F418474
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 351 | 216 | 702 | 353 |
Family's Representative Sequence
| Representative Sequence | 3300001990|JGI24737J22298_10019315|JGI24737J22298_100193152 |
| Length | 367 |
| Sequence | MPTRLGALGQNWLMQLPVMPPVPPMLAKSVSAIPPGASYEPKWDGFRSICFRDGDEVELGSRNERPMTRYFPELVAAIKAELPQRCVIDGEIVIATPGGLDFEALQQRIHPADSRVRLLAQQTPASFIAFDLLALGDDDLTKRPFAERRAALVDALAGAGPSVHLTPATADLAEAQRWFTEFEGAGLDGVVAKPLDGTYQPDKRVMFKIKHERTADCVVGGYRVHKSGPDAVGSLMLGLYRGDTLVSVGVIGAFPMQRRRELFTELQPLVTDFEGHPWDWAAHLAGERTPRKGEGSRWNAGKDLSFVPLRPELVVEVRYDHMEGERFRHTAQFNRWRPDRTPESCTYEQLEQPVTFSLGEIVPGLGT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 37 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 40 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 41 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 67 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 68 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 105 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 106 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 107 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 108 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 109 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 110 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 111 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 112 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 113 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 114 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 115 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 116 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 117 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 118 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 119 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 120 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 121 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 122 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 123 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 124 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 125 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 126 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 127 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 128 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 129 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 130 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 131 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 132 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 133 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 134 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 135 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 136 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 137 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 138 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 139 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 140 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 141 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 142 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 143 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 144 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 145 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 146 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 147 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 148 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 155 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 156 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 157 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 158 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 159 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 160 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 163 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 164 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 165 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 166 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 167 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 168 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 169 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 170 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 171 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 172 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 173 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 174 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 175 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 189 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 190 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 191 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 192 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 195 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 196 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 197 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 198 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 199 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 200 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 201 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 202 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 203 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 204 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 205 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 206 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 207 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 208 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 209 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 210 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 211 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 212 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 213 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 214 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 215 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 216 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.87 |
| Metatranscriptomes | 0.28 |
| Isolates | 4.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.41 |
| Nodule | 0.28 |
| Rhizoplane | 10.54 |
| Rhizosphere | 73.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10019315 | 3300001990 | Bacteria | 2180 |
| 2 | JGI24735J21928_10009706 | 3300002067 | Bacteria | 3083 |
| 3 | Ga0055540_1004054 | 3300003792 | Bacteria | 6805 |
| 4 | Ga0068869_100146229 | 3300005334 | Bacteria | 1829 |
| 5 | Ga0070682_100032737 | 3300005337 | Bacteria | 3154 |
| 6 | Ga0068868_100100344 | 3300005338 | Bacteria | 2342 |
| 7 | Ga0070687_100027208 | 3300005343 | Bacteria | 2760 |
| 8 | Ga0070661_100090697 | 3300005344 | Bacteria | 2263 |
| 9 | Ga0070671_100115702 | 3300005355 | Bacteria | 2255 |
| 10 | Ga0070674_100033480 | 3300005356 | Bacteria | 3421 |
| 11 | Ga0070673_100081387 | 3300005364 | Bacteria | 2626 |
| 12 | Ga0070688_100091048 | 3300005365 | Bacteria | 1993 |
| 13 | Ga0070659_100186765 | 3300005366 | Bacteria | 1702 |
| 14 | Ga0070667_100031980 | 3300005367 | Bacteria | 4387 |
| 15 | Ga0070667_100096300 | 3300005367 | Bacteria | 2552 |
| 16 | Ga0070667_100299550 | 3300005367 | Bacteria | 1447 |
| 17 | Ga0070714_100000006 | 3300005435 | Bacteria | 293311 |
| 18 | Ga0070701_10166004 | 3300005438 | Bacteria | 1282 |
| 19 | Ga0070700_100000011 | 3300005441 | Bacteria | 173076 |
| 20 | Ga0070663_100042515 | 3300005455 | Bacteria | 3193 |
| 21 | Ga0070678_100016504 | 3300005456 | Bacteria | 4727 |
| 22 | Ga0070706_100082344 | 3300005467 | Bacteria | 2981 |
| 23 | Ga0070684_100120063 | 3300005535 | Bacteria | 2364 |
| 24 | Ga0070672_100178944 | 3300005543 | Bacteria | 1766 |
| 25 | Ga0070665_100022993 | 3300005548 | Bacteria | 6276 |
| 26 | Ga0068855_100014820 | 3300005563 | Bacteria | 9388 |
| 27 | Ga0070664_100366624 | 3300005564 | Bacteria | 1312 |
| 28 | Ga0068856_100059095 | 3300005614 | Bacteria | 3787 |
| 29 | Ga0068856_100078436 | 3300005614 | Bacteria | 3274 |
| 30 | Ga0070702_100032304 | 3300005615 | Bacteria | 2871 |
| 31 | Ga0068859_100013272 | 3300005617 | Bacteria | 8265 |
| 32 | Ga0068859_100028595 | 3300005617 | Bacteria | 5589 |
| 33 | Ga0068864_100109738 | 3300005618 | Bacteria | 2456 |
| 34 | Ga0068870_10088672 | 3300005840 | Bacteria | 1725 |
| 35 | Ga0068863_100000496 | 3300005841 | Bacteria | 39941 |
| 36 | Ga0068858_100086316 | 3300005842 | Bacteria | 2919 |
| 37 | Ga0068858_100104606 | 3300005842 | Bacteria | 2641 |
| 38 | Ga0068860_100277985 | 3300005843 | Bacteria | 1635 |
| 39 | Ga0068862_100027176 | 3300005844 | Bacteria | 4815 |
| 40 | Ga0068862_100149141 | 3300005844 | Bacteria | 2081 |
| 41 | Ga0081455_10001039 | 3300005937 | Bacteria | 35032 |
| 42 | Ga0081455_10007057 | 3300005937 | Bacteria | 11924 |
| 43 | Ga0081455_10010526 | 3300005937 | Bacteria | 9374 |
| 44 | Ga0081455_10019609 | 3300005937 | Bacteria | 6390 |
| 45 | Ga0081455_10070785 | 3300005937 | Bacteria | 2894 |
| 46 | Ga0081455_10120076 | 3300005937 | Bacteria | 2072 |
| 47 | Ga0081540_1001394 | 3300005983 | Bacteria | 20936 |
| 48 | Ga0075365_10040331 | 3300006038 | Bacteria | 3045 |
| 49 | Ga0075365_10048531 | 3300006038 | Bacteria | 2795 |
| 50 | Ga0075365_10130257 | 3300006038 | Bacteria | 1741 |
| 51 | Ga0070716_100001757 | 3300006173 | Bacteria | 9795 |
| 52 | Ga0075369_10035046 | 3300006186 | Bacteria | 2132 |
| 53 | Ga0075370_10015466 | 3300006353 | Bacteria | 4086 |
| 54 | Ga0097620_100013272 | 3300006931 | Bacteria | 8265 |
| 55 | Ga0097620_100028595 | 3300006931 | Bacteria | 5589 |
| 56 | Ga0105240_10015550 | 3300009093 | Bacteria | 10342 |
| 57 | Ga0105240_10277990 | 3300009093 | Bacteria | 1924 |
| 58 | Ga0105245_10289439 | 3300009098 | Bacteria | 1604 |
| 59 | Ga0105247_10000046 | 3300009101 | Bacteria | 151843 |
| 60 | Ga0105247_10001542 | 3300009101 | Bacteria | 16439 |
| 61 | Ga0105247_10011635 | 3300009101 | Bacteria | 5301 |
| 62 | Ga0105247_10037551 | 3300009101 | Bacteria | 2955 |
| 63 | Ga0105247_10054211 | 3300009101 | Bacteria | 2475 |
| 64 | Ga0105243_10065858 | 3300009148 | Bacteria | 2912 |
| 65 | Ga0105243_10102534 | 3300009148 | Bacteria | 2378 |
| 66 | Ga0105241_10148371 | 3300009174 | Bacteria | 1916 |
| 67 | Ga0105242_10231994 | 3300009176 | Bacteria | 1654 |
| 68 | Ga0105248_10000153 | 3300009177 | Bacteria | 80607 |
| 69 | Ga0105237_10005091 | 3300009545 | Bacteria | 14927 |
| 70 | Ga0105237_10017843 | 3300009545 | Bacteria | 7357 |
| 71 | Ga0105237_10098309 | 3300009545 | Bacteria | 2918 |
| 72 | Ga0105238_10509453 | 3300009551 | Bacteria | 1205 |
| 73 | Ga0105249_10009825 | 3300009553 | Bacteria | 8385 |
| 74 | Ga0105249_10019476 | 3300009553 | Bacteria | 6055 |
| 75 | Ga0105239_10003727 | 3300010375 | Bacteria | 18549 |
| 76 | Ga0105239_10090112 | 3300010375 | Bacteria | 3383 |
| 77 | Ga0105239_10091477 | 3300010375 | Bacteria | 3357 |
| 78 | Ga0105246_10272037 | 3300011119 | Bacteria | 1355 |
| 79 | Ga0157370_10019589 | 3300013104 | Bacteria | 6780 |
| 80 | Ga0157369_10026195 | 3300013105 | Bacteria | 6470 |
| 81 | Ga0157369_10054587 | 3300013105 | Bacteria | 4315 |
| 82 | Ga0157374_10015545 | 3300013296 | Bacteria | 6677 |
| 83 | Ga0157374_10175376 | 3300013296 | Bacteria | 2092 |
| 84 | Ga0157378_10028101 | 3300013297 | Bacteria | 4961 |
| 85 | Ga0157378_10061131 | 3300013297 | Bacteria | 3361 |
| 86 | Ga0157378_10166330 | 3300013297 | Bacteria | 2066 |
| 87 | Ga0163162_10146794 | 3300013306 | Bacteria | 2475 |
| 88 | Ga0163162_10175860 | 3300013306 | Bacteria | 2266 |
| 89 | Ga0157372_10000022 | 3300013307 | Bacteria | 206038 |
| 90 | Ga0157372_10038611 | 3300013307 | Bacteria | 5269 |
| 91 | Ga0157372_10067771 | 3300013307 | Bacteria | 4011 |
| 92 | Ga0157372_10521137 | 3300013307 | Bacteria | 1386 |
| 93 | Ga0157375_10025245 | 3300013308 | Bacteria | 5517 |
| 94 | Ga0157375_10197092 | 3300013308 | Bacteria | 2169 |
| 95 | Ga0163163_10585351 | 3300014325 | Bacteria | 1179 |
| 96 | Ga0157377_10016380 | 3300014745 | Bacteria | 3813 |
| 97 | Ga0157379_10012655 | 3300014968 | Bacteria | 7374 |
| 98 | Ga0163161_10009471 | 3300017792 | Bacteria | 6741 |
| 99 | Ga0206353_10697503 | 3300020082 | Bacteria | 3206 |
| 100 | Ga0213876_10011043 | 3300021384 | Bacteria | 4834 |
| 101 | Ga0213876_10040612 | 3300021384 | Bacteria | 2458 |
| 102 | Ga0213876_10045291 | 3300021384 | Bacteria | 2327 |
| 103 | Ga0213875_10068507 | 3300021388 | Bacteria | 1657 |
| 104 | Ga0209051_1000750 | 3300025303 | Bacteria | 34899 |
| 105 | Ga0209051_1015414 | 3300025303 | Bacteria | 3515 |
| 106 | Ga0207710_10000071 | 3300025900 | Bacteria | 151859 |
| 107 | Ga0207710_10000146 | 3300025900 | Bacteria | 80814 |
| 108 | Ga0207710_10018522 | 3300025900 | Bacteria | 2962 |
| 109 | Ga0207688_10001523 | 3300025901 | Bacteria | 12166 |
| 110 | Ga0207688_10013099 | 3300025901 | Bacteria | 4507 |
| 111 | Ga0207647_10082486 | 3300025904 | Bacteria | 1926 |
| 112 | Ga0207643_10017425 | 3300025908 | Bacteria | 3928 |
| 113 | Ga0207705_10213847 | 3300025909 | Bacteria | 1462 |
| 114 | Ga0207695_10015740 | 3300025913 | Bacteria | 8892 |
| 115 | Ga0207671_10001867 | 3300025914 | Bacteria | 23470 |
| 116 | Ga0207671_10089187 | 3300025914 | Bacteria | 2321 |
| 117 | Ga0207671_10115070 | 3300025914 | Bacteria | 2050 |
| 118 | Ga0207693_10001955 | 3300025915 | Bacteria | 18066 |
| 119 | Ga0207660_10228173 | 3300025917 | Bacteria | 1463 |
| 120 | Ga0207662_10031703 | 3300025918 | Bacteria | 3071 |
| 121 | Ga0207657_10020351 | 3300025919 | Bacteria | 6272 |
| 122 | Ga0207652_10049228 | 3300025921 | Bacteria | 3607 |
| 123 | Ga0207681_10001078 | 3300025923 | Bacteria | 17698 |
| 124 | Ga0207681_10089982 | 3300025923 | Bacteria | 2190 |
| 125 | Ga0207687_10097393 | 3300025927 | Bacteria | 2158 |
| 126 | Ga0207700_10172219 | 3300025928 | Bacteria | 1807 |
| 127 | Ga0207664_10000032 | 3300025929 | Bacteria | 179232 |
| 128 | Ga0207644_10150709 | 3300025931 | Bacteria | 1799 |
| 129 | Ga0207690_10118831 | 3300025932 | Bacteria | 1916 |
| 130 | Ga0207706_10049286 | 3300025933 | Bacteria | 3722 |
| 131 | Ga0207709_10292143 | 3300025935 | Bacteria | 1208 |
| 132 | Ga0207670_10034836 | 3300025936 | Bacteria | 3259 |
| 133 | Ga0207665_10082155 | 3300025939 | Bacteria | 2220 |
| 134 | Ga0207691_10126170 | 3300025940 | Bacteria | 2264 |
| 135 | Ga0207711_10000923 | 3300025941 | Bacteria | 28332 |
| 136 | Ga0207711_10026191 | 3300025941 | Bacteria | 4892 |
| 137 | Ga0207689_10005173 | 3300025942 | Bacteria | 11718 |
| 138 | Ga0207689_10059598 | 3300025942 | Bacteria | 3139 |
| 139 | Ga0207667_10010916 | 3300025949 | Bacteria | 10586 |
| 140 | Ga0207667_10062852 | 3300025949 | Bacteria | 3881 |
| 141 | Ga0207658_10047160 | 3300025986 | Bacteria | 3152 |
| 142 | Ga0207703_10000036 | 3300026035 | Bacteria | 181013 |
| 143 | Ga0207703_10155119 | 3300026035 | Bacteria | 2000 |
| 144 | Ga0207678_10105598 | 3300026067 | Bacteria | 2403 |
| 145 | Ga0207708_10000009 | 3300026075 | Bacteria | 235909 |
| 146 | Ga0207708_10070871 | 3300026075 | Bacteria | 2669 |
| 147 | Ga0207702_10044172 | 3300026078 | Bacteria | 3745 |
| 148 | Ga0207641_10000643 | 3300026088 | Bacteria | 38084 |
| 149 | Ga0207641_10015657 | 3300026088 | Bacteria | 6215 |
| 150 | Ga0207648_10007446 | 3300026089 | Bacteria | 10762 |
| 151 | Ga0207675_100014457 | 3300026118 | Bacteria | 7359 |
| 152 | Ga0207675_100035394 | 3300026118 | Bacteria | 4658 |
| 153 | Ga0207683_10030206 | 3300026121 | Bacteria | 4695 |
| 154 | Ga0207683_10096459 | 3300026121 | Bacteria | 2636 |
| 155 | Ga0207683_10143995 | 3300026121 | Bacteria | 2148 |
| 156 | Ga0207683_10348914 | 3300026121 | Bacteria | 1358 |
| 157 | Ga0307513_10007060 | 3300031456 | Bacteria | 14600 |
| 158 | Ga0307408_100004469 | 3300031548 | Bacteria | 9491 |
| 159 | Ga0307408_100045079 | 3300031548 | Bacteria | 3147 |
| 160 | Ga0307408_100085007 | 3300031548 | Bacteria | 2374 |
| 161 | Ga0307405_10009647 | 3300031731 | Bacteria | 4958 |
| 162 | Ga0307405_10076439 | 3300031731 | Bacteria | 2172 |
| 163 | Ga0307405_10100384 | 3300031731 | Bacteria | 1939 |
| 164 | Ga0307413_10015892 | 3300031824 | Bacteria | 3871 |
| 165 | Ga0307413_10058990 | 3300031824 | Bacteria | 2356 |
| 166 | Ga0307410_10014348 | 3300031852 | Bacteria | 4659 |
| 167 | Ga0307410_10025366 | 3300031852 | Bacteria | 3718 |
| 168 | Ga0307407_10012791 | 3300031903 | Bacteria | 4049 |
| 169 | Ga0307407_10097615 | 3300031903 | Bacteria | 1816 |
| 170 | Ga0307412_10003312 | 3300031911 | Bacteria | 8943 |
| 171 | Ga0307412_10007510 | 3300031911 | Bacteria | 6189 |
| 172 | Ga0307412_10059334 | 3300031911 | Bacteria | 2563 |
| 173 | Ga0307412_10064354 | 3300031911 | Bacteria | 2477 |
| 174 | Ga0307412_10098234 | 3300031911 | Bacteria | 2064 |
| 175 | Ga0307409_100019236 | 3300031995 | Bacteria | 4617 |
| 176 | Ga0307409_100036618 | 3300031995 | Bacteria | 3609 |
| 177 | Ga0307416_100017671 | 3300032002 | Bacteria | 4999 |
| 178 | Ga0307416_100018984 | 3300032002 | Bacteria | 4861 |
| 179 | Ga0307416_100106291 | 3300032002 | Bacteria | 2459 |
| 180 | Ga0307416_100242790 | 3300032002 | Bacteria | 1746 |
| 181 | Ga0307416_100323845 | 3300032002 | Bacteria | 1545 |
| 182 | Ga0307416_100335500 | 3300032002 | Bacteria | 1522 |
| 183 | Ga0307414_10002589 | 3300032004 | Bacteria | 9516 |
| 184 | Ga0307414_10143092 | 3300032004 | Bacteria | 1875 |
| 185 | Ga0307414_10199019 | 3300032004 | Bacteria | 1628 |
| 186 | Ga0307411_10051359 | 3300032005 | Bacteria | 2689 |
| 187 | Ga0307415_100010874 | 3300032126 | Bacteria | 5175 |
| 188 | Ga0307415_100205420 | 3300032126 | Bacteria | 1567 |
| 189 | Ga0373956_0002130 | 3300035119 | Bacteria | 8197 |
| 190 | Ga0373927_0066879 | 3300035695 | Bacteria | 2325 |
| 191 | Ga0373933_0116376 | 3300035724 | Bacteria | 1671 |
| 192 | Ga0395900_0033940 | 3300037418 | Bacteria | 5252 |
| 193 | Ga0395898_0096954 | 3300037466 | Bacteria | 2832 |
| 194 | Ga0436364_1376393 | 3300037853 | Bacteria | 2426 |
| 195 | Ga0395901_0038530 | 3300038443 | Bacteria | 4945 |
| 196 | Ga0436365_0158682 | 3300039437 | Bacteria | 4834 |
| 197 | Ga0436365_0955489 | 3300039437 | Bacteria | 8665 |
| 198 | Ga0436365_1591167 | 3300039437 | Bacteria | 2296 |
| 199 | Ga0436363_0523583 | 3300039450 | Bacteria | 3727 |
| 200 | Ga0439466_0006026 | 3300041411 | Bacteria | 4615 |
| 201 | Ga0439466_0046258 | 3300041411 | Bacteria | 1438 |
| 202 | Ga0439466_0057108 | 3300041411 | Bacteria | 1265 |
| 203 | Ga0439465_0022912 | 3300041413 | Bacteria | 1963 |
| 204 | Ga0439433_0004524 | 3300041999 | Bacteria | 2994 |
| 205 | Ga0439442_001207 | 3300042002 | Bacteria | 5143 |
| 206 | Ga0439432_006810 | 3300042006 | Bacteria | 4069 |
| 207 | Ga0439449_0002528 | 3300042007 | Bacteria | 7148 |
| 208 | Ga0450920_000171 | 3300042122 | Bacteria | 9136 |
| 209 | Ga0450907_000292 | 3300042146 | Bacteria | 16874 |
| 210 | Ga0439434_0000012 | 3300042435 | Bacteria | 46644 |
| 211 | Ga0466969_0031215 | 3300044656 | Bacteria | 2713 |
| 212 | Ga0466972_0005580 | 3300044658 | Bacteria | 6302 |
| 213 | Ga0466972_0047246 | 3300044658 | Bacteria | 2082 |
| 214 | Ga0466972_0104689 | 3300044658 | Bacteria | 1338 |
| 215 | Ga0466966_0009545 | 3300044684 | Bacteria | 6422 |
| 216 | Ga0466966_0009627 | 3300044684 | Bacteria | 6395 |
| 217 | Ga0466966_0030718 | 3300044684 | Bacteria | 3485 |
| 218 | Ga0466966_0063538 | 3300044684 | Bacteria | 2326 |
| 219 | Ga0466966_0103490 | 3300044684 | Bacteria | 1760 |
| 220 | Ga0466966_0132603 | 3300044684 | Bacteria | 1525 |
| 221 | Ga0466961_0045087 | 3300044693 | Bacteria | 2822 |
| 222 | Ga0466961_0068218 | 3300044693 | Bacteria | 2258 |
| 223 | Ga0466963_0011211 | 3300044694 | Bacteria | 5455 |
| 224 | Ga0466963_0093846 | 3300044694 | Bacteria | 2046 |
| 225 | Ga0466964_0025618 | 3300044706 | Bacteria | 2304 |
| 226 | Ga0466971_0016342 | 3300044719 | Bacteria | 3274 |
| 227 | Ga0466968_0008622 | 3300044735 | Bacteria | 3907 |
| 228 | Ga0466970_0001924 | 3300044765 | Bacteria | 10040 |
| 229 | Ga0466970_0041895 | 3300044765 | Bacteria | 2434 |
| 230 | Ga0466970_0089293 | 3300044765 | Bacteria | 1672 |
| 231 | Ga0466970_0095311 | 3300044765 | Bacteria | 1618 |
| 232 | Ga0466957_0009300 | 3300044842 | Bacteria | 5607 |
| 233 | Ga0466957_0036945 | 3300044842 | Bacteria | 2939 |
| 234 | Ga0466957_0073340 | 3300044842 | Bacteria | 2121 |
| 235 | Ga0466957_0123564 | 3300044842 | Bacteria | 1652 |
| 236 | Ga0466960_0003094 | 3300044901 | Bacteria | 6366 |
| 237 | Ga0466959_0001288 | 3300045049 | Bacteria | 15176 |
| 238 | Ga0466959_0016182 | 3300045049 | Bacteria | 5445 |
| 239 | Ga0466959_0088491 | 3300045049 | Bacteria | 2226 |
| 240 | Ga0466958_0017996 | 3300045836 | Bacteria | 4096 |
| 241 | Ga0466958_0020825 | 3300045836 | Bacteria | 3827 |
| 242 | Ga0466958_0043337 | 3300045836 | Bacteria | 2710 |
| 243 | Ga0466958_0164042 | 3300045836 | Bacteria | 1405 |
| 244 | Ga0466967_0002940 | 3300045976 | Bacteria | 10875 |
| 245 | Ga0466967_0004824 | 3300045976 | Bacteria | 9194 |
| 246 | Ga0466967_0049179 | 3300045976 | Bacteria | 3686 |
| 247 | Ga0466967_0077258 | 3300045976 | Bacteria | 2997 |
| 248 | Ga0495580_0063511 | 3300046472 | Bacteria | 2589 |
| 249 | Ga0495648_0021857 | 3300046524 | Bacteria | 4418 |
| 250 | Ga0495672_0000906 | 3300047320 | Bacteria | 31047 |
| 251 | Ga0495673_0000673 | 3300047469 | Bacteria | 33572 |
| 252 | Ga0496100_0323628 | 3300048903 | Bacteria | 1159 |
| 253 | Ga0496101_0001637 | 3300048904 | Bacteria | 13428 |
| 254 | Ga0496101_0085176 | 3300048904 | Bacteria | 2341 |
| 255 | Ga0496101_0090426 | 3300048904 | Bacteria | 2277 |
| 256 | Ga0496101_0346015 | 3300048904 | Bacteria | 1168 |
| 257 | Ga0496102_0000095 | 3300048905 | Bacteria | 124981 |
| 258 | Ga0496102_0004130 | 3300048905 | Bacteria | 12310 |
| 259 | Ga0496102_0007350 | 3300048905 | Bacteria | 9410 |
| 260 | Ga0496102_0059949 | 3300048905 | Bacteria | 3481 |
| 261 | Ga0496102_0094339 | 3300048905 | Bacteria | 2773 |
| 262 | Ga0496102_0126741 | 3300048905 | Bacteria | 2387 |
| 263 | Ga0496103_0000791 | 3300048906 | Bacteria | 23282 |
| 264 | Ga0496104_0007259 | 3300048907 | Bacteria | 9779 |
| 265 | Ga0496104_0156782 | 3300048907 | Bacteria | 2185 |
| 266 | Ga0496104_0259366 | 3300048907 | Bacteria | 1651 |
| 267 | Ga0496105_0006738 | 3300048908 | Bacteria | 8833 |
| 268 | Ga0496106_0022212 | 3300048909 | Bacteria | 4712 |
| 269 | Ga0496106_0270208 | 3300048909 | Bacteria | 1361 |
| 270 | Ga0496107_0011202 | 3300048910 | Bacteria | 6242 |
| 271 | Ga0496108_0074540 | 3300048911 | Bacteria | 2865 |
| 272 | Ga0496108_0180191 | 3300048911 | Bacteria | 1829 |
| 273 | Ga0496109_0001497 | 3300048912 | Bacteria | 19409 |
| 274 | Ga0496109_0002371 | 3300048912 | Bacteria | 15734 |
| 275 | Ga0496109_0085349 | 3300048912 | Bacteria | 2914 |
| 276 | Ga0496110_0024970 | 3300048913 | Bacteria | 5101 |
| 277 | Ga0496110_0026723 | 3300048913 | Bacteria | 4943 |
| 278 | Ga0496111_0005748 | 3300048914 | Bacteria | 8002 |
| 279 | Ga0496111_0146520 | 3300048914 | Bacteria | 1751 |
| 280 | Ga0496112_0018897 | 3300048915 | Bacteria | 6493 |
| 281 | Ga0496112_0104192 | 3300048915 | Bacteria | 2807 |
| 282 | Ga0496112_0171781 | 3300048915 | Bacteria | 2133 |
| 283 | Ga0496113_0012945 | 3300048916 | Bacteria | 5627 |
| 284 | Ga0496113_0014882 | 3300048916 | Bacteria | 5324 |
| 285 | Ga0496113_0086917 | 3300048916 | Bacteria | 2403 |
| 286 | Ga0496114_0030061 | 3300048917 | Bacteria | 4467 |
| 287 | Ga0496114_0276281 | 3300048917 | Bacteria | 1481 |
| 288 | Ga0496115_0079353 | 3300048918 | Bacteria | 2671 |
| 289 | Ga0496116_0022879 | 3300048919 | Bacteria | 4667 |
| 290 | Ga0496117_0051528 | 3300048920 | Bacteria | 2909 |
| 291 | Ga0496118_0003906 | 3300048921 | Bacteria | 18249 |
| 292 | Ga0496118_0005741 | 3300048921 | Bacteria | 13957 |
| 293 | Ga0496118_0039324 | 3300048921 | Bacteria | 3776 |
| 294 | Ga0496118_0050519 | 3300048921 | Bacteria | 3190 |
| 295 | Ga0496119_0013252 | 3300048922 | Bacteria | 6590 |
| 296 | Ga0496119_0056578 | 3300048922 | Bacteria | 2376 |
| 297 | Ga0496119_0060896 | 3300048922 | Bacteria | 2257 |
| 298 | Ga0496121_0001856 | 3300048924 | Bacteria | 33927 |
| 299 | Ga0496121_0079390 | 3300048924 | Bacteria | 2605 |
| 300 | Ga0496121_0104246 | 3300048924 | Bacteria | 2180 |
| 301 | Ga0496125_0101016 | 3300048928 | Bacteria | 2124 |
| 302 | Ga0496126_0001953 | 3300048929 | Bacteria | 29245 |
| 303 | Ga0496126_0039384 | 3300048929 | Bacteria | 4386 |
| 304 | Ga0501032_0003545 | 3300049569 | Bacteria | 11908 |
| 305 | Ga0501032_0004891 | 3300049569 | Bacteria | 10028 |
| 306 | Ga0501033_0022458 | 3300049570 | Bacteria | 4760 |
| 307 | Ga0501033_0023472 | 3300049570 | Bacteria | 4651 |
| 308 | Ga0501033_0153896 | 3300049570 | Bacteria | 1658 |
| 309 | Ga0501036_0097415 | 3300049572 | Bacteria | 2486 |
| 310 | Ga0501037_0110790 | 3300049573 | Bacteria | 1977 |
| 311 | Ga0501039_0026392 | 3300049575 | Bacteria | 4463 |
| 312 | Ga0501042_0013637 | 3300049578 | Bacteria | 5534 |
| 313 | Ga0501047_0008431 | 3300049581 | Bacteria | 9724 |
| 314 | Ga0501048_0000264 | 3300049582 | Bacteria | 35134 |
| 315 | Ga0501073_0138539 | 3300049589 | Bacteria | 1686 |
| 316 | Ga0501075_0138928 | 3300049591 | Bacteria | 1851 |
| 317 | Ga0501083_0000003 | 3300049744 | Bacteria | 235949 |
| 318 | Ga0501035_0004704 | 3300049822 | Bacteria | 12963 |
| 319 | Ga0501035_0047716 | 3300049822 | Bacteria | 3843 |
| 320 | Ga0501044_0065163 | 3300049823 | Bacteria | 3716 |
| 321 | nmdc:mga00v17_22869_c1 | 3300050491 | Bacteria | 3612 |
| 322 | nmdc:mga0yw44_26285_c1 | 3300050492 | Bacteria | 3323 |
| 323 | nmdc:mga0yw44_83561_c1 | 3300050492 | Bacteria | 2006 |
| 324 | nmdc:mga06z11_67886_c1 | 3300050494 | Bacteria | 1878 |
| 325 | nmdc:mga07m45_8741_c1 | 3300050496 | Bacteria | 5220 |
| 326 | nmdc:mga0qj67_106534_c1 | 3300050509 | Bacteria | 2261 |
| 327 | nmdc:mga06r32_340793_c1 | 3300050510 | Bacteria | 1484 |
| 328 | Ga0500610_0095995 | 3300053079 | Bacteria | 1537 |
| 329 | Ga0500643_005275 | 3300053087 | Bacteria | 5607 |
| 330 | Ga0500643_020112 | 3300053087 | Bacteria | 2188 |
| 331 | Ga0500642_0053039 | 3300053130 | Bacteria | 1797 |
| 332 | Ga0500652_000651 | 3300053131 | Bacteria | 11825 |
| 333 | Ga0500645_000004 | 3300053730 | Bacteria | 305014 |
| 334 | Ga0466962_0024611 | 3300061719 | Bacteria | 2891 |
| 335 | 2517763826 | 2517572101 | Bacteria | 6884336 |
| 336 | 2644488453 | 2643221687 | Bacteria | 6500351 |
| 337 | 2738703307 | 2738541274 | Bacteria | 6909446 |
| 338 | 2739329232 | 2738543028 | Bacteria | 6917070 |
| 339 | 2775657151 | 2775506735 | Bacteria | 4556596 |
| 340 | 2795783012 | 2795385470 | Bacteria | 8317180 |
| 341 | 2808829102 | 2808606357 | Bacteria | 4466944 |
| 342 | 2808850327 | 2808606360 | Bacteria | 4404006 |
| 343 | 2808898583 | 2808606371 | Bacteria | 4251511 |
| 344 | 2809226652 | 2808606447 | Bacteria | 3572005 |
| 345 | 2812319153 | 2811994871 | Bacteria | 4497550 |
| 346 | 2852632861 | 2852632344 | Bacteria | 3463163 |
| 347 | 2902795374 | 2902792274 | Bacteria | 7270173 |
| 348 | 2902800308 | 2902799365 | Bacteria | 5419524 |
| 349 | 2929218337 | 2929212328 | Bacteria | 7708288 |
| 350 | 2939583826 | 2939582691 | Bacteria | 7088898 |
| 351 | 2954002672 | 2953998280 | Bacteria | 4812144 |
| 352 | JGI24737J22298_10019315 | |||
| 353 | JGI24735J21928_10009706 | |||
| 354 | Ga0055540_1004054 | |||
| 355 | Ga0068869_100146229 | |||
| 356 | Ga0070682_100032737 | |||
| 357 | Ga0068868_100100344 | |||
| 358 | Ga0070687_100027208 | |||
| 359 | Ga0070661_100090697 | |||
| 360 | Ga0070671_100115702 | |||
| 361 | Ga0070674_100033480 | |||
| 362 | Ga0070673_100081387 | |||
| 363 | Ga0070688_100091048 | |||
| 364 | Ga0070659_100186765 | |||
| 365 | Ga0070667_100031980 | |||
| 366 | Ga0070667_100096300 | |||
| 367 | Ga0070667_100299550 | |||
| 368 | Ga0070714_100000006 | |||
| 369 | Ga0070701_10166004 | |||
| 370 | Ga0070700_100000011 | |||
| 371 | Ga0070663_100042515 | |||
| 372 | Ga0070678_100016504 | |||
| 373 | Ga0070706_100082344 | |||
| 374 | Ga0070684_100120063 | |||
| 375 | Ga0070672_100178944 | |||
| 376 | Ga0070665_100022993 | |||
| 377 | Ga0068855_100014820 | |||
| 378 | Ga0070664_100366624 | |||
| 379 | Ga0068856_100059095 | |||
| 380 | Ga0068856_100078436 | |||
| 381 | Ga0070702_100032304 | |||
| 382 | Ga0068859_100013272 | |||
| 383 | Ga0068859_100028595 | |||
| 384 | Ga0068864_100109738 | |||
| 385 | Ga0068870_10088672 | |||
| 386 | Ga0068863_100000496 | |||
| 387 | Ga0068858_100086316 | |||
| 388 | Ga0068858_100104606 | |||
| 389 | Ga0068860_100277985 | |||
| 390 | Ga0068862_100027176 | |||
| 391 | Ga0068862_100149141 | |||
| 392 | Ga0081455_10001039 | |||
| 393 | Ga0081455_10007057 | |||
| 394 | Ga0081455_10010526 | |||
| 395 | Ga0081455_10019609 | |||
| 396 | Ga0081455_10070785 | |||
| 397 | Ga0081455_10120076 | |||
| 398 | Ga0081540_1001394 | |||
| 399 | Ga0075365_10040331 | |||
| 400 | Ga0075365_10048531 | |||
| 401 | Ga0075365_10130257 | |||
| 402 | Ga0070716_100001757 | |||
| 403 | Ga0075369_10035046 | |||
| 404 | Ga0075370_10015466 | |||
| 405 | Ga0097620_100013272 | |||
| 406 | Ga0097620_100028595 | |||
| 407 | Ga0105240_10015550 | |||
| 408 | Ga0105240_10277990 | |||
| 409 | Ga0105245_10289439 | |||
| 410 | Ga0105247_10000046 | |||
| 411 | Ga0105247_10001542 | |||
| 412 | Ga0105247_10011635 | |||
| 413 | Ga0105247_10037551 | |||
| 414 | Ga0105247_10054211 | |||
| 415 | Ga0105243_10065858 | |||
| 416 | Ga0105243_10102534 | |||
| 417 | Ga0105241_10148371 | |||
| 418 | Ga0105242_10231994 | |||
| 419 | Ga0105248_10000153 | |||
| 420 | Ga0105237_10005091 | |||
| 421 | Ga0105237_10017843 | |||
| 422 | Ga0105237_10098309 | |||
| 423 | Ga0105238_10509453 | |||
| 424 | Ga0105249_10009825 | |||
| 425 | Ga0105249_10019476 | |||
| 426 | Ga0105239_10003727 | |||
| 427 | Ga0105239_10090112 | |||
| 428 | Ga0105239_10091477 | |||
| 429 | Ga0105246_10272037 | |||
| 430 | Ga0157370_10019589 | |||
| 431 | Ga0157369_10026195 | |||
| 432 | Ga0157369_10054587 | |||
| 433 | Ga0157374_10015545 | |||
| 434 | Ga0157374_10175376 | |||
| 435 | Ga0157378_10028101 | |||
| 436 | Ga0157378_10061131 | |||
| 437 | Ga0157378_10166330 | |||
| 438 | Ga0163162_10146794 | |||
| 439 | Ga0163162_10175860 | |||
| 440 | Ga0157372_10000022 | |||
| 441 | Ga0157372_10038611 | |||
| 442 | Ga0157372_10067771 | |||
| 443 | Ga0157372_10521137 | |||
| 444 | Ga0157375_10025245 | |||
| 445 | Ga0157375_10197092 | |||
| 446 | Ga0163163_10585351 | |||
| 447 | Ga0157377_10016380 | |||
| 448 | Ga0157379_10012655 | |||
| 449 | Ga0163161_10009471 | |||
| 450 | Ga0206353_10697503 | |||
| 451 | Ga0213876_10011043 | |||
| 452 | Ga0213876_10040612 | |||
| 453 | Ga0213876_10045291 | |||
| 454 | Ga0213875_10068507 | |||
| 455 | Ga0209051_1000750 | |||
| 456 | Ga0209051_1015414 | |||
| 457 | Ga0207710_10000071 | |||
| 458 | Ga0207710_10000146 | |||
| 459 | Ga0207710_10018522 | |||
| 460 | Ga0207688_10001523 | |||
| 461 | Ga0207688_10013099 | |||
| 462 | Ga0207647_10082486 | |||
| 463 | Ga0207643_10017425 | |||
| 464 | Ga0207705_10213847 | |||
| 465 | Ga0207695_10015740 | |||
| 466 | Ga0207671_10001867 | |||
| 467 | Ga0207671_10089187 | |||
| 468 | Ga0207671_10115070 | |||
| 469 | Ga0207693_10001955 | |||
| 470 | Ga0207660_10228173 | |||
| 471 | Ga0207662_10031703 | |||
| 472 | Ga0207657_10020351 | |||
| 473 | Ga0207652_10049228 | |||
| 474 | Ga0207681_10001078 | |||
| 475 | Ga0207681_10089982 | |||
| 476 | Ga0207687_10097393 | |||
| 477 | Ga0207700_10172219 | |||
| 478 | Ga0207664_10000032 | |||
| 479 | Ga0207644_10150709 | |||
| 480 | Ga0207690_10118831 | |||
| 481 | Ga0207706_10049286 | |||
| 482 | Ga0207709_10292143 | |||
| 483 | Ga0207670_10034836 | |||
| 484 | Ga0207665_10082155 | |||
| 485 | Ga0207691_10126170 | |||
| 486 | Ga0207711_10000923 | |||
| 487 | Ga0207711_10026191 | |||
| 488 | Ga0207689_10005173 | |||
| 489 | Ga0207689_10059598 | |||
| 490 | Ga0207667_10010916 | |||
| 491 | Ga0207667_10062852 | |||
| 492 | Ga0207658_10047160 | |||
| 493 | Ga0207703_10000036 | |||
| 494 | Ga0207703_10155119 | |||
| 495 | Ga0207678_10105598 | |||
| 496 | Ga0207708_10000009 | |||
| 497 | Ga0207708_10070871 | |||
| 498 | Ga0207702_10044172 | |||
| 499 | Ga0207641_10000643 | |||
| 500 | Ga0207641_10015657 | |||
| 501 | Ga0207648_10007446 | |||
| 502 | Ga0207675_100014457 | |||
| 503 | Ga0207675_100035394 | |||
| 504 | Ga0207683_10030206 | |||
| 505 | Ga0207683_10096459 | |||
| 506 | Ga0207683_10143995 | |||
| 507 | Ga0207683_10348914 | |||
| 508 | Ga0307513_10007060 | |||
| 509 | Ga0307408_100004469 | |||
| 510 | Ga0307408_100045079 | |||
| 511 | Ga0307408_100085007 | |||
| 512 | Ga0307405_10009647 | |||
| 513 | Ga0307405_10076439 | |||
| 514 | Ga0307405_10100384 | |||
| 515 | Ga0307413_10015892 | |||
| 516 | Ga0307413_10058990 | |||
| 517 | Ga0307410_10014348 | |||
| 518 | Ga0307410_10025366 | |||
| 519 | Ga0307407_10012791 | |||
| 520 | Ga0307407_10097615 | |||
| 521 | Ga0307412_10003312 | |||
| 522 | Ga0307412_10007510 | |||
| 523 | Ga0307412_10059334 | |||
| 524 | Ga0307412_10064354 | |||
| 525 | Ga0307412_10098234 | |||
| 526 | Ga0307409_100019236 | |||
| 527 | Ga0307409_100036618 | |||
| 528 | Ga0307416_100017671 | |||
| 529 | Ga0307416_100018984 | |||
| 530 | Ga0307416_100106291 | |||
| 531 | Ga0307416_100242790 | |||
| 532 | Ga0307416_100323845 | |||
| 533 | Ga0307416_100335500 | |||
| 534 | Ga0307414_10002589 | |||
| 535 | Ga0307414_10143092 | |||
| 536 | Ga0307414_10199019 | |||
| 537 | Ga0307411_10051359 | |||
| 538 | Ga0307415_100010874 | |||
| 539 | Ga0307415_100205420 | |||
| 540 | Ga0373956_0002130 | |||
| 541 | Ga0373927_0066879 | |||
| 542 | Ga0373933_0116376 | |||
| 543 | Ga0395900_0033940 | |||
| 544 | Ga0395898_0096954 | |||
| 545 | Ga0436364_1376393 | |||
| 546 | Ga0395901_0038530 | |||
| 547 | Ga0436365_0158682 | |||
| 548 | Ga0436365_0955489 | |||
| 549 | Ga0436365_1591167 | |||
| 550 | Ga0436363_0523583 | |||
| 551 | Ga0439466_0006026 | |||
| 552 | Ga0439466_0046258 | |||
| 553 | Ga0439466_0057108 | |||
| 554 | Ga0439465_0022912 | |||
| 555 | Ga0439433_0004524 | |||
| 556 | Ga0439442_001207 | |||
| 557 | Ga0439432_006810 | |||
| 558 | Ga0439449_0002528 | |||
| 559 | Ga0450920_000171 | |||
| 560 | Ga0450907_000292 | |||
| 561 | Ga0439434_0000012 | |||
| 562 | Ga0466969_0031215 | |||
| 563 | Ga0466972_0005580 | |||
| 564 | Ga0466972_0047246 | |||
| 565 | Ga0466972_0104689 | |||
| 566 | Ga0466966_0009545 | |||
| 567 | Ga0466966_0009627 | |||
| 568 | Ga0466966_0030718 | |||
| 569 | Ga0466966_0063538 | |||
| 570 | Ga0466966_0103490 | |||
| 571 | Ga0466966_0132603 | |||
| 572 | Ga0466961_0045087 | |||
| 573 | Ga0466961_0068218 | |||
| 574 | Ga0466963_0011211 | |||
| 575 | Ga0466963_0093846 | |||
| 576 | Ga0466964_0025618 | |||
| 577 | Ga0466971_0016342 | |||
| 578 | Ga0466968_0008622 | |||
| 579 | Ga0466970_0001924 | |||
| 580 | Ga0466970_0041895 | |||
| 581 | Ga0466970_0089293 | |||
| 582 | Ga0466970_0095311 | |||
| 583 | Ga0466957_0009300 | |||
| 584 | Ga0466957_0036945 | |||
| 585 | Ga0466957_0073340 | |||
| 586 | Ga0466957_0123564 | |||
| 587 | Ga0466960_0003094 | |||
| 588 | Ga0466959_0001288 | |||
| 589 | Ga0466959_0016182 | |||
| 590 | Ga0466959_0088491 | |||
| 591 | Ga0466958_0017996 | |||
| 592 | Ga0466958_0020825 | |||
| 593 | Ga0466958_0043337 | |||
| 594 | Ga0466958_0164042 | |||
| 595 | Ga0466967_0002940 | |||
| 596 | Ga0466967_0004824 | |||
| 597 | Ga0466967_0049179 | |||
| 598 | Ga0466967_0077258 | |||
| 599 | Ga0495580_0063511 | |||
| 600 | Ga0495648_0021857 | |||
| 601 | Ga0495672_0000906 | |||
| 602 | Ga0495673_0000673 | |||
| 603 | Ga0496100_0323628 | |||
| 604 | Ga0496101_0001637 | |||
| 605 | Ga0496101_0085176 | |||
| 606 | Ga0496101_0090426 | |||
| 607 | Ga0496101_0346015 | |||
| 608 | Ga0496102_0000095 | |||
| 609 | Ga0496102_0004130 | |||
| 610 | Ga0496102_0007350 | |||
| 611 | Ga0496102_0059949 | |||
| 612 | Ga0496102_0094339 | |||
| 613 | Ga0496102_0126741 | |||
| 614 | Ga0496103_0000791 | |||
| 615 | Ga0496104_0007259 | |||
| 616 | Ga0496104_0156782 | |||
| 617 | Ga0496104_0259366 | |||
| 618 | Ga0496105_0006738 | |||
| 619 | Ga0496106_0022212 | |||
| 620 | Ga0496106_0270208 | |||
| 621 | Ga0496107_0011202 | |||
| 622 | Ga0496108_0074540 | |||
| 623 | Ga0496108_0180191 | |||
| 624 | Ga0496109_0001497 | |||
| 625 | Ga0496109_0002371 | |||
| 626 | Ga0496109_0085349 | |||
| 627 | Ga0496110_0024970 | |||
| 628 | Ga0496110_0026723 | |||
| 629 | Ga0496111_0005748 | |||
| 630 | Ga0496111_0146520 | |||
| 631 | Ga0496112_0018897 | |||
| 632 | Ga0496112_0104192 | |||
| 633 | Ga0496112_0171781 | |||
| 634 | Ga0496113_0012945 | |||
| 635 | Ga0496113_0014882 | |||
| 636 | Ga0496113_0086917 | |||
| 637 | Ga0496114_0030061 | |||
| 638 | Ga0496114_0276281 | |||
| 639 | Ga0496115_0079353 | |||
| 640 | Ga0496116_0022879 | |||
| 641 | Ga0496117_0051528 | |||
| 642 | Ga0496118_0003906 | |||
| 643 | Ga0496118_0005741 | |||
| 644 | Ga0496118_0039324 | |||
| 645 | Ga0496118_0050519 | |||
| 646 | Ga0496119_0013252 | |||
| 647 | Ga0496119_0056578 | |||
| 648 | Ga0496119_0060896 | |||
| 649 | Ga0496121_0001856 | |||
| 650 | Ga0496121_0079390 | |||
| 651 | Ga0496121_0104246 | |||
| 652 | Ga0496125_0101016 | |||
| 653 | Ga0496126_0001953 | |||
| 654 | Ga0496126_0039384 | |||
| 655 | Ga0501032_0003545 | |||
| 656 | Ga0501032_0004891 | |||
| 657 | Ga0501033_0022458 | |||
| 658 | Ga0501033_0023472 | |||
| 659 | Ga0501033_0153896 | |||
| 660 | Ga0501036_0097415 | |||
| 661 | Ga0501037_0110790 | |||
| 662 | Ga0501039_0026392 | |||
| 663 | Ga0501042_0013637 | |||
| 664 | Ga0501047_0008431 | |||
| 665 | Ga0501048_0000264 | |||
| 666 | Ga0501073_0138539 | |||
| 667 | Ga0501075_0138928 | |||
| 668 | Ga0501083_0000003 | |||
| 669 | Ga0501035_0004704 | |||
| 670 | Ga0501035_0047716 | |||
| 671 | Ga0501044_0065163 | |||
| 672 | nmdc:mga00v17_22869_c1 | |||
| 673 | nmdc:mga0yw44_26285_c1 | |||
| 674 | nmdc:mga0yw44_83561_c1 | |||
| 675 | nmdc:mga06z11_67886_c1 | |||
| 676 | nmdc:mga07m45_8741_c1 | |||
| 677 | nmdc:mga0qj67_106534_c1 | |||
| 678 | nmdc:mga06r32_340793_c1 | |||
| 679 | Ga0500610_0095995 | |||
| 680 | Ga0500643_005275 | |||
| 681 | Ga0500643_020112 | |||
| 682 | Ga0500642_0053039 | |||
| 683 | Ga0500652_000651 | |||
| 684 | Ga0500645_000004 | |||
| 685 | Ga0466962_0024611 | |||
| 686 | 2517763826 | |||
| 687 | 2644488453 | |||
| 688 | 2738703307 | |||
| 689 | 2739329232 | |||
| 690 | 2775657151 | |||
| 691 | 2795783012 | |||
| 692 | 2808829102 | |||
| 693 | 2808850327 | |||
| 694 | 2808898583 | |||
| 695 | 2809226652 | |||
| 696 | 2812319153 | |||
| 697 | 2852632861 | |||
| 698 | 2902795374 | |||
| 699 | 2902800308 | |||
| 700 | 2929218337 | |||
| 701 | 2939583826 | |||
| 702 | 2954002672 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7rpw-assembly1.cif.gz_E | archaeal dna ligase and heterotrimeric pcna in complex with adenylated dna | 0.7927 | 4 | 211 |
| 6p0d-assembly1.cif.gz_A | human dna ligase 1 (e346a/e592a) bound to an adenylated, hydroxyl terminated dna nick | 0.763 | 21 | 346 |
| 6p0a-assembly1.cif.gz_A | human dna ligase 1 bound to an adenylated, dideoxy terminated dna nick with 2 mm mg2+ | 0.7621 | 21 | 346 |
| 7sx5-assembly1.cif.gz_A | crystal structure of ligase i with nick duplexes containing mismatch a:c | 0.7614 | 21 | 346 |
| 6gdr-assembly1.cif.gz_A | dna binding with a minimal scaffold: structure-function analysis of lig e dna ligases | 0.7581 | 23 | 337 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_L0TDE1_8_201_3.30.470.30 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme | 0.9882 | 21 | 210 | 3.30.470.30 |
| af_L0TDE1_8_201_3.30.470.30 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme | 0.963 | 21 | 210 | 3.30.470.30 |
| af_L0TDE1_203_339_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9126 | 213 | 347 | 2.40.50.140 |
| af_P9WNV5_183_380_3.30.470.30 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme | 0.9007 | 21 | 210 | 3.30.470.30 |
| 4eq5A02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme | 0.8982 | 21 | 209 | 3.30.470.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5P5M4-F1-model_v4 | deleted | 0.9872 | 14 | 201 |
|
| AF-A0A7Y5P5M4-F1-model_v4 | deleted | 0.982 | 14 | 201 |
|
| AF-A0A2V8CDT1-F1-model_v4 | ATP-dependent DNA ligase | 0.9718 | 13 | 171 |
GO:0003910
GO:0005524 GO:0006281 GO:0006310 |
| AF-A0A351EUR7-F1-model_v4 | ATP-dependent DNA ligase | 0.9712 | 25 | 136 |
GO:0003910
GO:0005524 GO:0006281 GO:0006310 |
| AF-A0A534R9J8-F1-model_v4 | ATP-dependent DNA ligase | 0.9706 | 40 | 156 |
GO:0003910
GO:0005524 GO:0006281 GO:0006310 |