F418401

General Info

Members Datasets Scaffolds Average Seq Length
350 208 700 363

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0019953|Ga0501038_0019953_4581_5759
Length 392
Sequence VSLWIDDPADLAARLRAAPPRVGLDTEFVRERTWWPKLALVQVALEGGDVLLVDALAPGMNAALAPMLADPAVLKVMHSASEDLVALQHACGVVPAPLFDTQVAAALAGVAAGAGYQRLVQDLLGIALPKGETRSDWLRRPLSAAQLEYAADDVLHLFALHDLLAARLAQAGRDDWLREDAHRTVAAAVDETPEPWPHLAMRSAQFLDAPAQRRLLRLLRWRDAHARRADRPRSWILDNELATALARKPPADRASLQRQLEATPKSPRALGDALWAALETPLPDEADAPLARADDRDKARMRKLQDAVAALSAELGLPDGVLASRRWLQALLDARADGTAAWPGPLAGWRRALLEPRLAPLLEASAAAATPVVAAPGPDAAATAGDVPPASV

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
42 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
43 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
44 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
47 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
48 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
75 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
76 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
91 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
92 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
93 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
94 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
95 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
96 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
97 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
98 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
99 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
100 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
101 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
102 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
103 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
107 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
111 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
112 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
113 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
114 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
115 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
119 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
120 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
121 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
131 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
132 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
133 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
134 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
135 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
136 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
137 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
138 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
157 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
158 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
159 2643221559 Lysobacter sp. Root559 Isolate Unclassified
160 2643221573 Lysobacter sp. Root604 Isolate Unclassified
161 2643221586 Lysobacter sp. Root667 Isolate Unclassified
162 2643221593 Lysobacter sp. Root690 Isolate Unclassified
163 2643221612 Lysobacter sp. Root76 Isolate Unclassified
164 2643221695 Lysobacter sp. Root494 Isolate Unclassified
165 2643221720 Lysobacter sp. Root916 Isolate Unclassified
166 2643221727 Lysobacter sp. Root96 Isolate Unclassified
167 2643221728 Lysobacter sp. Root983 Isolate Unclassified
168 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
169 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
170 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
171 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
172 2818991457 Xanthomonas translucens 569 Isolate Unclassified
173 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
174 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
175 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
176 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
177 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
178 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
179 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
180 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
181 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
182 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
183 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
184 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
185 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
186 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
187 2919513703 Luteimonas sp. 3794 Isolate Unclassified
188 2919675420 Luteimonas terrae 4099 Isolate Unclassified
189 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
190 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
191 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
192 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
193 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
194 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
195 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
196 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
197 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
198 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
199 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
200 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
201 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
202 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
203 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
204 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
205 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
206 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
207 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
208 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.14
Metatranscriptomes 0
Isolates 14.86

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 20.29
Nodule 0.29
Rhizoplane 4.29
Rhizosphere 47.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0019953 3300049574 Bacteria 6033
2 JGI25152J39213_1000074 3300002773 Bacteria 66463
3 JGI25150J39212_1000056 3300002774 Bacteria 66462
4 JGI25151J46595_10000032 3300003187 Bacteria 195408
5 JGI25151J46595_10000178 3300003187 Bacteria 80734
6 JGI25151J46595_10011087 3300003187 Bacteria 4157
7 JGI25153J46596_10000131 3300003215 Bacteria 80734
8 rootH2_10002263 3300003320 Bacteria 5621
9 rootH1_10193337 3300003323 Bacteria 5510
10 Ga0055526_1000038 3300003771 Bacteria 131858
11 Ga0055526_1031123 3300003771 Bacteria 1538
12 Ga0055537_1000057 3300003773 Bacteria 81507
13 Ga0055537_1002160 3300003773 Bacteria 6864
14 Ga0055524_1000066 3300003775 Bacteria 131691
15 Ga0055524_1011635 3300003775 Bacteria 3427
16 Ga0055536_1001310 3300003781 Bacteria 15287
17 Ga0055536_1009531 3300003781 Bacteria 4001
18 Ga0055536_1029249 3300003781 Bacteria 1484
19 Ga0055534_1000082 3300003784 Bacteria 75351
20 Ga0055534_1000472 3300003784 Bacteria 22716
21 Ga0055528_1000023 3300003790 Bacteria 131856
22 Ga0055528_1000274 3300003790 Bacteria 43734
23 Ga0055530_10002304 3300003791 Bacteria 12481
24 Ga0055531_10011681 3300003794 Bacteria 4206
25 Ga0055531_10021672 3300003794 Bacteria 2482
26 Ga0058692_1000006 3300003856 Bacteria 398109
27 Ga0058692_1000012 3300003856 Bacteria 318930
28 Ga0065714_10015918 3300005288 Bacteria 1888
29 Ga0065704_10079495 3300005289 Bacteria 4147
30 Ga0070670_100007892 3300005331 Bacteria 9053
31 Ga0070670_100174800 3300005331 Bacteria 1864
32 Ga0070661_100247160 3300005344 Bacteria 1376
33 Ga0070669_100016661 3300005353 Bacteria 5245
34 Ga0070671_100099525 3300005355 Bacteria 2439
35 Ga0070671_100100744 3300005355 Bacteria 2423
36 Ga0070671_100271545 3300005355 Bacteria 1441
37 Ga0070674_100077191 3300005356 Bacteria 2371
38 Ga0070678_100108892 3300005456 Bacteria 2163
39 Ga0070662_100123292 3300005457 Bacteria 1989
40 Ga0070679_100154695 3300005530 Bacteria 2268
41 Ga0070672_100196972 3300005543 Bacteria 1683
42 Ga0070665_100326738 3300005548 Bacteria 1538
43 Ga0068862_100068427 3300005844 Bacteria 3063
44 Ga0081539_10028816 3300005985 Bacteria 3485
45 Ga0075364_10000327 3300006051 Bacteria 23551
46 Ga0075364_10006972 3300006051 Bacteria 6676
47 Ga0105251_10000634 3300009011 Bacteria 32237
48 Ga0105244_10018190 3300009036 Bacteria 3951
49 Ga0105243_10007468 3300009148 Bacteria 8400
50 Ga0105248_10221526 3300009177 Bacteria 2130
51 Ga0105248_10269174 3300009177 Bacteria 1918
52 Ga0157373_10035259 3300013100 Bacteria 3593
53 Ga0157373_10122081 3300013100 Bacteria 1831
54 Ga0157371_10000344 3300013102 Bacteria 59668
55 Ga0157371_10007349 3300013102 Bacteria 8931
56 Ga0157371_10080762 3300013102 Bacteria 2303
57 Ga0157370_10032318 3300013104 Bacteria 5111
58 Ga0157372_10252303 3300013307 Bacteria 2048
59 Ga0182008_10000339 3300014497 Bacteria 36578
60 Ga0182008_10005802 3300014497 Bacteria 6980
61 Ga0182006_1010257 3300015261 Bacteria 4172
62 Ga0182007_10000081 3300015262 Bacteria 73360
63 Ga0182005_1000687 3300015265 Bacteria 15827
64 Ga0183360_10001 3300015689 Bacteria 3943671
65 Ga0163161_10000633 3300017792 Bacteria 28051
66 Ga0163161_10047186 3300017792 Bacteria 3111
67 Ga0207425_1000108 3300025245 Bacteria 77709
68 Ga0209129_1000178 3300025258 Bacteria 92006
69 Ga0209565_1000005 3300025263 Bacteria 947317
70 Ga0209565_1000022 3300025263 Bacteria 390888
71 Ga0209565_1005397 3300025263 Bacteria 3722
72 Ga0209673_1000027 3300025273 Bacteria 360561
73 Ga0209673_1000110 3300025273 Bacteria 181173
74 Ga0209130_1010646 3300025284 Bacteria 2516
75 Ga0209675_1000004 3300025291 Bacteria 947166
76 Ga0209675_1000165 3300025291 Bacteria 81556
77 Ga0209675_1003307 3300025291 Bacteria 7742
78 Ga0209676_1000219 3300025292 Bacteria 125330
79 Ga0209676_1000603 3300025292 Bacteria 53099
80 Ga0209676_1000790 3300025292 Bacteria 41824
81 Ga0209676_1000888 3300025292 Bacteria 38155
82 Ga0209676_1001117 3300025292 Bacteria 29720
83 Ga0209676_1008423 3300025292 Bacteria 4599
84 Ga0209025_1000005 3300025294 Bacteria 1272149
85 Ga0209025_1000012 3300025294 Bacteria 924362
86 Ga0209025_1001283 3300025294 Bacteria 34499
87 Ga0209025_1008798 3300025294 Bacteria 7180
88 Ga0209564_1000050 3300025295 Bacteria 360560
89 Ga0209564_1000541 3300025295 Bacteria 61140
90 Ga0209564_1032307 3300025295 Bacteria 1580
91 Ga0209758_1000018 3300025297 Bacteria 753320
92 Ga0209758_1005507 3300025297 Bacteria 9696
93 Ga0209050_1000578 3300025298 Bacteria 59363
94 Ga0209050_1000850 3300025298 Bacteria 41582
95 Ga0209050_1001491 3300025298 Bacteria 24866
96 Ga0209050_1023100 3300025298 Bacteria 2201
97 Ga0209256_1000031 3300025299 Bacteria 410189
98 Ga0209256_1000889 3300025299 Bacteria 36807
99 Ga0209256_1003460 3300025299 Bacteria 11048
100 Ga0209256_1025835 3300025299 Bacteria 1704
101 Ga0209051_1007631 3300025303 Bacteria 5884
102 Ga0209257_1000255 3300025304 Bacteria 123098
103 Ga0209257_1000263 3300025304 Bacteria 120530
104 Ga0209257_1000283 3300025304 Bacteria 113507
105 Ga0209257_1000839 3300025304 Bacteria 44159
106 Ga0209257_1000879 3300025304 Bacteria 42464
107 Ga0209257_1001220 3300025304 Bacteria 32205
108 Ga0209257_1001545 3300025304 Bacteria 26779
109 Ga0209257_1001810 3300025304 Bacteria 23425
110 Ga0209257_1008532 3300025304 Bacteria 5790
111 Ga0207713_1011391 3300025735 Bacteria 4840
112 Ga0207713_1032500 3300025735 Bacteria 2290
113 Ga0207652_10293266 3300025921 Bacteria 1468
114 Ga0207681_10010569 3300025923 Bacteria 5658
115 Ga0207650_10005410 3300025925 Bacteria 8714
116 Ga0207644_10003431 3300025931 Bacteria 10240
117 Ga0207644_10226249 3300025931 Bacteria 1485
118 Ga0207706_10162187 3300025933 Bacteria 1965
119 Ga0207709_10002504 3300025935 Bacteria 11496
120 Ga0207691_10001954 3300025940 Bacteria 20125
121 Ga0207651_10252485 3300025960 Bacteria 1444
122 Ga0207668_10129769 3300025972 Bacteria 1923
123 Ga0209371_1000007 3300027312 Bacteria 1050654
124 Ga0209371_1000016 3300027312 Bacteria 646301
125 Ga0209983_1002457 3300027665 Bacteria 4057
126 Ga0209974_10009578 3300027876 Bacteria 3289
127 Ga0209974_10011628 3300027876 Bacteria 2954
128 Ga0268265_10052124 3300028380 Bacteria 3093
129 Ga0268256_1000008 3300030500 Bacteria 1050654
130 Ga0268256_1000015 3300030500 Bacteria 646300
131 Ga0316178_1173477 3300030735 Bacteria 1391
132 Ga0316183_1169855 3300030742 Bacteria 3611
133 Ga0307513_10025731 3300031456 Bacteria 6808
134 Ga0307513_10101217 3300031456 Bacteria 2904
135 Ga0307408_100105745 3300031548 Bacteria 2152
136 Ga0307413_10000115 3300031824 Bacteria 20626
137 Ga0307406_10064017 3300031901 Bacteria 2384
138 Ga0307412_10015356 3300031911 Bacteria 4538
139 Ga0307412_10063050 3300031911 Bacteria 2499
140 Ga0307416_100057348 3300032002 Bacteria 3150
141 Ga0307416_100159086 3300032002 Bacteria 2085
142 Ga0307414_10001369 3300032004 Bacteria 12607
143 Ga0307414_10006113 3300032004 Bacteria 6684
144 Ga0307414_10024242 3300032004 Bacteria 3866
145 Ga0307414_10088528 3300032004 Bacteria 2291
146 Ga0307411_10169038 3300032005 Bacteria 1647
147 Ga0307415_100123013 3300032126 Bacteria 1949
148 Ga0395899_0006032 3300037312 Bacteria 9409
149 Ga0395900_0021673 3300037418 Bacteria 6569
150 Ga0395905_0323810 3300037471 Bacteria 1431
151 Ga0395901_0061733 3300038443 Bacteria 3900
152 Ga0237819_00505 3300038705 Bacteria 13123
153 Ga0237819_01766 3300038705 Bacteria 5085
154 Ga0439436_0005959 3300041404 Bacteria 3738
155 Ga0439436_0033083 3300041404 Bacteria 1498
156 Ga0439436_0053242 3300041404 Bacteria 1140
157 Ga0439439_0004166 3300041406 Bacteria 3239
158 Ga0439447_005137 3300041407 Bacteria 4390
159 Ga0439465_0001813 3300041413 Bacteria 6991
160 Ga0439465_0003508 3300041413 Bacteria 5110
161 Ga0439465_0008052 3300041413 Bacteria 3335
162 Ga0451791_0116265 3300041451 Bacteria 1967
163 Ga0451793_0709379 3300041452 Bacteria 4053
164 Ga0451797_0089562 3300041453 Bacteria 4423
165 Ga0451797_1196246 3300041453 Bacteria 1055
166 Ga0451800_1612293 3300041459 Bacteria 1396
167 Ga0451807_0597550 3300041486 Bacteria 1406
168 Ga0451807_0663756 3300041486 Bacteria 1681
169 Ga0439431_0031782 3300041997 Bacteria 1313
170 Ga0439445_0002910 3300042004 Bacteria 3823
171 Ga0439432_028400 3300042006 Bacteria 1821
172 Ga0439449_0000032 3300042007 Bacteria 41302
173 Ga0439449_0004509 3300042007 Bacteria 5380
174 Ga0439449_0015277 3300042007 Bacteria 2884
175 Ga0451577_0002616 3300042876 Bacteria 21112
176 Ga0453684_0123860 3300044712 Bacteria 3115
177 Ga0495627_013258 3300046453 Bacteria 2902
178 Ga0495607_0053623 3300046501 Bacteria 2328
179 Ga0495610_0003727 3300046512 Bacteria 11664
180 Ga0495616_0030782 3300046513 Bacteria 2816
181 Ga0495631_0002482 3300046518 Bacteria 10382
182 Ga0495643_0001083 3300046522 Bacteria 27159
183 Ga0495663_0000897 3300046525 Bacteria 10032
184 Ga0495663_0001909 3300046525 Bacteria 6412
185 Ga0495663_0003414 3300046525 Bacteria 4584
186 Ga0495663_0008069 3300046525 Bacteria 2913
187 Ga0495598_0002823 3300046537 Bacteria 3619
188 Ga0495621_0010652 3300046539 Bacteria 2821
189 Ga0495633_0001984 3300046558 Bacteria 14817
190 Ga0495633_0033047 3300046558 Bacteria 2496
191 Ga0495668_0002733 3300046616 Bacteria 14134
192 Ga0495668_0044695 3300046616 Bacteria 2462
193 Ga0495625_0171495 3300046660 Bacteria 1448
194 Ga0495670_0091034 3300046691 Bacteria 1561
195 Ga0495660_0017660 3300046810 Bacteria 4105
196 Ga0495636_0000111 3300047318 Bacteria 34245
197 Ga0495636_0000237 3300047318 Bacteria 21836
198 Ga0495672_0002120 3300047320 Bacteria 18599
199 Ga0495686_0098157 3300047472 Bacteria 1770
200 Ga0496100_0385739 3300048903 Bacteria 1065
201 Ga0496101_0188026 3300048904 Bacteria 1593
202 Ga0496104_0031563 3300048907 Bacteria 4928
203 Ga0496105_0030633 3300048908 Bacteria 4408
204 Ga0496109_0074392 3300048912 Bacteria 3123
205 Ga0496112_0044225 3300048915 Bacteria 4363
206 Ga0496113_0089043 3300048916 Bacteria 2375
207 Ga0496113_0272980 3300048916 Bacteria 1351
208 Ga0496116_0003621 3300048919 Bacteria 15184
209 Ga0496116_0008289 3300048919 Bacteria 9034
210 Ga0496116_0009243 3300048919 Bacteria 8432
211 Ga0496116_0053212 3300048919 Bacteria 2675
212 Ga0496117_0001015 3300048920 Bacteria 42934
213 Ga0496117_0003364 3300048920 Bacteria 18642
214 Ga0496117_0006501 3300048920 Bacteria 11788
215 Ga0496117_0016756 3300048920 Bacteria 6160
216 Ga0496117_0032472 3300048920 Bacteria 3965
217 Ga0496117_0160744 3300048920 Bacteria 1316
218 Ga0496118_0001060 3300048921 Bacteria 42963
219 Ga0496118_0002044 3300048921 Bacteria 28528
220 Ga0496118_0004869 3300048921 Bacteria 15632
221 Ga0496118_0012271 3300048921 Bacteria 8246
222 Ga0496118_0047523 3300048921 Bacteria 3324
223 Ga0496118_0093486 3300048921 Bacteria 2060
224 Ga0496119_0001961 3300048922 Bacteria 23396
225 Ga0496119_0002881 3300048922 Bacteria 18359
226 Ga0496119_0020138 3300048922 Bacteria 4877
227 Ga0496119_0021439 3300048922 Bacteria 4671
228 Ga0496120_0000618 3300048923 Bacteria 53642
229 Ga0496120_0000870 3300048923 Bacteria 42759
230 Ga0496120_0018440 3300048923 Bacteria 4498
231 Ga0496121_0001093 3300048924 Bacteria 47915
232 Ga0496121_0007181 3300048924 Bacteria 13494
233 Ga0496121_0032477 3300048924 Bacteria 4743
234 Ga0496121_0148778 3300048924 Bacteria 1726
235 Ga0496122_0000468 3300048925 Bacteria 84377
236 Ga0496122_0001135 3300048925 Bacteria 45756
237 Ga0496122_0003191 3300048925 Bacteria 21871
238 Ga0496122_0007823 3300048925 Bacteria 11745
239 Ga0496122_0017772 3300048925 Bacteria 6616
240 Ga0496122_0019678 3300048925 Bacteria 6153
241 Ga0496122_0031265 3300048925 Bacteria 4435
242 Ga0496123_0000226 3300048926 Bacteria 113889
243 Ga0496123_0000497 3300048926 Bacteria 68228
244 Ga0496123_0006156 3300048926 Bacteria 11756
245 Ga0496123_0037105 3300048926 Bacteria 3446
246 Ga0496123_0040122 3300048926 Bacteria 3265
247 Ga0496123_0042754 3300048926 Bacteria 3122
248 Ga0496123_0056072 3300048926 Bacteria 2579
249 Ga0496124_0000009 3300048927 Bacteria 734820
250 Ga0496124_0000785 3300048927 Bacteria 51854
251 Ga0496124_0000930 3300048927 Bacteria 47209
252 Ga0496124_0006244 3300048927 Bacteria 13052
253 Ga0496124_0006459 3300048927 Bacteria 12768
254 Ga0496124_0006913 3300048927 Bacteria 12193
255 Ga0496124_0018185 3300048927 Bacteria 6593
256 Ga0496124_0022490 3300048927 Bacteria 5776
257 Ga0496124_0102181 3300048927 Bacteria 2320
258 Ga0496125_0001212 3300048928 Bacteria 38782
259 Ga0496125_0003758 3300048928 Bacteria 18073
260 Ga0496125_0009225 3300048928 Bacteria 10191
261 Ga0496125_0016250 3300048928 Bacteria 7154
262 Ga0496125_0032606 3300048928 Bacteria 4625
263 Ga0496125_0073257 3300048928 Bacteria 2664
264 Ga0496125_0116811 3300048928 Bacteria 1915
265 Ga0496126_0000352 3300048929 Bacteria 96433
266 Ga0496126_0010871 3300048929 Bacteria 9486
267 Ga0496126_0053638 3300048929 Bacteria 3656
268 Ga0496126_0100709 3300048929 Bacteria 2528
269 Ga0496126_0298017 3300048929 Bacteria 1331
270 Ga0501031_0017425 3300049568 Bacteria 4667
271 Ga0501033_0000715 3300049570 Bacteria 30454
272 Ga0501033_0061360 3300049570 Bacteria 2771
273 Ga0501033_0078302 3300049570 Bacteria 2426
274 Ga0501034_0000261 3300049571 Bacteria 95451
275 Ga0501034_0002420 3300049571 Bacteria 22586
276 Ga0501034_0015386 3300049571 Bacteria 7863
277 Ga0501034_0357795 3300049571 Bacteria 1387
278 Ga0501036_0008361 3300049572 Bacteria 8479
279 Ga0501037_0004462 3300049573 Bacteria 10166
280 Ga0501038_0001502 3300049574 Bacteria 21456
281 Ga0501043_0008896 3300049579 Bacteria 7903
282 Ga0501043_0019479 3300049579 Bacteria 5325
283 Ga0501043_0213851 3300049579 Bacteria 1494
284 Ga0501047_0136196 3300049581 Bacteria 2336
285 Ga0501070_0027428 3300049586 Bacteria 4778
286 Ga0501071_0114487 3300049587 Bacteria 1995
287 Ga0501073_0193229 3300049589 Bacteria 1408
288 Ga0501080_0010549 3300049742 Bacteria 8462
289 Ga0501275_000055 3300049772 Bacteria 11440
290 Ga0501035_0032020 3300049822 Bacteria 4787
291 Ga0501035_0185908 3300049822 Bacteria 1788
292 Ga0501044_0023229 3300049823 Bacteria 6598
293 Ga0501044_0037232 3300049823 Bacteria 5086
294 Ga0501044_0250329 3300049823 Bacteria 1713
295 Ga0501044_0357226 3300049823 Bacteria 1379
296 nmdc:mga00v17_4454_c1 3300050491 Bacteria 7292
297 nmdc:mga00v17_554_c1 3300050491 Bacteria 20868
298 Ga0500634_0000138 3300053161 Bacteria 26502
299 2547500375 2547132130 Bacteria 4660562
300 2578457693 2576861471 Bacteria 4648976
301 2643818794 2643221559 Bacteria 4424915
302 2643878458 2643221573 Bacteria 4784121
303 2643941047 2643221586 Bacteria 4446529
304 2643975898 2643221593 Bacteria 6296053
305 2644079914 2643221612 Bacteria 4361984
306 2644528952 2643221695 Bacteria 3441323
307 2644659766 2643221720 Bacteria 4694283
308 2644695509 2643221727 Bacteria 4415595
309 2644700493 2643221728 Bacteria 4797149
310 2747948196 2747842428 Bacteria 4689383
311 2748015978 2747842501 Bacteria 5293829
312 2765579801 2765235840 Bacteria 4663337
313 2816519147 2816332141 Bacteria 4436036
314 2819660036 2818991457 Bacteria 5323295
315 2842394770 2842391507 Bacteria 4486072
316 2842760032 2842757796 Bacteria 3981385
317 2842780846 2842780639 Bacteria 4337790
318 2852650141 2852649853 Bacteria 4036942
319 2852685148 2852684882 Bacteria 5463342
320 2874222487 2874220319 Bacteria 4594709
321 2894415423 2894414249 Bacteria 4405451
322 2895504063 2895498888 Bacteria 5283788
323 2895515417 2895511927 Bacteria 6802080
324 2895525072 2895522137 Bacteria 3284416
325 2895527781 2895525241 Bacteria 3388457
326 2919090426 2919089067 Bacteria 4560942
327 2919130688 2919130084 Bacteria 5301837
328 2919137639 2919134579 Bacteria 4480386
329 2919514797 2919513703 Bacteria 3844312
330 2919677417 2919675420 Bacteria 3969095
331 2928498263 2928496128 Bacteria 4631123
332 2929198309 2929195423 Bacteria 5325372
333 2931384057 2931380184 Bacteria 4455911
334 2937614781 2937610967 Bacteria 4618818
335 2939591023 2939589442 Bacteria 4214238
336 2939625626 2939622612 Bacteria 4698046
337 2939628404 2939626828 Bacteria 4695272
338 2941476559 2941475908 Bacteria 4145589
339 2941491514 2941489479 Bacteria 6313767
340 2961049252 2961047084 Bacteria 4594415
341 2961066049 2961064222 Bacteria 4749990
342 2974308303 2974307012 Bacteria 4172388
343 2977249061 2977247770 Bacteria 4160543
344 2984516487 2984514374 Bacteria 4172479
345 2987606184 2987605356 Bacteria 4187822
346 2995952380 2995948881 Bacteria 6358104
347 8003016260 8003014200 Bacteria 4059994
348 8021626453 8021622325 Bacteria 4844743
349 8021630178 8021626552 Bacteria 4665214
350 8021650698 8021648035 Bacteria 4772378
351 Ga0501038_0019953
352 JGI25152J39213_1000074
353 JGI25150J39212_1000056
354 JGI25151J46595_10000032
355 JGI25151J46595_10000178
356 JGI25151J46595_10011087
357 JGI25153J46596_10000131
358 rootH2_10002263
359 rootH1_10193337
360 Ga0055526_1000038
361 Ga0055526_1031123
362 Ga0055537_1000057
363 Ga0055537_1002160
364 Ga0055524_1000066
365 Ga0055524_1011635
366 Ga0055536_1001310
367 Ga0055536_1009531
368 Ga0055536_1029249
369 Ga0055534_1000082
370 Ga0055534_1000472
371 Ga0055528_1000023
372 Ga0055528_1000274
373 Ga0055530_10002304
374 Ga0055531_10011681
375 Ga0055531_10021672
376 Ga0058692_1000006
377 Ga0058692_1000012
378 Ga0065714_10015918
379 Ga0065704_10079495
380 Ga0070670_100007892
381 Ga0070670_100174800
382 Ga0070661_100247160
383 Ga0070669_100016661
384 Ga0070671_100099525
385 Ga0070671_100100744
386 Ga0070671_100271545
387 Ga0070674_100077191
388 Ga0070678_100108892
389 Ga0070662_100123292
390 Ga0070679_100154695
391 Ga0070672_100196972
392 Ga0070665_100326738
393 Ga0068862_100068427
394 Ga0081539_10028816
395 Ga0075364_10000327
396 Ga0075364_10006972
397 Ga0105251_10000634
398 Ga0105244_10018190
399 Ga0105243_10007468
400 Ga0105248_10221526
401 Ga0105248_10269174
402 Ga0157373_10035259
403 Ga0157373_10122081
404 Ga0157371_10000344
405 Ga0157371_10007349
406 Ga0157371_10080762
407 Ga0157370_10032318
408 Ga0157372_10252303
409 Ga0182008_10000339
410 Ga0182008_10005802
411 Ga0182006_1010257
412 Ga0182007_10000081
413 Ga0182005_1000687
414 Ga0183360_10001
415 Ga0163161_10000633
416 Ga0163161_10047186
417 Ga0207425_1000108
418 Ga0209129_1000178
419 Ga0209565_1000005
420 Ga0209565_1000022
421 Ga0209565_1005397
422 Ga0209673_1000027
423 Ga0209673_1000110
424 Ga0209130_1010646
425 Ga0209675_1000004
426 Ga0209675_1000165
427 Ga0209675_1003307
428 Ga0209676_1000219
429 Ga0209676_1000603
430 Ga0209676_1000790
431 Ga0209676_1000888
432 Ga0209676_1001117
433 Ga0209676_1008423
434 Ga0209025_1000005
435 Ga0209025_1000012
436 Ga0209025_1001283
437 Ga0209025_1008798
438 Ga0209564_1000050
439 Ga0209564_1000541
440 Ga0209564_1032307
441 Ga0209758_1000018
442 Ga0209758_1005507
443 Ga0209050_1000578
444 Ga0209050_1000850
445 Ga0209050_1001491
446 Ga0209050_1023100
447 Ga0209256_1000031
448 Ga0209256_1000889
449 Ga0209256_1003460
450 Ga0209256_1025835
451 Ga0209051_1007631
452 Ga0209257_1000255
453 Ga0209257_1000263
454 Ga0209257_1000283
455 Ga0209257_1000839
456 Ga0209257_1000879
457 Ga0209257_1001220
458 Ga0209257_1001545
459 Ga0209257_1001810
460 Ga0209257_1008532
461 Ga0207713_1011391
462 Ga0207713_1032500
463 Ga0207652_10293266
464 Ga0207681_10010569
465 Ga0207650_10005410
466 Ga0207644_10003431
467 Ga0207644_10226249
468 Ga0207706_10162187
469 Ga0207709_10002504
470 Ga0207691_10001954
471 Ga0207651_10252485
472 Ga0207668_10129769
473 Ga0209371_1000007
474 Ga0209371_1000016
475 Ga0209983_1002457
476 Ga0209974_10009578
477 Ga0209974_10011628
478 Ga0268265_10052124
479 Ga0268256_1000008
480 Ga0268256_1000015
481 Ga0316178_1173477
482 Ga0316183_1169855
483 Ga0307513_10025731
484 Ga0307513_10101217
485 Ga0307408_100105745
486 Ga0307413_10000115
487 Ga0307406_10064017
488 Ga0307412_10015356
489 Ga0307412_10063050
490 Ga0307416_100057348
491 Ga0307416_100159086
492 Ga0307414_10001369
493 Ga0307414_10006113
494 Ga0307414_10024242
495 Ga0307414_10088528
496 Ga0307411_10169038
497 Ga0307415_100123013
498 Ga0395899_0006032
499 Ga0395900_0021673
500 Ga0395905_0323810
501 Ga0395901_0061733
502 Ga0237819_00505
503 Ga0237819_01766
504 Ga0439436_0005959
505 Ga0439436_0033083
506 Ga0439436_0053242
507 Ga0439439_0004166
508 Ga0439447_005137
509 Ga0439465_0001813
510 Ga0439465_0003508
511 Ga0439465_0008052
512 Ga0451791_0116265
513 Ga0451793_0709379
514 Ga0451797_0089562
515 Ga0451797_1196246
516 Ga0451800_1612293
517 Ga0451807_0597550
518 Ga0451807_0663756
519 Ga0439431_0031782
520 Ga0439445_0002910
521 Ga0439432_028400
522 Ga0439449_0000032
523 Ga0439449_0004509
524 Ga0439449_0015277
525 Ga0451577_0002616
526 Ga0453684_0123860
527 Ga0495627_013258
528 Ga0495607_0053623
529 Ga0495610_0003727
530 Ga0495616_0030782
531 Ga0495631_0002482
532 Ga0495643_0001083
533 Ga0495663_0000897
534 Ga0495663_0001909
535 Ga0495663_0003414
536 Ga0495663_0008069
537 Ga0495598_0002823
538 Ga0495621_0010652
539 Ga0495633_0001984
540 Ga0495633_0033047
541 Ga0495668_0002733
542 Ga0495668_0044695
543 Ga0495625_0171495
544 Ga0495670_0091034
545 Ga0495660_0017660
546 Ga0495636_0000111
547 Ga0495636_0000237
548 Ga0495672_0002120
549 Ga0495686_0098157
550 Ga0496100_0385739
551 Ga0496101_0188026
552 Ga0496104_0031563
553 Ga0496105_0030633
554 Ga0496109_0074392
555 Ga0496112_0044225
556 Ga0496113_0089043
557 Ga0496113_0272980
558 Ga0496116_0003621
559 Ga0496116_0008289
560 Ga0496116_0009243
561 Ga0496116_0053212
562 Ga0496117_0001015
563 Ga0496117_0003364
564 Ga0496117_0006501
565 Ga0496117_0016756
566 Ga0496117_0032472
567 Ga0496117_0160744
568 Ga0496118_0001060
569 Ga0496118_0002044
570 Ga0496118_0004869
571 Ga0496118_0012271
572 Ga0496118_0047523
573 Ga0496118_0093486
574 Ga0496119_0001961
575 Ga0496119_0002881
576 Ga0496119_0020138
577 Ga0496119_0021439
578 Ga0496120_0000618
579 Ga0496120_0000870
580 Ga0496120_0018440
581 Ga0496121_0001093
582 Ga0496121_0007181
583 Ga0496121_0032477
584 Ga0496121_0148778
585 Ga0496122_0000468
586 Ga0496122_0001135
587 Ga0496122_0003191
588 Ga0496122_0007823
589 Ga0496122_0017772
590 Ga0496122_0019678
591 Ga0496122_0031265
592 Ga0496123_0000226
593 Ga0496123_0000497
594 Ga0496123_0006156
595 Ga0496123_0037105
596 Ga0496123_0040122
597 Ga0496123_0042754
598 Ga0496123_0056072
599 Ga0496124_0000009
600 Ga0496124_0000785
601 Ga0496124_0000930
602 Ga0496124_0006244
603 Ga0496124_0006459
604 Ga0496124_0006913
605 Ga0496124_0018185
606 Ga0496124_0022490
607 Ga0496124_0102181
608 Ga0496125_0001212
609 Ga0496125_0003758
610 Ga0496125_0009225
611 Ga0496125_0016250
612 Ga0496125_0032606
613 Ga0496125_0073257
614 Ga0496125_0116811
615 Ga0496126_0000352
616 Ga0496126_0010871
617 Ga0496126_0053638
618 Ga0496126_0100709
619 Ga0496126_0298017
620 Ga0501031_0017425
621 Ga0501033_0000715
622 Ga0501033_0061360
623 Ga0501033_0078302
624 Ga0501034_0000261
625 Ga0501034_0002420
626 Ga0501034_0015386
627 Ga0501034_0357795
628 Ga0501036_0008361
629 Ga0501037_0004462
630 Ga0501038_0001502
631 Ga0501043_0008896
632 Ga0501043_0019479
633 Ga0501043_0213851
634 Ga0501047_0136196
635 Ga0501070_0027428
636 Ga0501071_0114487
637 Ga0501073_0193229
638 Ga0501080_0010549
639 Ga0501275_000055
640 Ga0501035_0032020
641 Ga0501035_0185908
642 Ga0501044_0023229
643 Ga0501044_0037232
644 Ga0501044_0250329
645 Ga0501044_0357226
646 nmdc:mga00v17_4454_c1
647 nmdc:mga00v17_554_c1
648 Ga0500634_0000138
649 2547500375
650 2578457693
651 2643818794
652 2643878458
653 2643941047
654 2643975898
655 2644079914
656 2644528952
657 2644659766
658 2644695509
659 2644700493
660 2747948196
661 2748015978
662 2765579801
663 2816519147
664 2819660036
665 2842394770
666 2842760032
667 2842780846
668 2852650141
669 2852685148
670 2874222487
671 2894415423
672 2895504063
673 2895515417
674 2895525072
675 2895527781
676 2919090426
677 2919130688
678 2919137639
679 2919514797
680 2919677417
681 2928498263
682 2929198309
683 2931384057
684 2937614781
685 2939591023
686 2939625626
687 2939628404
688 2941476559
689 2941491514
690 2961049252
691 2961066049
692 2974308303
693 2977249061
694 2984516487
695 2987606184
696 2995952380
697 8003016260
698 8021626453
699 8021630178
700 8021650698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01612

DNA_pol_A_exo1

3'-5' exonuclease

4

169

0.95

PF00570

HRDC

HRDC domain

211

278

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c0x-assembly1.cif.gz_K structure of a 12-subunit nuclear exosome complex bound to structured rna 0.8837 3 186
7d4i-assembly1.cif.gz_r6 cryo-em structure of 90s small ribosomal precursors complex with the deah-box rna helicase dhr1 (state f) 0.8733 3 186
6fsz-assembly1.cif.gz_KK structure of the nuclear rna exosome 0.8733 3 186
2fbv-assembly1.cif.gz_A wrn exonuclease, mn complex 0.8663 1 166
5zo3-assembly1.cif.gz_A apo form of the nuclease 0.8649 4 192
ID Description Score Start End Superfamily
1yt3A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9386 3 189 3.30.420.10
af_A0A1D8PDF4_132_438_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9169 2 186 3.30.420.10
4nlbA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9153 1 186 3.30.420.10
af_G5EBX6_179_483_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9025 2 186 3.30.420.10
1yt3A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9015 3 189 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A7X5N586-F1-model_v4 Ribonuclease D 0.9919 55 146 GO:0003676
GO:0006139
GO:0008408
AF-A0A091AZ48-F1-model_v4 HRDC domain-containing protein 0.9759 3 360 GO:0000166
GO:0003676
GO:0005737
GO:0008033
GO:0008408
GO:0033890
AF-A0A6P0FS07-F1-model_v4 Ribonuclease D 0.9714 3 209 GO:0003676
GO:0006139
GO:0008408
AF-A0A091AZ48-F1-model_v4 HRDC domain-containing protein 0.9679 3 360 GO:0000166
GO:0003676
GO:0005737
GO:0008033
GO:0008408
GO:0033890
AF-A0A7D0IQV7-F1-model_v4 deleted 0.9653 1 360

Map