F418474

General Info

Members Datasets Scaffolds Average Seq Length
351 216 702 353

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10019315|JGI24737J22298_100193152
Length 367
Sequence MPTRLGALGQNWLMQLPVMPPVPPMLAKSVSAIPPGASYEPKWDGFRSICFRDGDEVELGSRNERPMTRYFPELVAAIKAELPQRCVIDGEIVIATPGGLDFEALQQRIHPADSRVRLLAQQTPASFIAFDLLALGDDDLTKRPFAERRAALVDALAGAGPSVHLTPATADLAEAQRWFTEFEGAGLDGVVAKPLDGTYQPDKRVMFKIKHERTADCVVGGYRVHKSGPDAVGSLMLGLYRGDTLVSVGVIGAFPMQRRRELFTELQPLVTDFEGHPWDWAAHLAGERTPRKGEGSRWNAGKDLSFVPLRPELVVEVRYDHMEGERFRHTAQFNRWRPDRTPESCTYEQLEQPVTFSLGEIVPGLGT

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
126 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
127 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
128 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
129 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
130 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
131 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
132 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
133 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
151 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
195 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
196 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
197 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
198 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
200 2517572101 Frankia sp. DC12 Isolate Nodule
201 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
202 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
203 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
204 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
205 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
206 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
207 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
208 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
209 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
210 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
211 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
212 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
213 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
214 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
215 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
216 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.87
Metatranscriptomes 0.28
Isolates 4.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.41
Nodule 0.28
Rhizoplane 10.54
Rhizosphere 73.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10019315 3300001990 Bacteria 2180
2 JGI24735J21928_10009706 3300002067 Bacteria 3083
3 Ga0055540_1004054 3300003792 Bacteria 6805
4 Ga0068869_100146229 3300005334 Bacteria 1829
5 Ga0070682_100032737 3300005337 Bacteria 3154
6 Ga0068868_100100344 3300005338 Bacteria 2342
7 Ga0070687_100027208 3300005343 Bacteria 2760
8 Ga0070661_100090697 3300005344 Bacteria 2263
9 Ga0070671_100115702 3300005355 Bacteria 2255
10 Ga0070674_100033480 3300005356 Bacteria 3421
11 Ga0070673_100081387 3300005364 Bacteria 2626
12 Ga0070688_100091048 3300005365 Bacteria 1993
13 Ga0070659_100186765 3300005366 Bacteria 1702
14 Ga0070667_100031980 3300005367 Bacteria 4387
15 Ga0070667_100096300 3300005367 Bacteria 2552
16 Ga0070667_100299550 3300005367 Bacteria 1447
17 Ga0070714_100000006 3300005435 Bacteria 293311
18 Ga0070701_10166004 3300005438 Bacteria 1282
19 Ga0070700_100000011 3300005441 Bacteria 173076
20 Ga0070663_100042515 3300005455 Bacteria 3193
21 Ga0070678_100016504 3300005456 Bacteria 4727
22 Ga0070706_100082344 3300005467 Bacteria 2981
23 Ga0070684_100120063 3300005535 Bacteria 2364
24 Ga0070672_100178944 3300005543 Bacteria 1766
25 Ga0070665_100022993 3300005548 Bacteria 6276
26 Ga0068855_100014820 3300005563 Bacteria 9388
27 Ga0070664_100366624 3300005564 Bacteria 1312
28 Ga0068856_100059095 3300005614 Bacteria 3787
29 Ga0068856_100078436 3300005614 Bacteria 3274
30 Ga0070702_100032304 3300005615 Bacteria 2871
31 Ga0068859_100013272 3300005617 Bacteria 8265
32 Ga0068859_100028595 3300005617 Bacteria 5589
33 Ga0068864_100109738 3300005618 Bacteria 2456
34 Ga0068870_10088672 3300005840 Bacteria 1725
35 Ga0068863_100000496 3300005841 Bacteria 39941
36 Ga0068858_100086316 3300005842 Bacteria 2919
37 Ga0068858_100104606 3300005842 Bacteria 2641
38 Ga0068860_100277985 3300005843 Bacteria 1635
39 Ga0068862_100027176 3300005844 Bacteria 4815
40 Ga0068862_100149141 3300005844 Bacteria 2081
41 Ga0081455_10001039 3300005937 Bacteria 35032
42 Ga0081455_10007057 3300005937 Bacteria 11924
43 Ga0081455_10010526 3300005937 Bacteria 9374
44 Ga0081455_10019609 3300005937 Bacteria 6390
45 Ga0081455_10070785 3300005937 Bacteria 2894
46 Ga0081455_10120076 3300005937 Bacteria 2072
47 Ga0081540_1001394 3300005983 Bacteria 20936
48 Ga0075365_10040331 3300006038 Bacteria 3045
49 Ga0075365_10048531 3300006038 Bacteria 2795
50 Ga0075365_10130257 3300006038 Bacteria 1741
51 Ga0070716_100001757 3300006173 Bacteria 9795
52 Ga0075369_10035046 3300006186 Bacteria 2132
53 Ga0075370_10015466 3300006353 Bacteria 4086
54 Ga0097620_100013272 3300006931 Bacteria 8265
55 Ga0097620_100028595 3300006931 Bacteria 5589
56 Ga0105240_10015550 3300009093 Bacteria 10342
57 Ga0105240_10277990 3300009093 Bacteria 1924
58 Ga0105245_10289439 3300009098 Bacteria 1604
59 Ga0105247_10000046 3300009101 Bacteria 151843
60 Ga0105247_10001542 3300009101 Bacteria 16439
61 Ga0105247_10011635 3300009101 Bacteria 5301
62 Ga0105247_10037551 3300009101 Bacteria 2955
63 Ga0105247_10054211 3300009101 Bacteria 2475
64 Ga0105243_10065858 3300009148 Bacteria 2912
65 Ga0105243_10102534 3300009148 Bacteria 2378
66 Ga0105241_10148371 3300009174 Bacteria 1916
67 Ga0105242_10231994 3300009176 Bacteria 1654
68 Ga0105248_10000153 3300009177 Bacteria 80607
69 Ga0105237_10005091 3300009545 Bacteria 14927
70 Ga0105237_10017843 3300009545 Bacteria 7357
71 Ga0105237_10098309 3300009545 Bacteria 2918
72 Ga0105238_10509453 3300009551 Bacteria 1205
73 Ga0105249_10009825 3300009553 Bacteria 8385
74 Ga0105249_10019476 3300009553 Bacteria 6055
75 Ga0105239_10003727 3300010375 Bacteria 18549
76 Ga0105239_10090112 3300010375 Bacteria 3383
77 Ga0105239_10091477 3300010375 Bacteria 3357
78 Ga0105246_10272037 3300011119 Bacteria 1355
79 Ga0157370_10019589 3300013104 Bacteria 6780
80 Ga0157369_10026195 3300013105 Bacteria 6470
81 Ga0157369_10054587 3300013105 Bacteria 4315
82 Ga0157374_10015545 3300013296 Bacteria 6677
83 Ga0157374_10175376 3300013296 Bacteria 2092
84 Ga0157378_10028101 3300013297 Bacteria 4961
85 Ga0157378_10061131 3300013297 Bacteria 3361
86 Ga0157378_10166330 3300013297 Bacteria 2066
87 Ga0163162_10146794 3300013306 Bacteria 2475
88 Ga0163162_10175860 3300013306 Bacteria 2266
89 Ga0157372_10000022 3300013307 Bacteria 206038
90 Ga0157372_10038611 3300013307 Bacteria 5269
91 Ga0157372_10067771 3300013307 Bacteria 4011
92 Ga0157372_10521137 3300013307 Bacteria 1386
93 Ga0157375_10025245 3300013308 Bacteria 5517
94 Ga0157375_10197092 3300013308 Bacteria 2169
95 Ga0163163_10585351 3300014325 Bacteria 1179
96 Ga0157377_10016380 3300014745 Bacteria 3813
97 Ga0157379_10012655 3300014968 Bacteria 7374
98 Ga0163161_10009471 3300017792 Bacteria 6741
99 Ga0206353_10697503 3300020082 Bacteria 3206
100 Ga0213876_10011043 3300021384 Bacteria 4834
101 Ga0213876_10040612 3300021384 Bacteria 2458
102 Ga0213876_10045291 3300021384 Bacteria 2327
103 Ga0213875_10068507 3300021388 Bacteria 1657
104 Ga0209051_1000750 3300025303 Bacteria 34899
105 Ga0209051_1015414 3300025303 Bacteria 3515
106 Ga0207710_10000071 3300025900 Bacteria 151859
107 Ga0207710_10000146 3300025900 Bacteria 80814
108 Ga0207710_10018522 3300025900 Bacteria 2962
109 Ga0207688_10001523 3300025901 Bacteria 12166
110 Ga0207688_10013099 3300025901 Bacteria 4507
111 Ga0207647_10082486 3300025904 Bacteria 1926
112 Ga0207643_10017425 3300025908 Bacteria 3928
113 Ga0207705_10213847 3300025909 Bacteria 1462
114 Ga0207695_10015740 3300025913 Bacteria 8892
115 Ga0207671_10001867 3300025914 Bacteria 23470
116 Ga0207671_10089187 3300025914 Bacteria 2321
117 Ga0207671_10115070 3300025914 Bacteria 2050
118 Ga0207693_10001955 3300025915 Bacteria 18066
119 Ga0207660_10228173 3300025917 Bacteria 1463
120 Ga0207662_10031703 3300025918 Bacteria 3071
121 Ga0207657_10020351 3300025919 Bacteria 6272
122 Ga0207652_10049228 3300025921 Bacteria 3607
123 Ga0207681_10001078 3300025923 Bacteria 17698
124 Ga0207681_10089982 3300025923 Bacteria 2190
125 Ga0207687_10097393 3300025927 Bacteria 2158
126 Ga0207700_10172219 3300025928 Bacteria 1807
127 Ga0207664_10000032 3300025929 Bacteria 179232
128 Ga0207644_10150709 3300025931 Bacteria 1799
129 Ga0207690_10118831 3300025932 Bacteria 1916
130 Ga0207706_10049286 3300025933 Bacteria 3722
131 Ga0207709_10292143 3300025935 Bacteria 1208
132 Ga0207670_10034836 3300025936 Bacteria 3259
133 Ga0207665_10082155 3300025939 Bacteria 2220
134 Ga0207691_10126170 3300025940 Bacteria 2264
135 Ga0207711_10000923 3300025941 Bacteria 28332
136 Ga0207711_10026191 3300025941 Bacteria 4892
137 Ga0207689_10005173 3300025942 Bacteria 11718
138 Ga0207689_10059598 3300025942 Bacteria 3139
139 Ga0207667_10010916 3300025949 Bacteria 10586
140 Ga0207667_10062852 3300025949 Bacteria 3881
141 Ga0207658_10047160 3300025986 Bacteria 3152
142 Ga0207703_10000036 3300026035 Bacteria 181013
143 Ga0207703_10155119 3300026035 Bacteria 2000
144 Ga0207678_10105598 3300026067 Bacteria 2403
145 Ga0207708_10000009 3300026075 Bacteria 235909
146 Ga0207708_10070871 3300026075 Bacteria 2669
147 Ga0207702_10044172 3300026078 Bacteria 3745
148 Ga0207641_10000643 3300026088 Bacteria 38084
149 Ga0207641_10015657 3300026088 Bacteria 6215
150 Ga0207648_10007446 3300026089 Bacteria 10762
151 Ga0207675_100014457 3300026118 Bacteria 7359
152 Ga0207675_100035394 3300026118 Bacteria 4658
153 Ga0207683_10030206 3300026121 Bacteria 4695
154 Ga0207683_10096459 3300026121 Bacteria 2636
155 Ga0207683_10143995 3300026121 Bacteria 2148
156 Ga0207683_10348914 3300026121 Bacteria 1358
157 Ga0307513_10007060 3300031456 Bacteria 14600
158 Ga0307408_100004469 3300031548 Bacteria 9491
159 Ga0307408_100045079 3300031548 Bacteria 3147
160 Ga0307408_100085007 3300031548 Bacteria 2374
161 Ga0307405_10009647 3300031731 Bacteria 4958
162 Ga0307405_10076439 3300031731 Bacteria 2172
163 Ga0307405_10100384 3300031731 Bacteria 1939
164 Ga0307413_10015892 3300031824 Bacteria 3871
165 Ga0307413_10058990 3300031824 Bacteria 2356
166 Ga0307410_10014348 3300031852 Bacteria 4659
167 Ga0307410_10025366 3300031852 Bacteria 3718
168 Ga0307407_10012791 3300031903 Bacteria 4049
169 Ga0307407_10097615 3300031903 Bacteria 1816
170 Ga0307412_10003312 3300031911 Bacteria 8943
171 Ga0307412_10007510 3300031911 Bacteria 6189
172 Ga0307412_10059334 3300031911 Bacteria 2563
173 Ga0307412_10064354 3300031911 Bacteria 2477
174 Ga0307412_10098234 3300031911 Bacteria 2064
175 Ga0307409_100019236 3300031995 Bacteria 4617
176 Ga0307409_100036618 3300031995 Bacteria 3609
177 Ga0307416_100017671 3300032002 Bacteria 4999
178 Ga0307416_100018984 3300032002 Bacteria 4861
179 Ga0307416_100106291 3300032002 Bacteria 2459
180 Ga0307416_100242790 3300032002 Bacteria 1746
181 Ga0307416_100323845 3300032002 Bacteria 1545
182 Ga0307416_100335500 3300032002 Bacteria 1522
183 Ga0307414_10002589 3300032004 Bacteria 9516
184 Ga0307414_10143092 3300032004 Bacteria 1875
185 Ga0307414_10199019 3300032004 Bacteria 1628
186 Ga0307411_10051359 3300032005 Bacteria 2689
187 Ga0307415_100010874 3300032126 Bacteria 5175
188 Ga0307415_100205420 3300032126 Bacteria 1567
189 Ga0373956_0002130 3300035119 Bacteria 8197
190 Ga0373927_0066879 3300035695 Bacteria 2325
191 Ga0373933_0116376 3300035724 Bacteria 1671
192 Ga0395900_0033940 3300037418 Bacteria 5252
193 Ga0395898_0096954 3300037466 Bacteria 2832
194 Ga0436364_1376393 3300037853 Bacteria 2426
195 Ga0395901_0038530 3300038443 Bacteria 4945
196 Ga0436365_0158682 3300039437 Bacteria 4834
197 Ga0436365_0955489 3300039437 Bacteria 8665
198 Ga0436365_1591167 3300039437 Bacteria 2296
199 Ga0436363_0523583 3300039450 Bacteria 3727
200 Ga0439466_0006026 3300041411 Bacteria 4615
201 Ga0439466_0046258 3300041411 Bacteria 1438
202 Ga0439466_0057108 3300041411 Bacteria 1265
203 Ga0439465_0022912 3300041413 Bacteria 1963
204 Ga0439433_0004524 3300041999 Bacteria 2994
205 Ga0439442_001207 3300042002 Bacteria 5143
206 Ga0439432_006810 3300042006 Bacteria 4069
207 Ga0439449_0002528 3300042007 Bacteria 7148
208 Ga0450920_000171 3300042122 Bacteria 9136
209 Ga0450907_000292 3300042146 Bacteria 16874
210 Ga0439434_0000012 3300042435 Bacteria 46644
211 Ga0466969_0031215 3300044656 Bacteria 2713
212 Ga0466972_0005580 3300044658 Bacteria 6302
213 Ga0466972_0047246 3300044658 Bacteria 2082
214 Ga0466972_0104689 3300044658 Bacteria 1338
215 Ga0466966_0009545 3300044684 Bacteria 6422
216 Ga0466966_0009627 3300044684 Bacteria 6395
217 Ga0466966_0030718 3300044684 Bacteria 3485
218 Ga0466966_0063538 3300044684 Bacteria 2326
219 Ga0466966_0103490 3300044684 Bacteria 1760
220 Ga0466966_0132603 3300044684 Bacteria 1525
221 Ga0466961_0045087 3300044693 Bacteria 2822
222 Ga0466961_0068218 3300044693 Bacteria 2258
223 Ga0466963_0011211 3300044694 Bacteria 5455
224 Ga0466963_0093846 3300044694 Bacteria 2046
225 Ga0466964_0025618 3300044706 Bacteria 2304
226 Ga0466971_0016342 3300044719 Bacteria 3274
227 Ga0466968_0008622 3300044735 Bacteria 3907
228 Ga0466970_0001924 3300044765 Bacteria 10040
229 Ga0466970_0041895 3300044765 Bacteria 2434
230 Ga0466970_0089293 3300044765 Bacteria 1672
231 Ga0466970_0095311 3300044765 Bacteria 1618
232 Ga0466957_0009300 3300044842 Bacteria 5607
233 Ga0466957_0036945 3300044842 Bacteria 2939
234 Ga0466957_0073340 3300044842 Bacteria 2121
235 Ga0466957_0123564 3300044842 Bacteria 1652
236 Ga0466960_0003094 3300044901 Bacteria 6366
237 Ga0466959_0001288 3300045049 Bacteria 15176
238 Ga0466959_0016182 3300045049 Bacteria 5445
239 Ga0466959_0088491 3300045049 Bacteria 2226
240 Ga0466958_0017996 3300045836 Bacteria 4096
241 Ga0466958_0020825 3300045836 Bacteria 3827
242 Ga0466958_0043337 3300045836 Bacteria 2710
243 Ga0466958_0164042 3300045836 Bacteria 1405
244 Ga0466967_0002940 3300045976 Bacteria 10875
245 Ga0466967_0004824 3300045976 Bacteria 9194
246 Ga0466967_0049179 3300045976 Bacteria 3686
247 Ga0466967_0077258 3300045976 Bacteria 2997
248 Ga0495580_0063511 3300046472 Bacteria 2589
249 Ga0495648_0021857 3300046524 Bacteria 4418
250 Ga0495672_0000906 3300047320 Bacteria 31047
251 Ga0495673_0000673 3300047469 Bacteria 33572
252 Ga0496100_0323628 3300048903 Bacteria 1159
253 Ga0496101_0001637 3300048904 Bacteria 13428
254 Ga0496101_0085176 3300048904 Bacteria 2341
255 Ga0496101_0090426 3300048904 Bacteria 2277
256 Ga0496101_0346015 3300048904 Bacteria 1168
257 Ga0496102_0000095 3300048905 Bacteria 124981
258 Ga0496102_0004130 3300048905 Bacteria 12310
259 Ga0496102_0007350 3300048905 Bacteria 9410
260 Ga0496102_0059949 3300048905 Bacteria 3481
261 Ga0496102_0094339 3300048905 Bacteria 2773
262 Ga0496102_0126741 3300048905 Bacteria 2387
263 Ga0496103_0000791 3300048906 Bacteria 23282
264 Ga0496104_0007259 3300048907 Bacteria 9779
265 Ga0496104_0156782 3300048907 Bacteria 2185
266 Ga0496104_0259366 3300048907 Bacteria 1651
267 Ga0496105_0006738 3300048908 Bacteria 8833
268 Ga0496106_0022212 3300048909 Bacteria 4712
269 Ga0496106_0270208 3300048909 Bacteria 1361
270 Ga0496107_0011202 3300048910 Bacteria 6242
271 Ga0496108_0074540 3300048911 Bacteria 2865
272 Ga0496108_0180191 3300048911 Bacteria 1829
273 Ga0496109_0001497 3300048912 Bacteria 19409
274 Ga0496109_0002371 3300048912 Bacteria 15734
275 Ga0496109_0085349 3300048912 Bacteria 2914
276 Ga0496110_0024970 3300048913 Bacteria 5101
277 Ga0496110_0026723 3300048913 Bacteria 4943
278 Ga0496111_0005748 3300048914 Bacteria 8002
279 Ga0496111_0146520 3300048914 Bacteria 1751
280 Ga0496112_0018897 3300048915 Bacteria 6493
281 Ga0496112_0104192 3300048915 Bacteria 2807
282 Ga0496112_0171781 3300048915 Bacteria 2133
283 Ga0496113_0012945 3300048916 Bacteria 5627
284 Ga0496113_0014882 3300048916 Bacteria 5324
285 Ga0496113_0086917 3300048916 Bacteria 2403
286 Ga0496114_0030061 3300048917 Bacteria 4467
287 Ga0496114_0276281 3300048917 Bacteria 1481
288 Ga0496115_0079353 3300048918 Bacteria 2671
289 Ga0496116_0022879 3300048919 Bacteria 4667
290 Ga0496117_0051528 3300048920 Bacteria 2909
291 Ga0496118_0003906 3300048921 Bacteria 18249
292 Ga0496118_0005741 3300048921 Bacteria 13957
293 Ga0496118_0039324 3300048921 Bacteria 3776
294 Ga0496118_0050519 3300048921 Bacteria 3190
295 Ga0496119_0013252 3300048922 Bacteria 6590
296 Ga0496119_0056578 3300048922 Bacteria 2376
297 Ga0496119_0060896 3300048922 Bacteria 2257
298 Ga0496121_0001856 3300048924 Bacteria 33927
299 Ga0496121_0079390 3300048924 Bacteria 2605
300 Ga0496121_0104246 3300048924 Bacteria 2180
301 Ga0496125_0101016 3300048928 Bacteria 2124
302 Ga0496126_0001953 3300048929 Bacteria 29245
303 Ga0496126_0039384 3300048929 Bacteria 4386
304 Ga0501032_0003545 3300049569 Bacteria 11908
305 Ga0501032_0004891 3300049569 Bacteria 10028
306 Ga0501033_0022458 3300049570 Bacteria 4760
307 Ga0501033_0023472 3300049570 Bacteria 4651
308 Ga0501033_0153896 3300049570 Bacteria 1658
309 Ga0501036_0097415 3300049572 Bacteria 2486
310 Ga0501037_0110790 3300049573 Bacteria 1977
311 Ga0501039_0026392 3300049575 Bacteria 4463
312 Ga0501042_0013637 3300049578 Bacteria 5534
313 Ga0501047_0008431 3300049581 Bacteria 9724
314 Ga0501048_0000264 3300049582 Bacteria 35134
315 Ga0501073_0138539 3300049589 Bacteria 1686
316 Ga0501075_0138928 3300049591 Bacteria 1851
317 Ga0501083_0000003 3300049744 Bacteria 235949
318 Ga0501035_0004704 3300049822 Bacteria 12963
319 Ga0501035_0047716 3300049822 Bacteria 3843
320 Ga0501044_0065163 3300049823 Bacteria 3716
321 nmdc:mga00v17_22869_c1 3300050491 Bacteria 3612
322 nmdc:mga0yw44_26285_c1 3300050492 Bacteria 3323
323 nmdc:mga0yw44_83561_c1 3300050492 Bacteria 2006
324 nmdc:mga06z11_67886_c1 3300050494 Bacteria 1878
325 nmdc:mga07m45_8741_c1 3300050496 Bacteria 5220
326 nmdc:mga0qj67_106534_c1 3300050509 Bacteria 2261
327 nmdc:mga06r32_340793_c1 3300050510 Bacteria 1484
328 Ga0500610_0095995 3300053079 Bacteria 1537
329 Ga0500643_005275 3300053087 Bacteria 5607
330 Ga0500643_020112 3300053087 Bacteria 2188
331 Ga0500642_0053039 3300053130 Bacteria 1797
332 Ga0500652_000651 3300053131 Bacteria 11825
333 Ga0500645_000004 3300053730 Bacteria 305014
334 Ga0466962_0024611 3300061719 Bacteria 2891
335 2517763826 2517572101 Bacteria 6884336
336 2644488453 2643221687 Bacteria 6500351
337 2738703307 2738541274 Bacteria 6909446
338 2739329232 2738543028 Bacteria 6917070
339 2775657151 2775506735 Bacteria 4556596
340 2795783012 2795385470 Bacteria 8317180
341 2808829102 2808606357 Bacteria 4466944
342 2808850327 2808606360 Bacteria 4404006
343 2808898583 2808606371 Bacteria 4251511
344 2809226652 2808606447 Bacteria 3572005
345 2812319153 2811994871 Bacteria 4497550
346 2852632861 2852632344 Bacteria 3463163
347 2902795374 2902792274 Bacteria 7270173
348 2902800308 2902799365 Bacteria 5419524
349 2929218337 2929212328 Bacteria 7708288
350 2939583826 2939582691 Bacteria 7088898
351 2954002672 2953998280 Bacteria 4812144
352 JGI24737J22298_10019315
353 JGI24735J21928_10009706
354 Ga0055540_1004054
355 Ga0068869_100146229
356 Ga0070682_100032737
357 Ga0068868_100100344
358 Ga0070687_100027208
359 Ga0070661_100090697
360 Ga0070671_100115702
361 Ga0070674_100033480
362 Ga0070673_100081387
363 Ga0070688_100091048
364 Ga0070659_100186765
365 Ga0070667_100031980
366 Ga0070667_100096300
367 Ga0070667_100299550
368 Ga0070714_100000006
369 Ga0070701_10166004
370 Ga0070700_100000011
371 Ga0070663_100042515
372 Ga0070678_100016504
373 Ga0070706_100082344
374 Ga0070684_100120063
375 Ga0070672_100178944
376 Ga0070665_100022993
377 Ga0068855_100014820
378 Ga0070664_100366624
379 Ga0068856_100059095
380 Ga0068856_100078436
381 Ga0070702_100032304
382 Ga0068859_100013272
383 Ga0068859_100028595
384 Ga0068864_100109738
385 Ga0068870_10088672
386 Ga0068863_100000496
387 Ga0068858_100086316
388 Ga0068858_100104606
389 Ga0068860_100277985
390 Ga0068862_100027176
391 Ga0068862_100149141
392 Ga0081455_10001039
393 Ga0081455_10007057
394 Ga0081455_10010526
395 Ga0081455_10019609
396 Ga0081455_10070785
397 Ga0081455_10120076
398 Ga0081540_1001394
399 Ga0075365_10040331
400 Ga0075365_10048531
401 Ga0075365_10130257
402 Ga0070716_100001757
403 Ga0075369_10035046
404 Ga0075370_10015466
405 Ga0097620_100013272
406 Ga0097620_100028595
407 Ga0105240_10015550
408 Ga0105240_10277990
409 Ga0105245_10289439
410 Ga0105247_10000046
411 Ga0105247_10001542
412 Ga0105247_10011635
413 Ga0105247_10037551
414 Ga0105247_10054211
415 Ga0105243_10065858
416 Ga0105243_10102534
417 Ga0105241_10148371
418 Ga0105242_10231994
419 Ga0105248_10000153
420 Ga0105237_10005091
421 Ga0105237_10017843
422 Ga0105237_10098309
423 Ga0105238_10509453
424 Ga0105249_10009825
425 Ga0105249_10019476
426 Ga0105239_10003727
427 Ga0105239_10090112
428 Ga0105239_10091477
429 Ga0105246_10272037
430 Ga0157370_10019589
431 Ga0157369_10026195
432 Ga0157369_10054587
433 Ga0157374_10015545
434 Ga0157374_10175376
435 Ga0157378_10028101
436 Ga0157378_10061131
437 Ga0157378_10166330
438 Ga0163162_10146794
439 Ga0163162_10175860
440 Ga0157372_10000022
441 Ga0157372_10038611
442 Ga0157372_10067771
443 Ga0157372_10521137
444 Ga0157375_10025245
445 Ga0157375_10197092
446 Ga0163163_10585351
447 Ga0157377_10016380
448 Ga0157379_10012655
449 Ga0163161_10009471
450 Ga0206353_10697503
451 Ga0213876_10011043
452 Ga0213876_10040612
453 Ga0213876_10045291
454 Ga0213875_10068507
455 Ga0209051_1000750
456 Ga0209051_1015414
457 Ga0207710_10000071
458 Ga0207710_10000146
459 Ga0207710_10018522
460 Ga0207688_10001523
461 Ga0207688_10013099
462 Ga0207647_10082486
463 Ga0207643_10017425
464 Ga0207705_10213847
465 Ga0207695_10015740
466 Ga0207671_10001867
467 Ga0207671_10089187
468 Ga0207671_10115070
469 Ga0207693_10001955
470 Ga0207660_10228173
471 Ga0207662_10031703
472 Ga0207657_10020351
473 Ga0207652_10049228
474 Ga0207681_10001078
475 Ga0207681_10089982
476 Ga0207687_10097393
477 Ga0207700_10172219
478 Ga0207664_10000032
479 Ga0207644_10150709
480 Ga0207690_10118831
481 Ga0207706_10049286
482 Ga0207709_10292143
483 Ga0207670_10034836
484 Ga0207665_10082155
485 Ga0207691_10126170
486 Ga0207711_10000923
487 Ga0207711_10026191
488 Ga0207689_10005173
489 Ga0207689_10059598
490 Ga0207667_10010916
491 Ga0207667_10062852
492 Ga0207658_10047160
493 Ga0207703_10000036
494 Ga0207703_10155119
495 Ga0207678_10105598
496 Ga0207708_10000009
497 Ga0207708_10070871
498 Ga0207702_10044172
499 Ga0207641_10000643
500 Ga0207641_10015657
501 Ga0207648_10007446
502 Ga0207675_100014457
503 Ga0207675_100035394
504 Ga0207683_10030206
505 Ga0207683_10096459
506 Ga0207683_10143995
507 Ga0207683_10348914
508 Ga0307513_10007060
509 Ga0307408_100004469
510 Ga0307408_100045079
511 Ga0307408_100085007
512 Ga0307405_10009647
513 Ga0307405_10076439
514 Ga0307405_10100384
515 Ga0307413_10015892
516 Ga0307413_10058990
517 Ga0307410_10014348
518 Ga0307410_10025366
519 Ga0307407_10012791
520 Ga0307407_10097615
521 Ga0307412_10003312
522 Ga0307412_10007510
523 Ga0307412_10059334
524 Ga0307412_10064354
525 Ga0307412_10098234
526 Ga0307409_100019236
527 Ga0307409_100036618
528 Ga0307416_100017671
529 Ga0307416_100018984
530 Ga0307416_100106291
531 Ga0307416_100242790
532 Ga0307416_100323845
533 Ga0307416_100335500
534 Ga0307414_10002589
535 Ga0307414_10143092
536 Ga0307414_10199019
537 Ga0307411_10051359
538 Ga0307415_100010874
539 Ga0307415_100205420
540 Ga0373956_0002130
541 Ga0373927_0066879
542 Ga0373933_0116376
543 Ga0395900_0033940
544 Ga0395898_0096954
545 Ga0436364_1376393
546 Ga0395901_0038530
547 Ga0436365_0158682
548 Ga0436365_0955489
549 Ga0436365_1591167
550 Ga0436363_0523583
551 Ga0439466_0006026
552 Ga0439466_0046258
553 Ga0439466_0057108
554 Ga0439465_0022912
555 Ga0439433_0004524
556 Ga0439442_001207
557 Ga0439432_006810
558 Ga0439449_0002528
559 Ga0450920_000171
560 Ga0450907_000292
561 Ga0439434_0000012
562 Ga0466969_0031215
563 Ga0466972_0005580
564 Ga0466972_0047246
565 Ga0466972_0104689
566 Ga0466966_0009545
567 Ga0466966_0009627
568 Ga0466966_0030718
569 Ga0466966_0063538
570 Ga0466966_0103490
571 Ga0466966_0132603
572 Ga0466961_0045087
573 Ga0466961_0068218
574 Ga0466963_0011211
575 Ga0466963_0093846
576 Ga0466964_0025618
577 Ga0466971_0016342
578 Ga0466968_0008622
579 Ga0466970_0001924
580 Ga0466970_0041895
581 Ga0466970_0089293
582 Ga0466970_0095311
583 Ga0466957_0009300
584 Ga0466957_0036945
585 Ga0466957_0073340
586 Ga0466957_0123564
587 Ga0466960_0003094
588 Ga0466959_0001288
589 Ga0466959_0016182
590 Ga0466959_0088491
591 Ga0466958_0017996
592 Ga0466958_0020825
593 Ga0466958_0043337
594 Ga0466958_0164042
595 Ga0466967_0002940
596 Ga0466967_0004824
597 Ga0466967_0049179
598 Ga0466967_0077258
599 Ga0495580_0063511
600 Ga0495648_0021857
601 Ga0495672_0000906
602 Ga0495673_0000673
603 Ga0496100_0323628
604 Ga0496101_0001637
605 Ga0496101_0085176
606 Ga0496101_0090426
607 Ga0496101_0346015
608 Ga0496102_0000095
609 Ga0496102_0004130
610 Ga0496102_0007350
611 Ga0496102_0059949
612 Ga0496102_0094339
613 Ga0496102_0126741
614 Ga0496103_0000791
615 Ga0496104_0007259
616 Ga0496104_0156782
617 Ga0496104_0259366
618 Ga0496105_0006738
619 Ga0496106_0022212
620 Ga0496106_0270208
621 Ga0496107_0011202
622 Ga0496108_0074540
623 Ga0496108_0180191
624 Ga0496109_0001497
625 Ga0496109_0002371
626 Ga0496109_0085349
627 Ga0496110_0024970
628 Ga0496110_0026723
629 Ga0496111_0005748
630 Ga0496111_0146520
631 Ga0496112_0018897
632 Ga0496112_0104192
633 Ga0496112_0171781
634 Ga0496113_0012945
635 Ga0496113_0014882
636 Ga0496113_0086917
637 Ga0496114_0030061
638 Ga0496114_0276281
639 Ga0496115_0079353
640 Ga0496116_0022879
641 Ga0496117_0051528
642 Ga0496118_0003906
643 Ga0496118_0005741
644 Ga0496118_0039324
645 Ga0496118_0050519
646 Ga0496119_0013252
647 Ga0496119_0056578
648 Ga0496119_0060896
649 Ga0496121_0001856
650 Ga0496121_0079390
651 Ga0496121_0104246
652 Ga0496125_0101016
653 Ga0496126_0001953
654 Ga0496126_0039384
655 Ga0501032_0003545
656 Ga0501032_0004891
657 Ga0501033_0022458
658 Ga0501033_0023472
659 Ga0501033_0153896
660 Ga0501036_0097415
661 Ga0501037_0110790
662 Ga0501039_0026392
663 Ga0501042_0013637
664 Ga0501047_0008431
665 Ga0501048_0000264
666 Ga0501073_0138539
667 Ga0501075_0138928
668 Ga0501083_0000003
669 Ga0501035_0004704
670 Ga0501035_0047716
671 Ga0501044_0065163
672 nmdc:mga00v17_22869_c1
673 nmdc:mga0yw44_26285_c1
674 nmdc:mga0yw44_83561_c1
675 nmdc:mga06z11_67886_c1
676 nmdc:mga07m45_8741_c1
677 nmdc:mga0qj67_106534_c1
678 nmdc:mga06r32_340793_c1
679 Ga0500610_0095995
680 Ga0500643_005275
681 Ga0500643_020112
682 Ga0500642_0053039
683 Ga0500652_000651
684 Ga0500645_000004
685 Ga0466962_0024611
686 2517763826
687 2644488453
688 2738703307
689 2739329232
690 2775657151
691 2795783012
692 2808829102
693 2808850327
694 2808898583
695 2809226652
696 2812319153
697 2852632861
698 2902795374
699 2902800308
700 2929218337
701 2939583826
702 2954002672

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01068

DNA_ligase_A_M

ATP dependent DNA ligase domain

24

210

0.95

PF04679

DNA_ligase_A_C

ATP dependent DNA ligase C terminal region

228

340

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rpw-assembly1.cif.gz_E archaeal dna ligase and heterotrimeric pcna in complex with adenylated dna 0.7927 4 211
6p0d-assembly1.cif.gz_A human dna ligase 1 (e346a/e592a) bound to an adenylated, hydroxyl terminated dna nick 0.763 21 346
6p0a-assembly1.cif.gz_A human dna ligase 1 bound to an adenylated, dideoxy terminated dna nick with 2 mm mg2+ 0.7621 21 346
7sx5-assembly1.cif.gz_A crystal structure of ligase i with nick duplexes containing mismatch a:c 0.7614 21 346
6gdr-assembly1.cif.gz_A dna binding with a minimal scaffold: structure-function analysis of lig e dna ligases 0.7581 23 337
ID Description Score Start End Superfamily
af_L0TDE1_8_201_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.9882 21 210 3.30.470.30
af_L0TDE1_8_201_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.963 21 210 3.30.470.30
af_L0TDE1_203_339_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9126 213 347 2.40.50.140
af_P9WNV5_183_380_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.9007 21 210 3.30.470.30
4eq5A02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.8982 21 209 3.30.470.30
ID Description Score Start End GO Terms
AF-A0A7Y5P5M4-F1-model_v4 deleted 0.9872 14 201
AF-A0A7Y5P5M4-F1-model_v4 deleted 0.982 14 201
AF-A0A2V8CDT1-F1-model_v4 ATP-dependent DNA ligase 0.9718 13 171 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-A0A351EUR7-F1-model_v4 ATP-dependent DNA ligase 0.9712 25 136 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-A0A534R9J8-F1-model_v4 ATP-dependent DNA ligase 0.9706 40 156 GO:0003910
GO:0005524
GO:0006281
GO:0006310

Map