F418481

General Info

Members Datasets Scaffolds Average Seq Length
351 206 702 139

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10079691|JGI25153J46596_100796912
Length 148
Sequence MRPGFGDAYMPTPSPEIQAFAAGFPVFLAHAGVTVVILFAAAALYVLLTPHKEITLIREGNTAAAVSLGGVLLGLAIPLSASLRASTNVIEIGLWGAVTVVVQLLVFRLVDMLLRGLPKRIQDGEVSAAALLVGAKIATALIIAAARS

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
61 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
106 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
128 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
129 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
138 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
139 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
140 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
151 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
152 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
169 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
172 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
173 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
174 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
175 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
176 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
177 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
178 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
179 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
180 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
181 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
182 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
183 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
184 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
185 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
186 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
187 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
188 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
189 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
190 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
191 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
192 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
195 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
196 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
197 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
198 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
199 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
200 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
201 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
202 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
203 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
204 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
205 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
206 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.95
Nodule 0
Rhizoplane 1.99
Rhizosphere 76.35
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10079691 3300003215 Bacteria 820
2 Ga0055530_10002430 3300003791 Bacteria 12047
3 Ga0055531_10001198 3300003794 Bacteria 19883
4 Ga0055531_10040547 3300003794 Bacteria 1363
5 Ga0055543_1014823 3300004625 Bacteria 1511
6 Ga0065165_1000856 3300005262 Bacteria 39851
7 Ga0070658_10705720 3300005327 Bacteria 876
8 Ga0070670_100054256 3300005331 Bacteria 3441
9 Ga0070670_100114061 3300005331 Bacteria 2330
10 Ga0068869_100099950 3300005334 Bacteria 2193
11 Ga0070666_10151264 3300005335 Bacteria 1619
12 Ga0070666_10372774 3300005335 Bacteria 1024
13 Ga0070682_100371226 3300005337 Bacteria 1073
14 Ga0070660_100039024 3300005339 Bacteria 3608
15 Ga0070660_100049247 3300005339 Bacteria 3239
16 Ga0070660_100159572 3300005339 Bacteria 1816
17 Ga0070668_100153024 3300005347 Bacteria 1867
18 Ga0070669_100022476 3300005353 Bacteria 4509
19 Ga0070671_100023099 3300005355 Bacteria 5084
20 Ga0070674_100974131 3300005356 Bacteria 743
21 Ga0070659_100000194 3300005366 Bacteria 46646
22 Ga0070659_100017125 3300005366 Bacteria 5448
23 Ga0070659_101104102 3300005366 Bacteria 699
24 Ga0070667_100018561 3300005367 Bacteria 5770
25 Ga0070667_101379085 3300005367 Unclassified 661
26 Ga0070663_100824401 3300005455 Bacteria 797
27 Ga0070681_10002130 3300005458 Bacteria 17987
28 Ga0070681_10400167 3300005458 Bacteria 1284
29 Ga0070681_10817948 3300005458 Bacteria 849
30 Ga0068867_100721223 3300005459 Bacteria 882
31 Ga0070679_100059780 3300005530 Bacteria 3798
32 Ga0070679_100101199 3300005530 Bacteria 2868
33 Ga0068853_100009968 3300005539 Bacteria 7672
34 Ga0068853_100084127 3300005539 Bacteria 2788
35 Ga0068853_100729110 3300005539 Bacteria 947
36 Ga0068853_101979119 3300005539 Bacteria 565
37 Ga0070686_100660561 3300005544 Bacteria 830
38 Ga0070693_100110262 3300005547 Bacteria 1692
39 Ga0070665_100000198 3300005548 Bacteria 105999
40 Ga0070665_100000945 3300005548 Bacteria 37054
41 Ga0070665_100085592 3300005548 Bacteria 3158
42 Ga0070665_100187871 3300005548 Bacteria 2067
43 Ga0068855_100024641 3300005563 Bacteria 7197
44 Ga0068855_100025093 3300005563 Bacteria 7136
45 Ga0068856_100901390 3300005614 Bacteria 903
46 Ga0068852_100179402 3300005616 Bacteria 1990
47 Ga0068852_100200230 3300005616 Bacteria 1890
48 Ga0068852_101658581 3300005616 Bacteria 662
49 Ga0068859_100200192 3300005617 Bacteria 2082
50 Ga0068864_100000106 3300005618 Bacteria 81202
51 Ga0068864_100186364 3300005618 Bacteria 1900
52 Ga0068864_100223392 3300005618 Bacteria 1738
53 Ga0068864_101401920 3300005618 Bacteria 700
54 Ga0068864_101782925 3300005618 Bacteria 621
55 Ga0068861_100111011 3300005719 Bacteria 2197
56 Ga0068863_100000175 3300005841 Bacteria 67772
57 Ga0068863_100109823 3300005841 Bacteria 2626
58 Ga0068863_100175295 3300005841 Bacteria 2058
59 Ga0068863_100222777 3300005841 Bacteria 1818
60 Ga0068858_100000006 3300005842 Bacteria 256011
61 Ga0068858_102117805 3300005842 Bacteria 556
62 Ga0068860_100000066 3300005843 Bacteria 182836
63 Ga0068860_100030995 3300005843 Bacteria 5141
64 Ga0068862_100001593 3300005844 Bacteria 20666
65 Ga0068862_100079772 3300005844 Bacteria 2838
66 Ga0068862_100523622 3300005844 Bacteria 1128
67 Ga0068862_100823344 3300005844 Bacteria 908
68 Ga0070717_10700803 3300006028 Bacteria 920
69 Ga0075363_100369578 3300006048 Bacteria 839
70 Ga0075362_10231285 3300006177 Bacteria 905
71 Ga0075369_10101879 3300006186 Bacteria 1289
72 Ga0075370_10110264 3300006353 Bacteria 1598
73 Ga0068865_100000753 3300006881 Bacteria 18176
74 Ga0068865_100438226 3300006881 Bacteria 1078
75 Ga0097620_100200184 3300006931 Bacteria 2082
76 Ga0105250_10323479 3300009092 Bacteria 671
77 Ga0105240_10000428 3300009093 Bacteria 77995
78 Ga0105240_10076028 3300009093 Bacteria 4141
79 Ga0105240_10098539 3300009093 Bacteria 3559
80 Ga0105240_10127389 3300009093 Bacteria 3057
81 Ga0105245_10625277 3300009098 Bacteria 1105
82 Ga0105242_10369369 3300009176 Bacteria 1330
83 Ga0105248_10000789 3300009177 Bacteria 35531
84 Ga0105248_10585487 3300009177 Bacteria 1259
85 Ga0105248_10599849 3300009177 Bacteria 1243
86 Ga0105237_10166826 3300009545 Bacteria 2201
87 Ga0105238_10042172 3300009551 Bacteria 4621
88 Ga0105238_10065063 3300009551 Bacteria 3647
89 Ga0105238_10101151 3300009551 Bacteria 2865
90 Ga0105238_11415964 3300009551 Bacteria 722
91 Ga0105249_10245795 3300009553 Bacteria 1771
92 Ga0105249_11320779 3300009553 Bacteria 793
93 Ga0105239_10568335 3300010375 Bacteria 1292
94 Ga0105239_11022415 3300010375 Bacteria 950
95 Ga0105239_11531277 3300010375 Bacteria 771
96 Ga0157370_10584427 3300013104 Bacteria 1023
97 Ga0157369_10668018 3300013105 Bacteria 1071
98 Ga0157369_10711195 3300013105 Bacteria 1034
99 Ga0157374_10614048 3300013296 Bacteria 1098
100 Ga0163162_11229873 3300013306 Bacteria 850
101 Ga0157372_11247865 3300013307 Bacteria 858
102 Ga0163163_10004944 3300014325 Bacteria 11468
103 Ga0163163_11476920 3300014325 Bacteria 741
104 Ga0163163_11607750 3300014325 Bacteria 711
105 Ga0157380_10909348 3300014326 Bacteria 907
106 Ga0157379_10066468 3300014968 Bacteria 3223
107 Ga0209026_1002163 3300025250 Bacteria 7650
108 Ga0209148_1026077 3300025254 Bacteria 910
109 Ga0209676_1004570 3300025292 Bacteria 7658
110 Ga0209758_1001260 3300025297 Bacteria 31379
111 Ga0209050_1000073 3300025298 Bacteria 292046
112 Ga0209257_1000099 3300025304 Bacteria 255304
113 Ga0209257_1002773 3300025304 Bacteria 16545
114 Ga0207680_10388785 3300025903 Bacteria 984
115 Ga0207705_10005135 3300025909 Bacteria 9815
116 Ga0207705_10157118 3300025909 Bacteria 1706
117 Ga0207707_10062816 3300025912 Bacteria 3232
118 Ga0207707_10115183 3300025912 Bacteria 2349
119 Ga0207695_10003931 3300025913 Bacteria 20558
120 Ga0207695_10008102 3300025913 Bacteria 13210
121 Ga0207695_10070931 3300025913 Bacteria 3559
122 Ga0207695_10072122 3300025913 Bacteria 3525
123 Ga0207695_10243926 3300025913 Bacteria 1697
124 Ga0207671_10099373 3300025914 Bacteria 2202
125 Ga0207660_10001963 3300025917 Bacteria 13715
126 Ga0207660_10100831 3300025917 Bacteria 2156
127 Ga0207660_11203629 3300025917 Bacteria 616
128 Ga0207662_10354896 3300025918 Bacteria 986
129 Ga0207657_10001390 3300025919 Bacteria 25814
130 Ga0207657_10018271 3300025919 Bacteria 6703
131 Ga0207657_10053064 3300025919 Bacteria 3514
132 Ga0207649_10490662 3300025920 Bacteria 933
133 Ga0207652_10001537 3300025921 Bacteria 20342
134 Ga0207652_10463143 3300025921 Bacteria 1142
135 Ga0207681_10116265 3300025923 Bacteria 1954
136 Ga0207694_10070682 3300025924 Bacteria 2727
137 Ga0207694_10095176 3300025924 Bacteria 2354
138 Ga0207694_10183552 3300025924 Bacteria 1697
139 Ga0207694_11010823 3300025924 Bacteria 704
140 Ga0207650_10041242 3300025925 Bacteria 3381
141 Ga0207650_10048914 3300025925 Bacteria 3120
142 Ga0207687_10130292 3300025927 Bacteria 1894
143 Ga0207644_10005489 3300025931 Bacteria 8258
144 Ga0207690_10000031 3300025932 Bacteria 154724
145 Ga0207690_10007448 3300025932 Bacteria 6495
146 Ga0207690_10794142 3300025932 Bacteria 782
147 Ga0207686_10295087 3300025934 Bacteria 1202
148 Ga0207704_10005105 3300025938 Bacteria 6043
149 Ga0207691_10335198 3300025940 Bacteria 1295
150 Ga0207711_10002318 3300025941 Bacteria 17056
151 Ga0207711_10007627 3300025941 Bacteria 9048
152 Ga0207711_10297220 3300025941 Bacteria 1489
153 Ga0207711_10733128 3300025941 Bacteria 921
154 Ga0207689_10035952 3300025942 Bacteria 4112
155 Ga0207679_10651526 3300025945 Bacteria 953
156 Ga0207667_10002879 3300025949 Bacteria 21366
157 Ga0207667_10478525 3300025949 Bacteria 1264
158 Ga0207712_10212907 3300025961 Bacteria 1540
159 Ga0207668_10000004 3300025972 Bacteria 201204
160 Ga0207668_10028039 3300025972 Bacteria 3676
161 Ga0207668_10040863 3300025972 Bacteria 3132
162 Ga0207668_10052956 3300025972 Bacteria 2810
163 Ga0207658_10002238 3300025986 Bacteria 14351
164 Ga0207658_10319945 3300025986 Bacteria 1342
165 Ga0207703_10000027 3300026035 Bacteria 209608
166 Ga0207703_12102155 3300026035 Bacteria 541
167 Ga0207639_10004762 3300026041 Bacteria 9143
168 Ga0207639_11133941 3300026041 Bacteria 734
169 Ga0207639_11981125 3300026041 Bacteria 543
170 Ga0207641_10000003 3300026088 Bacteria 496984
171 Ga0207641_10154777 3300026088 Bacteria 2079
172 Ga0207641_10295908 3300026088 Bacteria 1527
173 Ga0207641_11102399 3300026088 Bacteria 792
174 Ga0207641_11127079 3300026088 Bacteria 783
175 Ga0207648_10759696 3300026089 Bacteria 901
176 Ga0207676_10001496 3300026095 Bacteria 17256
177 Ga0207676_10107292 3300026095 Bacteria 2329
178 Ga0207676_10321022 3300026095 Bacteria 1422
179 Ga0207676_11136822 3300026095 Bacteria 773
180 Ga0207676_11488041 3300026095 Bacteria 674
181 Ga0207675_100252504 3300026118 Bacteria 1707
182 Ga0207675_100403649 3300026118 Bacteria 1347
183 Ga0207698_10269135 3300026142 Bacteria 1570
184 Ga0207698_10272184 3300026142 Bacteria 1562
185 Ga0207698_10485645 3300026142 Bacteria 1199
186 Ga0209981_1002113 3300027378 Bacteria 2529
187 Ga0210000_1057144 3300027462 Bacteria 630
188 Ga0209999_1009898 3300027543 Bacteria 1722
189 Ga0268266_10000003 3300028379 Bacteria 1701703
190 Ga0268266_10001373 3300028379 Bacteria 29333
191 Ga0268266_10074278 3300028379 Bacteria 2952
192 Ga0268265_10001213 3300028380 Bacteria 22410
193 Ga0268265_10001214 3300028380 Bacteria 22398
194 Ga0268265_10035560 3300028380 Bacteria 3641
195 Ga0268265_10766730 3300028380 Bacteria 937
196 Ga0268265_11197726 3300028380 Bacteria 757
197 Ga0268264_10000113 3300028381 Bacteria 203262
198 Ga0268264_10064625 3300028381 Bacteria 3080
199 Ga0307517_10040779 3300028786 Bacteria 5041
200 Ga0307517_10107922 3300028786 Bacteria 2141
201 Ga0307511_10035205 3300030521 Bacteria 4376
202 Ga0265327_10004912 3300031251 Bacteria 11536
203 Ga0307513_10004806 3300031456 Bacteria 17949
204 Ga0307513_10014423 3300031456 Bacteria 9643
205 Ga0307513_10313387 3300031456 Bacteria 1330
206 Ga0307513_10460814 3300031456 Bacteria 994
207 Ga0307408_100329175 3300031548 Bacteria 1289
208 Ga0307516_10000006 3300031730 Bacteria 298586
209 Ga0307413_10335588 3300031824 Bacteria 1160
210 Ga0307413_12149162 3300031824 Bacteria 505
211 Ga0307410_12005067 3300031852 Bacteria 516
212 Ga0307406_11168399 3300031901 Bacteria 667
213 Ga0307406_11375029 3300031901 Bacteria 618
214 Ga0307409_101239471 3300031995 Bacteria 770
215 Ga0307414_10031743 3300032004 Bacteria 3469
216 Ga0307414_10036326 3300032004 Bacteria 3288
217 Ga0307414_10080779 3300032004 Bacteria 2378
218 Ga0307414_10484481 3300032004 Bacteria 1091
219 Ga0307414_10535475 3300032004 Bacteria 1041
220 Ga0307414_10843662 3300032004 Bacteria 837
221 Ga0307414_11128782 3300032004 Bacteria 724
222 Ga0307414_11256091 3300032004 Bacteria 686
223 Ga0307415_101606337 3300032126 Bacteria 625
224 Ga0373944_0007745 3300035089 Bacteria 2885
225 Ga0373946_0172411 3300035171 Bacteria 1022
226 Ga0373931_0364710 3300035691 Bacteria 907
227 Ga0373925_0000199 3300037068 Bacteria 65400
228 Ga0373925_0095227 3300037068 Bacteria 2280
229 Ga0395899_0000991 3300037312 Bacteria 26130
230 Ga0395899_0129356 3300037312 Bacteria 1804
231 Ga0395899_0286824 3300037312 Bacteria 1118
232 Ga0395900_0000002 3300037418 Bacteria 671103
233 Ga0395900_0096205 3300037418 Bacteria 3042
234 Ga0395898_0006370 3300037466 Bacteria 12608
235 Ga0395898_0037641 3300037466 Bacteria 4798
236 Ga0395905_0009959 3300037471 Bacteria 9261
237 Ga0395905_0014734 3300037471 Bacteria 7455
238 Ga0395905_0073940 3300037471 Bacteria 3194
239 Ga0395905_0159260 3300037471 Bacteria 2122
240 Ga0395905_0282615 3300037471 Bacteria 1546
241 Ga0395905_0367249 3300037471 Bacteria 1332
242 Ga0395905_0396798 3300037471 Bacteria 1274
243 Ga0395905_1001133 3300037471 Bacteria 739
244 Ga0395905_1159542 3300037471 Bacteria 676
245 Ga0395901_0000021 3300038443 Bacteria 307734
246 Ga0395901_0053158 3300038443 Bacteria 4209
247 Ga0395901_0078804 3300038443 Bacteria 3440
248 Ga0436365_0984804 3300039437 Bacteria 7989
249 Ga0451802_0832561 3300041460 Bacteria 584
250 Ga0439462_0031431 3300042015 Bacteria 1406
251 Ga0450890_027934 3300042127 Bacteria 792
252 Ga0466965_0165520 3300044683 Bacteria 1161
253 Ga0466957_0791182 3300044842 Bacteria 673
254 Ga0495629_0003470 3300046459 Bacteria 11921
255 Ga0495650_0146799 3300046471 Bacteria 850
256 Ga0495585_0623210 3300046492 Bacteria 506
257 Ga0495583_0004258 3300046506 Bacteria 10376
258 Ga0495583_0194047 3300046506 Bacteria 827
259 Ga0495606_0076565 3300046507 Bacteria 2091
260 Ga0495606_0139987 3300046507 Bacteria 1430
261 Ga0495610_0100539 3300046512 Bacteria 1296
262 Ga0495620_0025766 3300046515 Bacteria 2777
263 Ga0495620_0346485 3300046515 Bacteria 563
264 Ga0495643_0010268 3300046522 Bacteria 5767
265 Ga0495643_0304009 3300046522 Bacteria 726
266 Ga0495642_0022236 3300046528 Bacteria 2498
267 Ga0495609_0047171 3300046538 Bacteria 1928
268 Ga0495645_0186314 3300046543 Bacteria 1418
269 Ga0495622_0003481 3300046557 Bacteria 7415
270 Ga0495668_0042004 3300046616 Bacteria 2546
271 Ga0495668_0095815 3300046616 Bacteria 1624
272 Ga0495611_0002863 3300046648 Bacteria 7700
273 Ga0495625_0027125 3300046660 Bacteria 4318
274 Ga0495625_0104913 3300046660 Bacteria 1937
275 Ga0495625_0133483 3300046660 Bacteria 1680
276 Ga0495625_0195158 3300046660 Bacteria 1339
277 Ga0495669_0000006 3300046684 Bacteria 190838
278 Ga0495669_0000222 3300046684 Bacteria 34149
279 Ga0495669_0334168 3300046684 Bacteria 732
280 Ga0495674_0802235 3300047319 Bacteria 732
281 Ga0495672_0215258 3300047320 Bacteria 952
282 Ga0495687_141708 3300047443 Bacteria 835
283 Ga0495677_0009881 3300047445 Bacteria 3514
284 Ga0495677_0320071 3300047445 Unclassified 611
285 Ga0495685_019778 3300047447 Bacteria 2314
286 Ga0495602_0699963 3300048088 Bacteria 688
287 Ga0495602_0748772 3300048088 Bacteria 659
288 Ga0496100_0735329 3300048903 Bacteria 771
289 Ga0496102_0204502 3300048905 Bacteria 1861
290 Ga0496112_0082983 3300048915 Bacteria 3169
291 Ga0496112_0354390 3300048915 Bacteria 1410
292 Ga0496115_0022476 3300048918 Bacteria 4887
293 Ga0496115_0070820 3300048918 Bacteria 2827
294 Ga0496117_0016777 3300048920 Bacteria 6155
295 Ga0496118_0008171 3300048921 Bacteria 10889
296 Ga0496121_0000042 3300048924 Bacteria 342304
297 Ga0496125_0144387 3300048928 Bacteria 1648
298 Ga0496126_0516276 3300048929 Bacteria 953
299 Ga0501032_0038976 3300049569 Bacteria 3234
300 Ga0501036_0736333 3300049572 Bacteria 814
301 Ga0501043_0132064 3300049579 Bacteria 1956
302 Ga0501047_0001866 3300049581 Bacteria 20290
303 Ga0501047_0043514 3300049581 Bacteria 4338
304 Ga0501047_0256513 3300049581 Bacteria 1597
305 Ga0501047_0821756 3300049581 Bacteria 744
306 Ga0501044_0876520 3300049823 Bacteria 773
307 nmdc:mga03683_179746_c1 3300050489 Bacteria 965
308 nmdc:mga03n38_447893_c1 3300050490 Bacteria 718
309 nmdc:mga0k408_443646_c1 3300050493 Bacteria 771
310 nmdc:mga0sz30_424206_c1 3300050516 Bacteria 596
311 Ga0500635_0000051 3300053080 Bacteria 76510
312 Ga0500578_0502246 3300053086 Bacteria 682
313 Ga0500643_014040 3300053087 Bacteria 2800
314 Ga0500643_111800 3300053087 Bacteria 737
315 Ga0500583_0196249 3300053092 Bacteria 1004
316 Ga0500651_0007877 3300053093 Bacteria 6233
317 Ga0500566_0066641 3300053094 Bacteria 2028
318 Ga0500641_0045693 3300053096 Bacteria 1784
319 Ga0500555_125795 3300053103 Bacteria 638
320 Ga0500556_0019477 3300053104 Bacteria 2157
321 Ga0500562_001541 3300053108 Bacteria 5705
322 Ga0500562_006934 3300053108 Bacteria 2859
323 Ga0500562_024747 3300053108 Bacteria 1569
324 Ga0500572_052896 3300053111 Bacteria 1215
325 Ga0500595_000938 3300053119 Bacteria 16518
326 Ga0500607_219707 3300053121 Bacteria 793
327 Ga0500608_009136 3300053122 Bacteria 4197
328 Ga0500614_007873 3300053123 Bacteria 2252
329 Ga0500658_0006734 3300053134 Bacteria 4252
330 Ga0500559_0129237 3300053136 Bacteria 1179
331 Ga0500564_192533 3300053138 Bacteria 843
332 Ga0500568_0233563 3300053139 Bacteria 671
333 Ga0500590_028436 3300053148 Bacteria 2900
334 Ga0500603_002296 3300053150 Bacteria 4203
335 Ga0500616_0037673 3300053153 Bacteria 2617
336 Ga0500619_019939 3300053154 Bacteria 1908
337 Ga0500620_155586 3300053155 Bacteria 795
338 Ga0500638_045103 3300053162 Bacteria 2139
339 Ga0500639_221843 3300053163 Bacteria 788
340 Ga0500636_0003210 3300053177 Bacteria 9158
341 Ga0500636_0086820 3300053177 Bacteria 1796
342 Ga0500637_0001261 3300053178 Bacteria 10594
343 Ga0500637_0005413 3300053178 Bacteria 6174
344 Ga0500645_001609 3300053730 Bacteria 11202
345 Ga0500645_006055 3300053730 Bacteria 4365
346 Ga0500596_002649 3300053735 Bacteria 3509
347 2524609835 2524023250 Bacteria 5457705
348 2643999713 2643221598 Bacteria 4578346
349 2644087529 2643221614 Bacteria 4260023
350 2644344427 2643221661 Bacteria 4267604
351 2644366889 2643221666 Bacteria 4265935
352 JGI25153J46596_10079691
353 Ga0055530_10002430
354 Ga0055531_10001198
355 Ga0055531_10040547
356 Ga0055543_1014823
357 Ga0065165_1000856
358 Ga0070658_10705720
359 Ga0070670_100054256
360 Ga0070670_100114061
361 Ga0068869_100099950
362 Ga0070666_10151264
363 Ga0070666_10372774
364 Ga0070682_100371226
365 Ga0070660_100039024
366 Ga0070660_100049247
367 Ga0070660_100159572
368 Ga0070668_100153024
369 Ga0070669_100022476
370 Ga0070671_100023099
371 Ga0070674_100974131
372 Ga0070659_100000194
373 Ga0070659_100017125
374 Ga0070659_101104102
375 Ga0070667_100018561
376 Ga0070667_101379085
377 Ga0070663_100824401
378 Ga0070681_10002130
379 Ga0070681_10400167
380 Ga0070681_10817948
381 Ga0068867_100721223
382 Ga0070679_100059780
383 Ga0070679_100101199
384 Ga0068853_100009968
385 Ga0068853_100084127
386 Ga0068853_100729110
387 Ga0068853_101979119
388 Ga0070686_100660561
389 Ga0070693_100110262
390 Ga0070665_100000198
391 Ga0070665_100000945
392 Ga0070665_100085592
393 Ga0070665_100187871
394 Ga0068855_100024641
395 Ga0068855_100025093
396 Ga0068856_100901390
397 Ga0068852_100179402
398 Ga0068852_100200230
399 Ga0068852_101658581
400 Ga0068859_100200192
401 Ga0068864_100000106
402 Ga0068864_100186364
403 Ga0068864_100223392
404 Ga0068864_101401920
405 Ga0068864_101782925
406 Ga0068861_100111011
407 Ga0068863_100000175
408 Ga0068863_100109823
409 Ga0068863_100175295
410 Ga0068863_100222777
411 Ga0068858_100000006
412 Ga0068858_102117805
413 Ga0068860_100000066
414 Ga0068860_100030995
415 Ga0068862_100001593
416 Ga0068862_100079772
417 Ga0068862_100523622
418 Ga0068862_100823344
419 Ga0070717_10700803
420 Ga0075363_100369578
421 Ga0075362_10231285
422 Ga0075369_10101879
423 Ga0075370_10110264
424 Ga0068865_100000753
425 Ga0068865_100438226
426 Ga0097620_100200184
427 Ga0105250_10323479
428 Ga0105240_10000428
429 Ga0105240_10076028
430 Ga0105240_10098539
431 Ga0105240_10127389
432 Ga0105245_10625277
433 Ga0105242_10369369
434 Ga0105248_10000789
435 Ga0105248_10585487
436 Ga0105248_10599849
437 Ga0105237_10166826
438 Ga0105238_10042172
439 Ga0105238_10065063
440 Ga0105238_10101151
441 Ga0105238_11415964
442 Ga0105249_10245795
443 Ga0105249_11320779
444 Ga0105239_10568335
445 Ga0105239_11022415
446 Ga0105239_11531277
447 Ga0157370_10584427
448 Ga0157369_10668018
449 Ga0157369_10711195
450 Ga0157374_10614048
451 Ga0163162_11229873
452 Ga0157372_11247865
453 Ga0163163_10004944
454 Ga0163163_11476920
455 Ga0163163_11607750
456 Ga0157380_10909348
457 Ga0157379_10066468
458 Ga0209026_1002163
459 Ga0209148_1026077
460 Ga0209676_1004570
461 Ga0209758_1001260
462 Ga0209050_1000073
463 Ga0209257_1000099
464 Ga0209257_1002773
465 Ga0207680_10388785
466 Ga0207705_10005135
467 Ga0207705_10157118
468 Ga0207707_10062816
469 Ga0207707_10115183
470 Ga0207695_10003931
471 Ga0207695_10008102
472 Ga0207695_10070931
473 Ga0207695_10072122
474 Ga0207695_10243926
475 Ga0207671_10099373
476 Ga0207660_10001963
477 Ga0207660_10100831
478 Ga0207660_11203629
479 Ga0207662_10354896
480 Ga0207657_10001390
481 Ga0207657_10018271
482 Ga0207657_10053064
483 Ga0207649_10490662
484 Ga0207652_10001537
485 Ga0207652_10463143
486 Ga0207681_10116265
487 Ga0207694_10070682
488 Ga0207694_10095176
489 Ga0207694_10183552
490 Ga0207694_11010823
491 Ga0207650_10041242
492 Ga0207650_10048914
493 Ga0207687_10130292
494 Ga0207644_10005489
495 Ga0207690_10000031
496 Ga0207690_10007448
497 Ga0207690_10794142
498 Ga0207686_10295087
499 Ga0207704_10005105
500 Ga0207691_10335198
501 Ga0207711_10002318
502 Ga0207711_10007627
503 Ga0207711_10297220
504 Ga0207711_10733128
505 Ga0207689_10035952
506 Ga0207679_10651526
507 Ga0207667_10002879
508 Ga0207667_10478525
509 Ga0207712_10212907
510 Ga0207668_10000004
511 Ga0207668_10028039
512 Ga0207668_10040863
513 Ga0207668_10052956
514 Ga0207658_10002238
515 Ga0207658_10319945
516 Ga0207703_10000027
517 Ga0207703_12102155
518 Ga0207639_10004762
519 Ga0207639_11133941
520 Ga0207639_11981125
521 Ga0207641_10000003
522 Ga0207641_10154777
523 Ga0207641_10295908
524 Ga0207641_11102399
525 Ga0207641_11127079
526 Ga0207648_10759696
527 Ga0207676_10001496
528 Ga0207676_10107292
529 Ga0207676_10321022
530 Ga0207676_11136822
531 Ga0207676_11488041
532 Ga0207675_100252504
533 Ga0207675_100403649
534 Ga0207698_10269135
535 Ga0207698_10272184
536 Ga0207698_10485645
537 Ga0209981_1002113
538 Ga0210000_1057144
539 Ga0209999_1009898
540 Ga0268266_10000003
541 Ga0268266_10001373
542 Ga0268266_10074278
543 Ga0268265_10001213
544 Ga0268265_10001214
545 Ga0268265_10035560
546 Ga0268265_10766730
547 Ga0268265_11197726
548 Ga0268264_10000113
549 Ga0268264_10064625
550 Ga0307517_10040779
551 Ga0307517_10107922
552 Ga0307511_10035205
553 Ga0265327_10004912
554 Ga0307513_10004806
555 Ga0307513_10014423
556 Ga0307513_10313387
557 Ga0307513_10460814
558 Ga0307408_100329175
559 Ga0307516_10000006
560 Ga0307413_10335588
561 Ga0307413_12149162
562 Ga0307410_12005067
563 Ga0307406_11168399
564 Ga0307406_11375029
565 Ga0307409_101239471
566 Ga0307414_10031743
567 Ga0307414_10036326
568 Ga0307414_10080779
569 Ga0307414_10484481
570 Ga0307414_10535475
571 Ga0307414_10843662
572 Ga0307414_11128782
573 Ga0307414_11256091
574 Ga0307415_101606337
575 Ga0373944_0007745
576 Ga0373946_0172411
577 Ga0373931_0364710
578 Ga0373925_0000199
579 Ga0373925_0095227
580 Ga0395899_0000991
581 Ga0395899_0129356
582 Ga0395899_0286824
583 Ga0395900_0000002
584 Ga0395900_0096205
585 Ga0395898_0006370
586 Ga0395898_0037641
587 Ga0395905_0009959
588 Ga0395905_0014734
589 Ga0395905_0073940
590 Ga0395905_0159260
591 Ga0395905_0282615
592 Ga0395905_0367249
593 Ga0395905_0396798
594 Ga0395905_1001133
595 Ga0395905_1159542
596 Ga0395901_0000021
597 Ga0395901_0053158
598 Ga0395901_0078804
599 Ga0436365_0984804
600 Ga0451802_0832561
601 Ga0439462_0031431
602 Ga0450890_027934
603 Ga0466965_0165520
604 Ga0466957_0791182
605 Ga0495629_0003470
606 Ga0495650_0146799
607 Ga0495585_0623210
608 Ga0495583_0004258
609 Ga0495583_0194047
610 Ga0495606_0076565
611 Ga0495606_0139987
612 Ga0495610_0100539
613 Ga0495620_0025766
614 Ga0495620_0346485
615 Ga0495643_0010268
616 Ga0495643_0304009
617 Ga0495642_0022236
618 Ga0495609_0047171
619 Ga0495645_0186314
620 Ga0495622_0003481
621 Ga0495668_0042004
622 Ga0495668_0095815
623 Ga0495611_0002863
624 Ga0495625_0027125
625 Ga0495625_0104913
626 Ga0495625_0133483
627 Ga0495625_0195158
628 Ga0495669_0000006
629 Ga0495669_0000222
630 Ga0495669_0334168
631 Ga0495674_0802235
632 Ga0495672_0215258
633 Ga0495687_141708
634 Ga0495677_0009881
635 Ga0495677_0320071
636 Ga0495685_019778
637 Ga0495602_0699963
638 Ga0495602_0748772
639 Ga0496100_0735329
640 Ga0496102_0204502
641 Ga0496112_0082983
642 Ga0496112_0354390
643 Ga0496115_0022476
644 Ga0496115_0070820
645 Ga0496117_0016777
646 Ga0496118_0008171
647 Ga0496121_0000042
648 Ga0496125_0144387
649 Ga0496126_0516276
650 Ga0501032_0038976
651 Ga0501036_0736333
652 Ga0501043_0132064
653 Ga0501047_0001866
654 Ga0501047_0043514
655 Ga0501047_0256513
656 Ga0501047_0821756
657 Ga0501044_0876520
658 nmdc:mga03683_179746_c1
659 nmdc:mga03n38_447893_c1
660 nmdc:mga0k408_443646_c1
661 nmdc:mga0sz30_424206_c1
662 Ga0500635_0000051
663 Ga0500578_0502246
664 Ga0500643_014040
665 Ga0500643_111800
666 Ga0500583_0196249
667 Ga0500651_0007877
668 Ga0500566_0066641
669 Ga0500641_0045693
670 Ga0500555_125795
671 Ga0500556_0019477
672 Ga0500562_001541
673 Ga0500562_006934
674 Ga0500562_024747
675 Ga0500572_052896
676 Ga0500595_000938
677 Ga0500607_219707
678 Ga0500608_009136
679 Ga0500614_007873
680 Ga0500658_0006734
681 Ga0500559_0129237
682 Ga0500564_192533
683 Ga0500568_0233563
684 Ga0500590_028436
685 Ga0500603_002296
686 Ga0500616_0037673
687 Ga0500619_019939
688 Ga0500620_155586
689 Ga0500638_045103
690 Ga0500639_221843
691 Ga0500636_0003210
692 Ga0500636_0086820
693 Ga0500637_0001261
694 Ga0500637_0005413
695 Ga0500645_001609
696 Ga0500645_006055
697 Ga0500596_002649
698 2524609835
699 2643999713
700 2644087529
701 2644344427
702 2644366889

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03994

DUF350

Domain of Unknown Function (DUF350)

95

146

0.99

PF03994

DUF350

Domain of Unknown Function (DUF350)

30

83

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8btk-assembly1.cif.gz_TC structure of the trap complex with the sec translocon and a translating ribosome 0.4593 29 140
3fbz-assembly3.cif.gz_C crystal structure of orf140 of the archaeal virus acidianus filamentous virus 1 (afv1) 0.4342 13 142
8b5l-assembly1.cif.gz_t cryo-em structure of ribosome-sec61-trap (translocon associated protein) translocon complex 0.4155 16 146
7osf-assembly1.cif.gz_E abc transporter complex nosdfyl, r-domain 1 0.3995 63 147
8b5l-assembly1.cif.gz_t cryo-em structure of ribosome-sec61-trap (translocon associated protein) translocon complex 0.3879 16 146
ID Description Score Start End Superfamily
af_Q2FY18_5_276_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.5911 68 139 1.10.3470.10
af_A0A0G2K4B0_59_286_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4163 23 147 1.20.1070.10
af_Q7TM99_296_483_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4127 30 144 1.20.1250.20
af_O17927_126_336_1.10.565.10 Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor 0.4028 66 146 1.10.565.10
af_Q02328_671_873_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.4 29 144 1.20.1410.10
ID Description Score Start End GO Terms
AF-A0A258BAI5-F1-model_v4 DUF350 domain-containing protein 0.9993 14 147 GO:0005886
AF-A0A258FAE5-F1-model_v4 DUF350 domain-containing protein 0.9986 13 147 GO:0005886
AF-A0A328AYV0-F1-model_v4 DUF350 domain-containing protein 0.9926 10 147 GO:0005886
AF-A0A2E0YHZ2-F1-model_v4 deleted 0.9837 16 148
AF-A0A519KIS9-F1-model_v4 DUF350 domain-containing protein 0.9827 14 95 GO:0005886

Map