Bacteria 9390
98 Ga0209758_1000040 3300025297 Bacteria 411841
99 Ga0209758_1000853 3300025297 Bacteria 42429
100 Ga0209758_1013004 3300025297 Bacteria 4590
101 Ga0209758_1045200 3300025297 Bacteria 1601
102 Ga0209050_1012066 3300025298 Bacteria 4012
103 Ga0209256_1013709 3300025299 Unclassified 2987
104 Ga0209256_1027226 3300025299 Bacteria 1632
105 Ga0209256_1080008 3300025299 Bacteria 716
106 Ga0209256_1109095 3300025299 Unclassified 560
107 Ga0207426_1000005 3300025302 Bacteria 1037188
108 Ga0209051_1001808 3300025303 Bacteria 16953
109 Ga0209051_1037874 3300025303 Bacteria 1762
110 Ga0209257_1089276 3300025304 Bacteria 773
111 Ga0207709_10523343 3300025935 Bacteria 929
112 Ga0207668_10100363 3300025972 Bacteria 2149
113 Ga0209371_1000009 3300027312 Bacteria 963030
114 Ga0209371_1000424 3300027312 Bacteria 43444
115 Ga0209371_1003065 3300027312 Bacteria 8572
116 Ga0209282_1030376 3300027666 Bacteria 3327
117 Ga0209282_1121559 3300027666 Bacteria 1305
118 Ga0209813_10015758 3300027866 Bacteria 2053
119 Ga0209813_10074440 3300027866 Bacteria 1111
120 Ga0268266_10015688 3300028379 Bacteria 6491
121 Ga0268256_1000010 3300030500 Bacteria 963034
122 Ga0268256_1025011 3300030500 Bacteria 1523
123 Ga0316181_1017626 3300030744 Bacteria 3151
124 Ga0307405_10000728 3300031731 Bacteria 12824
125 Ga0307406_10036006 3300031901 Bacteria 3047
126 Ga0307406_10060630 3300031901 Bacteria 2440
127 Ga0307406_10804875 3300031901 Unclassified 793
128 Ga0307412_10019177 3300031911 Bacteria 4135
129 Ga0307409_100963453 3300031995 Unclassified 870
130 Ga0307409_101538195 3300031995 Unclassified 693
131 Ga0307414_10073525 3300032004 Bacteria 2473
132 Ga0307414_10143313 3300032004 Bacteria 1874
133 Ga0439465_0007849 3300041413 Bacteria 3382
134 Ga0451797_0442221 3300041453 Bacteria 613
135 Ga0451807_2018948 3300041486 Bacteria 925
136 Ga0451833_0103945 3300041491 Bacteria 13159
137 Ga0451837_1075150 3300041494 Bacteria 17021
138 Ga0451849_1353073 3300041505 Bacteria 2842
139 Ga0451843_0419974 3300041509 Bacteria 5331
140 Ga0451855_1236972 3300041511 Bacteria 9160
141 Ga0466966_0046143 3300044684 Bacteria 2783
142 Ga0466963_0000823 3300044694 Bacteria 15527
143 Ga0466964_0108454 3300044706 Bacteria 1235
144 Ga0466971_0313189 3300044719 Bacteria 755
145 Ga0466970_0005579 3300044765 Bacteria 6254
146 Ga0466959_0519176 3300045049 Bacteria 804
147 Ga0466958_0069969 3300045836 Bacteria 2147
148 Ga0466967_0208414 3300045976 Bacteria 1853
149 Ga0495638_0023950 3300046460 Bacteria 3986
150 Ga0495607_0342577 3300046501 Bacteria 692
151 Ga0495610_0001287 3300046512 Bacteria 22420
152 Ga0495632_0086965 3300046519 Bacteria 1486
153 Ga0495633_0014485 3300046558 Bacteria 4122
154 Ga0495588_0000622 3300046674 Bacteria 16604
155 Ga0495671_0193722 3300046692 Bacteria 987
156 Ga0495673_0088101 3300047469 Bacteria 1273
157 Ga0495681_0011202 3300047470 Bacteria 5360
158 Ga0495686_0004971 3300047472 Bacteria 10692
159 Ga0496100_0244535 3300048903 Bacteria 1325
160 Ga0496101_0051855 3300048904 Bacteria 2957
161 Ga0496106_0001636 3300048909 Bacteria 16807
162 Ga0496110_0190730 3300048913 Bacteria 1861
163 Ga0496111_0000411 3300048914 Bacteria 21500
164 Ga0496116_0000100 3300048919 Bacteria 194740
165 Ga0496116_0000692 3300048919 Bacteria 43664
166 Ga0496116_0010532 3300048919 Bacteria 7733
167 Ga0496116_0058530 3300048919 Bacteria 2512
168 Ga0496116_0127447 3300048919 Bacteria 1459
169 Ga0496117_0000002 3300048920 Bacteria 2483758
170 Ga0496117_0001643 3300048920 Bacteria 31420
171 Ga0496117_0006361 3300048920 Bacteria 11999
172 Ga0496117_0007393 3300048920 Bacteria 10749
173 Ga0496117_0102539 3300048920 Bacteria 1805
174 Ga0496117_0293155 3300048920 Bacteria 865
175 Ga0496118_0001493 3300048921 Bacteria 34920
176 Ga0496118_0010681 3300048921 Bacteria 9051
177 Ga0496118_0010730 3300048921 Bacteria 9032
178 Ga0496118_0275130 3300048921 Bacteria 940
179 Ga0496119_0007481 3300048922 Bacteria 9821
180 Ga0496119_0016902 3300048922 Bacteria 5521
181 Ga0496119_0026093 3300048922 Bacteria 4061
182 Ga0496119_0108089 3300048922 Bacteria 1549
183 Ga0496119_0116321 3300048922 Bacteria 1476
184 Ga0496120_0000021 3300048923 Bacteria 250966
185 Ga0496120_0112980 3300048923 Bacteria 1416
186 Ga0496121_0000001 3300048924 Bacteria 1830318
187 Ga0496121_0073094 3300048924 Bacteria 2749
188 Ga0496121_0115787 3300048924 Bacteria 2035
189 Ga0496121_0417594 3300048924 Bacteria 874
190 Ga0496121_0485426 3300048924 Bacteria 788
191 Ga0496121_0584078 3300048924 Bacteria 692
192 Ga0496122_0000001 3300048925 Bacteria 1827766
193 Ga0496122_0000494 3300048925 Bacteria 81969
194 Ga0496122_0000889 3300048925 Bacteria 55661
195 Ga0496122_0008413 3300048925 Bacteria 11146
196 Ga0496122_0033228 3300048925 Bacteria 4248
197 Ga0496122_0082785 3300048925 Bacteria 2227
198 Ga0496122_0084360 3300048925 Bacteria 2197
199 Ga0496123_0000001 3300048926 Bacteria 1831497
200 Ga0496123_0000442 3300048926 Bacteria 74540
201 Ga0496123_0003397 3300048926 Bacteria 17930
202 Ga0496123_0006606 3300048926 Bacteria 11200
203 Ga0496123_0046625 3300048926 Bacteria 2937
204 Ga0496123_0076793 3300048926 Bacteria 2054
205 Ga0496123_0226076 3300048926 Bacteria 940
206 Ga0496124_0000023 3300048927 Bacteria 415226
207 Ga0496124_0000063 3300048927 Bacteria 229705
208 Ga0496124_0003101 3300048927 Bacteria 20649
209 Ga0496124_0007381 3300048927 Bacteria 11691
210 Ga0496124_0011544 3300048927 Bacteria 8816
211 Ga0496124_0015675 3300048927 Bacteria 7250
212 Ga0496124_0107253 3300048927 Bacteria 2254
213 Ga0496124_0120110 3300048927 Bacteria 2101
214 Ga0496124_0131192 3300048927 Bacteria 1990
215 Ga0496124_0801074 3300048927 Bacteria 583
216 Ga0496125_0000001 3300048928 Bacteria 1766138
217 Ga0496125_0000422 3300048928 Bacteria 78615
218 Ga0496125_0027161 3300048928 Bacteria 5195
219 Ga0496125_0036150 3300048928 Bacteria 4318
220 Ga0496125_0045452 3300048928 Bacteria 3695
221 Ga0496126_0000094 3300048929 Bacteria 208184
222 Ga0496126_0007849 3300048929 Bacteria 11628
223 Ga0496126_0043148 3300048929 Bacteria 4162
224 Ga0496126_0105881 3300048929 Bacteria 2455
225 Ga0496126_0312818 3300048929 Bacteria 1292
226 Ga0496126_1003291 3300048929 Bacteria 626
227 Ga0501031_0079042 3300049568 Bacteria 2143
228 Ga0501032_0068545 3300049569 Bacteria 2368
229 Ga0501034_0064739 3300049571 Bacteria 3669
230 Ga0501036_0232872 3300049572 Bacteria 1545
231 Ga0501043_0033181 3300049579 Bacteria 4060
232 Ga0501048_0665531 3300049582 Bacteria 748
233 Ga0501227_176812 3300049665 Unclassified 599
234 Ga0501225_0022660 3300049705 Bacteria 1734
235 Ga0501035_0175252 3300049822 Bacteria 1850
236 Ga0501045_0220563 3300049824 Bacteria 1412
237 nmdc:mga03683_101212_c1 3300050489 Bacteria 1266
238 nmdc:mga03n38_15478_c1 3300050490 Bacteria 2947
239 nmdc:mga00v17_48_c1 3300050491 Bacteria 75606
240 nmdc:mga00v17_5790_c1 3300050491 Bacteria 6527
241 nmdc:mga0yw44_1426_c2 3300050492 Bacteria 3702
242 nmdc:mga0yw44_262534_c1 3300050492 Bacteria 1151
243 nmdc:mga0yw44_5888_c1 3300050492 Bacteria 5858
244 nmdc:mga0k408_702200_c1 3300050493 Bacteria 593
245 nmdc:mga04h51_18498_c1 3300050495 Bacteria 2053
246 nmdc:mga0sz30_11796_c1 3300050516 Bacteria 1499
247 Ga0500644_0057216 3300053088 Bacteria 1360
248 Ga0500560_000852 3300053107 Bacteria 4737
249 Ga0500560_092307 3300053107 Bacteria 1012
250 Ga0500618_000041 3300053125 Bacteria 111404
251 Ga0500618_005454 3300053125 Bacteria 3864
252 Ga0500573_0000918 3300053140 Bacteria 13410
253 Ga0500573_0003057 3300053140 Bacteria 8575
254 Ga0500616_0000304 3300053153 Bacteria 71131
255 Ga0500633_0000151 3300053160 Bacteria 9308
256 Ga0500634_0000020 3300053161 Bacteria 106250
257 Ga0500634_0016676 3300053161 Bacteria 3922
258 Ga0500634_0076952 3300053161 Bacteria 1730
259 Ga0500636_0000006 3300053177 Bacteria 183899
260 Ga0500636_0129561 3300053177 Bacteria 1407
261 2510843764 2510461069 Bacteria 5505000
262 2511171175 2510917026 Bacteria 7046020
263 2537876011 2537561587 Bacteria 5425293
264 2554246541 2554235003 Bacteria 5877155
265 2559293716 2558860242 Bacteria 5568029
266 2585258836 2582581304 Bacteria 5831370
267 2585334996 2582581316 Bacteria 7774528
268 2585846138 2585427594 Bacteria 6180594
269 2585995465 2585427633 Bacteria 6413184
270 2586000068 2585427634 Bacteria 6455027
271 2599606024 2599185210 Bacteria 5624189
272 2599717949 2599185236 Bacteria 6875203
273 2600376928 2600254933 Bacteria 4750527
274 2601609259 2600255279 Bacteria 5605316
275 2601746034 2600255308 Bacteria 5611129
276 2616552888 2615840698 Bacteria 7319877
277 2617381336 2617270742 Bacteria 6808054
278 2643814443 2643221558 Bacteria 5460675
279 2643855216 2643221568 Bacteria 5187270
280 2643918311 2643221582 Bacteria 5804683
281 2644298280 2643221653 Bacteria 4569637
282 2644519317 2643221693 Bacteria 5513853
283 2644659219 2643221719 Bacteria 4568197
284 2671114659 2667528174 Bacteria 6435400
285 2738799871 2738541293 Bacteria 7065685
286 2776911356 2775507049 Bacteria 6284736
287 2778124871 2775507255 Bacteria 3945731
288 2778174521 2775507266 Bacteria 7392367
289 2808986456 2808606387 Bacteria 5697198
290 2819243308 2818991272 Bacteria 4622173
291 2819245316 2818991272 Bacteria 4622173
292 2819556586 2818991439 Bacteria 6907412
293 2819607791 2818991448 Bacteria 6772224
294 2838032595 2838029111 Bacteria 6603031
295 2838677314 2838675328 Bacteria 4909118
296 2838716202 2838714209 Bacteria 5525906
297 2838719998 2838719591 Bacteria 5523910
298 2838726954 2838724970 Bacteria 4908691
299 2841846930 2841846520 Bacteria 5345850
300 2841860542 2841859092 Bacteria 5436171
301 2842127041 2842124991 Bacteria 5346824
302 2842132207 2842130223 Bacteria 4909145
303 2842152624 2842152218 Bacteria 4908957
304 2842172447 2842170452 Bacteria 5525737
305 2842176243 2842175837 Bacteria 4908771
306 2842189309 2842187318 Bacteria 5524014
307 2842213623 2842211629 Bacteria 5523832
308 2842224759 2842224351 Bacteria 5524473
309 2842479327 2842475841 Bacteria 6603183
310 2842485438 2842482326 Bacteria 7212537
311 2842506514 2842502639 Bacteria 6604161
312 2842517327 2842515876 Bacteria 5436280
313 2854900597 2854896431 Bacteria 5869725
314 2891375589 2891373044 Bacteria 5202277
315 2899792624 2899792073 Bacteria 4926588
316 2899846006 2899845264 Bacteria 5672268
317 2919116405 2919114240 Bacteria 5700270
318 2919166787 2919166419 Bacteria 4952238
319 2919175504 2919171160 Bacteria 6499771
320 2919413387 2919408235 Bacteria 6149349
321 2926757359 2926754445 Bacteria 5964435
322 2926761575 2926760298 Bacteria 5505990
323 2929138720 2929138655 Bacteria 5810547
324 2932403653 2932401849 Bacteria 4262978
325 2933007269 2933006813 Bacteria 4912075
326 2933015140 2933011516 Bacteria 5439334
327 2933594474 2933594066 Bacteria 5594265
328 2978973203 2978969890 Bacteria 5400756
329 2979093135 2979089926 Bacteria 5670289
330 2979099478 2979095461 Bacteria 5669583
331 2979105102 2979100975 Bacteria 5423623
332 2984513056 2984509177 Bacteria 5274802
333 2984520579 2984518228 Bacteria 5277463
334 2984539873 2984537506 Bacteria 5277481
335 2984591451 2984587000 Bacteria 5263363
336 2984602080 2984601300 Bacteria 5455244
337 2989353871 2989349275 Bacteria 6349068
338 2989773945 2989771324 Bacteria 5605128
339 2989781525 2989776772 Bacteria 4843317
340 3003935351 3003930520 Bacteria 5667563
341 3005422209 3005416602 Bacteria 7064308
342 650738958 650716007 Bacteria 5573770
343 8003572590 8003570095 Bacteria 5747666
344 8005250170 8005246636 Bacteria 4933972
345 8005321488 8005314921 Bacteria 7072929
346 8005489767 8005484373 Bacteria 6297373
347 8005650637 8005645114 Bacteria 6950293
348 8005683687 8005682033 Bacteria 6726518
349 8018150931 8018150411 Bacteria 5549903
350 8054461232 8054460903 Bacteria 4872905
351 8054561588 8054558443 Bacteria 5204801
352 Ga0496126_0000212
353 JGI25155J39150_1000003
354 JGI25156J39149_1000004
355 JGI25162J39368_1000570
356 JGI25162J39368_1006124
357 JGI25154J39366_1000013
358 JGI25157J39369_1000004
359 JGI25163J39215_1007053
360 JGI25150J39212_1000155
361 JGI25159J45721_1000308
362 JGI25151J46595_10000007
363 JGI25151J46595_10011697
364 JGI25165J46597_1000263
365 JGI25165J46597_1001021
366 JGI25153J46596_10000569
367 JGI25153J46596_10031347
368 rootH1_10007216
369 rootH2_10026419
370 rootH2_10099275
371 rootH2_10171268
372 rootL2_10002196
373 rootL2_10338264
374 rootH1_10016790
375 rootH1_10185923
376 rootH1_10269314
377 JGI25160J50197_1019408
378 JGI25161J50226_1000231
379 Ga0055526_1002902
380 Ga0055524_1004464
381 Ga0055528_1002564
382 Ga0055530_10027113
383 Ga0055540_1014842
384 Ga0055531_10033074
385 Ga0058692_1000651
386 Ga0058692_1003220
387 Ga0058692_1029020
388 Ga0055543_1000190
389 Ga0065165_1006054
390 Ga0065704_10132416
391 Ga0070668_100009809
392 Ga0070663_100326172
393 Ga0070665_100005844
394 Ga0070665_100205555
395 Ga0075365_10008409
396 Ga0075365_10115788
397 Ga0075368_10034526
398 Ga0075368_10038934
399 Ga0075363_100232122
400 Ga0075364_10016127
401 Ga0075364_10142493
402 Ga0075367_10442803
403 Ga0075369_10029183
404 Ga0075369_10051697
405 Ga0075369_10226173
406 Ga0075369_10404567
407 Ga0075366_10226363
408 Ga0099826_10000109
409 Ga0099826_10092557
410 Ga0105244_10244862
411 Ga0105240_10649075
412 Ga0105243_10014434
413 Ga0105238_10533790
414 Ga0157314_1004049
415 Ga0157373_10012386
416 Ga0157373_10210739
417 Ga0157373_10221544
418 Ga0157371_10000004
419 Ga0157371_10032139
420 Ga0157370_10000185
421 Ga0157370_10134690
422 Ga0157369_10069466
423 Ga0157369_10565494
424 Ga0163161_10047981
425 Ga0209435_100006
426 Ga0209436_100012
427 Ga0207427_113986
428 Ga0209437_100062
429 Ga0209437_100104
430 Ga0207425_1000018
431 Ga0209646_1000015
432 Ga0209646_1001639
433 Ga0209026_1000039
434 Ga0209148_1033094
435 Ga0209759_1000005
436 Ga0209129_1000026
437 Ga0209233_1000054
438 Ga0209233_1000082
439 Ga0209455_1014236
440 Ga0209673_1002129
441 Ga0209673_1004049
442 Ga0209130_1000022
443 Ga0209676_1010558
444 Ga0209025_1000035
445 Ga0209025_1000060
446 Ga0209025_1000436
447 Ga0209564_1003976
448 Ga0209758_1000040
449 Ga0209758_1000853
450 Ga0209758_1013004
451 Ga0209758_1045200
452 Ga0209050_1012066
453 Ga0209256_1013709
454 Ga0209256_1027226
455 Ga0209256_1080008
456 Ga0209256_1109095
457 Ga0207426_1000005
458 Ga0209051_1001808
459 Ga0209051_1037874
460 Ga0209257_1089276
461 Ga0207709_10523343
462 Ga0207668_10100363
463 Ga0209371_1000009
464 Ga0209371_1000424
465 Ga0209371_1003065
466 Ga0209282_1030376
467 Ga0209282_1121559
468 Ga0209813_10015758
469 Ga0209813_10074440
470 Ga0268266_10015688
471 Ga0268256_1000010
472 Ga0268256_1025011
473 Ga0316181_1017626
474 Ga0307405_10000728
475 Ga0307406_10036006
476 Ga0307406_10060630
477 Ga0307406_10804875
478 Ga0307412_10019177
479 Ga0307409_100963453
480 Ga0307409_101538195
481 Ga0307414_10073525
482 Ga0307414_10143313
483 Ga0439465_0007849
484 Ga0451797_0442221
485 Ga0451807_2018948
486 Ga0451833_0103945
487 Ga0451837_1075150
488 Ga0451849_1353073
489 Ga0451843_0419974
490 Ga0451855_1236972
491 Ga0466966_0046143
492 Ga0466963_0000823
493 Ga0466964_0108454
494 Ga0466971_0313189
495 Ga0466970_0005579
496 Ga0466959_0519176
497 Ga0466958_0069969
498 Ga0466967_0208414
499 Ga0495638_0023950
500 Ga0495607_0342577
501 Ga0495610_0001287
502 Ga0495632_0086965
503 Ga0495633_0014485
504 Ga0495588_0000622
505 Ga0495671_0193722
506 Ga0495673_0088101
507 Ga0495681_0011202
508 Ga0495686_0004971
509 Ga0496100_0244535
510 Ga0496101_0051855
511 Ga0496106_0001636
512 Ga0496110_0190730
513 Ga0496111_0000411
514 Ga0496116_0000100
515 Ga0496116_0000692
516 Ga0496116_0010532
517 Ga0496116_0058530
518 Ga0496116_0127447
519 Ga0496117_0000002
520 Ga0496117_0001643
521 Ga0496117_0006361
522 Ga0496117_0007393
523 Ga0496117_0102539
524 Ga0496117_0293155
525 Ga0496118_0001493
526 Ga0496118_0010681
527 Ga0496118_0010730
528 Ga0496118_0275130
529 Ga0496119_0007481
530 Ga0496119_0016902
531 Ga0496119_0026093
532 Ga0496119_0108089
533 Ga0496119_0116321
534 Ga0496120_0000021
535 Ga0496120_0112980
536 Ga0496121_0000001
537 Ga0496121_0073094
538 Ga0496121_0115787
539 Ga0496121_0417594
540 Ga0496121_0485426
541 Ga0496121_0584078
542 Ga0496122_0000001
543 Ga0496122_0000494
544 Ga0496122_0000889
545 Ga0496122_0008413
546 Ga0496122_0033228
547 Ga0496122_0082785
548 Ga0496122_0084360
549 Ga0496123_0000001
550 Ga0496123_0000442
551 Ga0496123_0003397
552 Ga0496123_0006606
553 Ga0496123_0046625
554 Ga0496123_0076793
555 Ga0496123_0226076
556 Ga0496124_0000023
557 Ga0496124_0000063
558 Ga0496124_0003101
559 Ga0496124_0007381
560 Ga0496124_0011544
561 Ga0496124_0015675
562 Ga0496124_0107253
563 Ga0496124_0120110
564 Ga0496124_0131192
565 Ga0496124_0801074
566 Ga0496125_0000001
567 Ga0496125_0000422
568 Ga0496125_0027161
569 Ga0496125_0036150
570 Ga0496125_0045452
571 Ga0496126_0000094
572 Ga0496126_0007849
573 Ga0496126_0043148
574 Ga0496126_0105881
575 Ga0496126_0312818
576 Ga0496126_1003291
577 Ga0501031_0079042
578 Ga0501032_0068545
579 Ga0501034_0064739
580 Ga0501036_0232872
581 Ga0501043_0033181
582 Ga0501048_0665531
583 Ga0501227_176812
584 Ga0501225_0022660
585 Ga0501035_0175252
586 Ga0501045_0220563
587 nmdc:mga03683_101212_c1
588 nmdc:mga03n38_15478_c1
589 nmdc:mga00v17_48_c1
590 nmdc:mga00v17_5790_c1
591 nmdc:mga0yw44_1426_c2
592 nmdc:mga0yw44_262534_c1
593 nmdc:mga0yw44_5888_c1
594 nmdc:mga0k408_702200_c1
595 nmdc:mga04h51_18498_c1
596 nmdc:mga0sz30_11796_c1
597 Ga0500644_0057216
598 Ga0500560_000852
599 Ga0500560_092307
600 Ga0500618_000041
601 Ga0500618_005454
602 Ga0500573_0000918
603 Ga0500573_0003057
604 Ga0500616_0000304
605 Ga0500633_0000151
606 Ga0500634_0000020
607 Ga0500634_0016676
608 Ga0500634_0076952
609 Ga0500636_0000006
610 Ga0500636_0129561
611 2510843764
612 2511171175
613 2537876011
614 2554246541
615 2559293716
616 2585258836
617 2585334996
618 2585846138
619 2585995465
620 2586000068
621 2599606024
622 2599717949
623 2600376928
624 2601609259
625 2601746034
626 2616552888
627 2617381336
628 2643814443
629 2643855216
630 2643918311
631 2644298280
632 2644519317
633 2644659219
634 2671114659
635 2738799871
636 2776911356
637 2778124871
638 2778174521
639 2808986456
640 2819243308
641 2819245316
642 2819556586
643 2819607791
644 2838032595
645 2838677314
646 2838716202
647 2838719998
648 2838726954
649 2841846930
650 2841860542
651 2842127041
652 2842132207
653 2842152624
654 2842172447
655 2842176243
656 2842189309
657 2842213623
658 2842224759
659 2842479327
660 2842485438
661 2842506514
662 2842517327
663 2854900597
664 2891375589
665 2899792624
666 2899846006
667 2919116405
668 2919166787
669 2919175504
670 2919413387
671 2926757359
672 2926761575
673 2929138720
674 2932403653
675 2933007269
676 2933015140
677 2933594474
678 2978973203
679 2979093135
680 2979099478
681 2979105102
682 2984513056
683 2984520579
684 2984539873
685 2984591451
686 2984602080
687 2989353871
688 2989773945
689 2989781525
690 3003935351
691 3005422209
692 650738958
693 8003572590
694 8005250170
695 8005321488
696 8005489767
697 8005650637
698 8005683687
699 8018150931
700 8054461232
701 8054561588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01899

MNHE

Na+/H+ ion antiporter subunit

28

176

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rsq-assembly1.cif.gz_A copper(i) loaded form of the first domain of the human copper chaperone for sod1, ccs 0.8381 87 147
6fon-assembly1.cif.gz_C elongated conformer of the human copper chaperone for sod1 complexed with human sod1 0.816 90 145
6fp6-assembly4.cif.gz_H complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation 0.8133 87 145
6fp6-assembly1.cif.gz_B complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation 0.81 87 149
6fp6-assembly8.cif.gz_P complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation 0.8096 85 149
ID Description Score Start End Superfamily
af_I1JD23_3_71_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8686 87 132 3.30.70.100
af_Q6H7M3_184_260_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8572 90 136 3.30.70.100
af_A0A1D6NFU6_1_73_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8514 89 136 3.30.70.100
af_B6SZL4_173_238_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.845 87 148 3.30.70.100
af_K7KE01_9_82_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8429 89 148 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A4Q3SMI3-F1-model_v4 Na+/H+ antiporter subunit E 0.9232 72 158 GO:0005886
GO:0008324
AF-A0A7W7V745-F1-model_v4 Multisubunit Na+/H+ antiporter MnhE subunit 0.9161 52 157 GO:0005886
GO:0008324
AF-M4V7H7-F1-model_v4 Uncharacterized protein 0.916 56 158 GO:0005886
GO:0008324
AF-A0A261T650-F1-model_v4 Sodium:proton antiporter 0.9136 51 156 GO:0005886
GO:0008324
AF-A0A3C0HIQ6-F1-model_v4 Sodium:proton antiporter 0.9134 53 157 GO:0005886
GO:0008324

Map