F418501

General Info

Members Datasets Scaffolds Average Seq Length
351 182 345 453

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100018480|Ga0070683_1000184804
Length 500
Sequence MGTFIFMFFRDIGQVAPPPNSPGRMATTAQGLPIIKEIMVIMNSRFSNGALRCTLICVCMTLASNYLHAQSDSTDPAIRAALNEISASNVQADIEKLVGFQTRSTLSAQDEASIASGRGIGAAREWIKSEFERYSQNCGGCLEVKTDTFIQPVSERVASPVQITNVYAVLKGTNPKEGSNVVLVTGHYDSRNSSNENVRDPAPGANDDASGTTISLECARVLSKLRFPETIIFLAVAGEEQGLYGSKHFAEFAKAQGWQIEAVLNNDIVGGDKSPGQDAGRVRVFSESIPEDASEREMRMLRALGGENDSPSRELARYVARIAGEYQLPVSPLLEFRRDRYLRGGDHIPFNQAGFAAVRFTEFRENYNHQHQNVRMEKAIEYGDLPKFVDFNYVANVAKVNAATLASLXXXPPPPQNVHLETTELVNDSTLTWDAPTDDRAVSYEVLWRATAAPDWEHSQKFQNTTRATIAVSKDNVFFSVQAMDGSGHKSLPVVPMPER

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
3 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
4 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
5 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
6 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
7 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
181 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
182 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 0
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.13
Nodule 0
Rhizoplane 2.56
Rhizosphere 89.46
Stem 0
Stem Tuber 0
Unclassified 4.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001857 3300001904 Bacteria 3771
2 JGI24737J22298_10000681 3300001990 Bacteria 11981
3 JGI24737J22298_10003893 3300001990 Bacteria 5243
4 JGI24743J22301_10004792 3300001991 Bacteria 2224
5 JGI24735J21928_10000005 3300002067 Bacteria 356755
6 JGI25162J39368_1000016 3300002737 Bacteria 288734
7 rootH1_10000713 3300003316 Bacteria 3479
8 rootH2_10012714 3300003320 Bacteria 66260
9 rootH2_10113384 3300003320 Bacteria 7920
10 rootH1_10012646 3300003323 Bacteria 62371
11 rootH1_10028786 3300003323 Bacteria 6946
12 Ga0070658_10000008 3300005327 Bacteria 319912
13 Ga0070658_10026346 3300005327 Bacteria 4664
14 Ga0070658_10064218 3300005327 Bacteria 2994
15 Ga0070676_10002139 3300005328 Bacteria 10059
16 Ga0070683_100018480 3300005329 Bacteria 6176
17 Ga0070683_100020085 3300005329 Bacteria 5941
18 Ga0068869_100001760 3300005334 Bacteria 12948
19 Ga0070680_100043669 3300005336 Bacteria 3641
20 Ga0068868_100030713 3300005338 Bacteria 4120
21 Ga0068868_100046766 3300005338 Bacteria 3387
22 Ga0068868_100088239 3300005338 Bacteria 2496
23 Ga0070660_100036082 3300005339 Bacteria 3744
24 Ga0070660_100084899 3300005339 Bacteria 2489
25 Ga0070671_100076596 3300005355 Bacteria 2794
26 Ga0070673_100044406 3300005364 Bacteria 3441
27 Ga0070714_100098024 3300005435 Bacteria 2578
28 Ga0070713_100020596 3300005436 Bacteria 5059
29 Ga0070713_100222210 3300005436 Unclassified 1714
30 Ga0070710_10045524 3300005437 Bacteria 2440
31 Ga0070711_100010890 3300005439 Bacteria 5638
32 Ga0070711_100058396 3300005439 Bacteria 2675
33 Ga0070708_100003211 3300005445 Bacteria 12753
34 Ga0070678_100004429 3300005456 Bacteria 7968
35 Ga0070662_100000790 3300005457 Bacteria 19431
36 Ga0070662_100053614 3300005457 Bacteria 2920
37 Ga0070681_10000672 3300005458 Bacteria 28308
38 Ga0070681_10002267 3300005458 Bacteria 17569
39 Ga0068867_100001754 3300005459 Bacteria 15105
40 Ga0068867_100033250 3300005459 Bacteria 3733
41 Ga0070707_100055870 3300005468 Unclassified 3784
42 Ga0070699_100020400 3300005518 Bacteria 5716
43 Ga0070679_100056216 3300005530 Bacteria 3921
44 Ga0070679_100149157 3300005530 Bacteria 2316
45 Ga0070684_100004101 3300005535 Bacteria 11024
46 Ga0070684_100008449 3300005535 Bacteria 8049
47 Ga0070684_100028348 3300005535 Bacteria 4736
48 Ga0068853_100005185 3300005539 Bacteria 10193
49 Ga0068853_100021912 3300005539 Bacteria 5329
50 Ga0068853_100049747 3300005539 Bacteria 3603
51 Ga0068853_100064644 3300005539 Bacteria 3173
52 Ga0068853_100113435 3300005539 Bacteria 2410
53 Ga0068853_100214192 3300005539 Bacteria 1757
54 Ga0070695_100087561 3300005545 Bacteria 2072
55 Ga0070665_100000118 3300005548 Bacteria 149830
56 Ga0068855_100000155 3300005563 Bacteria 86903
57 Ga0068855_100002647 3300005563 Bacteria 22069
58 Ga0068855_100004995 3300005563 Bacteria 16182
59 Ga0068855_100009255 3300005563 Bacteria 11902
60 Ga0068855_100022662 3300005563 Bacteria 7524
61 Ga0068855_100033941 3300005563 Bacteria 6087
62 Ga0068855_100045502 3300005563 Bacteria 5192
63 Ga0068855_100158389 3300005563 Bacteria 2571
64 Ga0068855_100164577 3300005563 Bacteria 2515
65 Ga0068855_100396462 3300005563 Bacteria 1513
66 Ga0070664_100002954 3300005564 Bacteria 13751
67 Ga0068857_100000154 3300005577 Bacteria 42680
68 Ga0068857_100067925 3300005577 Bacteria 3173
69 Ga0068854_100006297 3300005578 Bacteria 7548
70 Ga0068854_100016730 3300005578 Bacteria 4893
71 Ga0068854_100031805 3300005578 Bacteria 3669
72 Ga0068856_100000371 3300005614 Bacteria 49295
73 Ga0068856_100000612 3300005614 Bacteria 39134
74 Ga0068856_100003296 3300005614 Bacteria 16416
75 Ga0068856_100005418 3300005614 Bacteria 12572
76 Ga0068856_100013472 3300005614 Bacteria 7914
77 Ga0068856_100092064 3300005614 Bacteria 3016
78 Ga0068852_100025919 3300005616 Bacteria 4758
79 Ga0068864_100009168 3300005618 Bacteria 8158
80 Ga0068866_10005626 3300005718 Bacteria 5187
81 Ga0068851_10043626 3300005834 Unclassified 2261
82 Ga0068863_100049305 3300005841 Bacteria 3993
83 Ga0068863_100111529 3300005841 Bacteria 2605
84 Ga0068858_100000491 3300005842 Bacteria 41299
85 Ga0068858_100067844 3300005842 Bacteria 3304
86 Ga0068858_100068348 3300005842 Bacteria 3292
87 Ga0068860_100085910 3300005843 Bacteria 2993
88 Ga0070717_10008717 3300006028 Bacteria 7586
89 Ga0070717_10015203 3300006028 Bacteria 5940
90 Ga0070717_10017106 3300006028 Bacteria 5634
91 Ga0070717_10052063 3300006028 Bacteria 3371
92 Ga0070717_10115948 3300006028 Bacteria 2290
93 Ga0075366_10000717 3300006195 Bacteria 15728
94 Ga0075366_10024059 3300006195 Bacteria 3552
95 Ga0097621_100000174 3300006237 Bacteria 40714
96 Ga0097621_100001137 3300006237 Bacteria 18447
97 Ga0097621_100005864 3300006237 Bacteria 8679
98 Ga0068871_100000060 3300006358 Bacteria 59245
99 Ga0068871_100002001 3300006358 Bacteria 13800
100 Ga0068871_100003610 3300006358 Bacteria 10627
101 Ga0068865_100000345 3300006881 Bacteria 25771
102 Ga0075436_100002588 3300006914 Bacteria 12438
103 Ga0075435_100003661 3300007076 Bacteria 10469
104 Ga0105240_10000371 3300009093 Bacteria 84390
105 Ga0105240_10004289 3300009093 Bacteria 21785
106 Ga0105240_10008014 3300009093 Bacteria 15215
107 Ga0105240_10017291 3300009093 Bacteria 9724
108 Ga0105240_10044224 3300009093 Bacteria 5662
109 Ga0105245_10143772 3300009098 Bacteria 2249
110 Ga0105241_10003593 3300009174 Bacteria 11536
111 Ga0105241_10004801 3300009174 Bacteria 9955
112 Ga0105241_10004960 3300009174 Bacteria 9814
113 Ga0105241_10026855 3300009174 Bacteria 4285
114 Ga0105241_10046364 3300009174 Bacteria 3301
115 Ga0105242_10063003 3300009176 Bacteria 3053
116 Ga0105248_10087575 3300009177 Bacteria 3505
117 Ga0105237_10000632 3300009545 Bacteria 49178
118 Ga0105237_10001840 3300009545 Bacteria 27293
119 Ga0105237_10002057 3300009545 Bacteria 25541
120 Ga0105237_10002169 3300009545 Bacteria 24637
121 Ga0105237_10003032 3300009545 Bacteria 20265
122 Ga0105237_10007468 3300009545 Bacteria 11957
123 Ga0105237_10045474 3300009545 Bacteria 4417
124 Ga0105237_10104739 3300009545 Bacteria 2820
125 Ga0105238_10000339 3300009551 Bacteria 51013
126 Ga0105238_10040527 3300009551 Bacteria 4719
127 Ga0105238_10047634 3300009551 Bacteria 4321
128 Ga0105238_10085256 3300009551 Bacteria 3147
129 Ga0105239_10000166 3300010375 Bacteria 94743
130 Ga0105239_10001606 3300010375 Bacteria 29871
131 Ga0105239_10002482 3300010375 Bacteria 23507
132 Ga0105239_10002716 3300010375 Bacteria 22264
133 Ga0105239_10003051 3300010375 Bacteria 20817
134 Ga0105239_10020086 3300010375 Bacteria 7370
135 Ga0105239_10051980 3300010375 Bacteria 4492
136 Ga0105239_10075879 3300010375 Bacteria 3696
137 Ga0105246_10017539 3300011119 Bacteria 4552
138 Ga0105246_10101250 3300011119 Bacteria 2098
139 Ga0157373_10020769 3300013100 Bacteria 4768
140 Ga0157373_10047342 3300013100 Bacteria 3067
141 Ga0157371_10045690 3300013102 Bacteria 3116
142 Ga0157370_10014756 3300013104 Bacteria 7977
143 Ga0157369_10000269 3300013105 Bacteria 69979
144 Ga0157369_10027888 3300013105 Bacteria 6255
145 Ga0157369_10070658 3300013105 Bacteria 3750
146 Ga0157369_10241101 3300013105 Bacteria 1888
147 Ga0157374_10000384 3300013296 Bacteria 40618
148 Ga0157374_10000742 3300013296 Bacteria 28401
149 Ga0157374_10002065 3300013296 Bacteria 16892
150 Ga0157374_10010475 3300013296 Bacteria 7975
151 Ga0157374_10031944 3300013296 Bacteria 4790
152 Ga0157374_10078578 3300013296 Bacteria 3125
153 Ga0157378_10000121 3300013297 Bacteria 75263
154 Ga0157378_10013627 3300013297 Bacteria 7109
155 Ga0163162_10000012 3300013306 Bacteria 292674
156 Ga0163162_10014555 3300013306 Bacteria 7687
157 Ga0157372_10002460 3300013307 Bacteria 20067
158 Ga0157372_10003372 3300013307 Bacteria 17233
159 Ga0157372_10003996 3300013307 Bacteria 15821
160 Ga0157372_10018181 3300013307 Bacteria 7557
161 Ga0157372_10048760 3300013307 Bacteria 4708
162 Ga0157372_10066581 3300013307 Bacteria 4047
163 Ga0157372_10070552 3300013307 Bacteria 3931
164 Ga0157372_10187650 3300013307 Bacteria 2394
165 Ga0157375_10004936 3300013308 Bacteria 11601
166 Ga0157376_10002663 3300014969 Bacteria 12137
167 Ga0157376_10037824 3300014969 Bacteria 3922
168 Ga0182005_1010804 3300015265 Bacteria 2618
169 Ga0209437_100262 3300025233 Bacteria 81344
170 Ga0209026_1004337 3300025250 Bacteria 4250
171 Ga0209129_1011175 3300025258 Bacteria 2167
172 Ga0209455_1009132 3300025272 Bacteria 2628
173 Ga0207656_10045817 3300025321 Unclassified 1873
174 Ga0207692_10074134 3300025898 Bacteria 1803
175 Ga0207642_10001957 3300025899 Bacteria 6354
176 Ga0207647_10000231 3300025904 Bacteria 46261
177 Ga0207645_10000229 3300025907 Bacteria 46502
178 Ga0207645_10019424 3300025907 Bacteria 4454
179 Ga0207705_10000026 3300025909 Bacteria 256051
180 Ga0207705_10070890 3300025909 Bacteria 2526
181 Ga0207654_10001012 3300025911 Bacteria 15381
182 Ga0207654_10002331 3300025911 Bacteria 9744
183 Ga0207654_10019560 3300025911 Bacteria 3576
184 Ga0207707_10003830 3300025912 Bacteria 13330
185 Ga0207707_10006867 3300025912 Bacteria 9926
186 Ga0207707_10040095 3300025912 Bacteria 4092
187 Ga0207695_10000142 3300025913 Bacteria 214715
188 Ga0207695_10013341 3300025913 Bacteria 9806
189 Ga0207695_10017626 3300025913 Bacteria 8299
190 Ga0207695_10025045 3300025913 Bacteria 6692
191 Ga0207695_10025321 3300025913 Bacteria 6646
192 Ga0207695_10101172 3300025913 Bacteria 2877
193 Ga0207695_10143641 3300025913 Bacteria 2332
194 Ga0207671_10000110 3300025914 Bacteria 126480
195 Ga0207671_10000815 3300025914 Bacteria 39441
196 Ga0207671_10001918 3300025914 Bacteria 23087
197 Ga0207671_10004491 3300025914 Bacteria 13287
198 Ga0207671_10010705 3300025914 Bacteria 7542
199 Ga0207671_10014423 3300025914 Bacteria 6246
200 Ga0207671_10060055 3300025914 Bacteria 2820
201 Ga0207693_10024114 3300025915 Bacteria 4830
202 Ga0207663_10023893 3300025916 Bacteria 3515
203 Ga0207663_10057937 3300025916 Bacteria 2443
204 Ga0207660_10005575 3300025917 Bacteria 8176
205 Ga0207657_10046812 3300025919 Bacteria 3787
206 Ga0207652_10004129 3300025921 Bacteria 11851
207 Ga0207652_10034677 3300025921 Bacteria 4254
208 Ga0207652_10103559 3300025921 Bacteria 2516
209 Ga0207694_10017090 3300025924 Bacteria 5481
210 Ga0207694_10024962 3300025924 Bacteria 4541
211 Ga0207694_10071503 3300025924 Bacteria 2711
212 Ga0207694_10124089 3300025924 Bacteria 2064
213 Ga0207650_10002753 3300025925 Bacteria 12132
214 Ga0207687_10119811 3300025927 Bacteria 1966
215 Ga0207700_10182623 3300025928 Bacteria 1758
216 Ga0207664_10021903 3300025929 Unclassified 4762
217 Ga0207664_10026695 3300025929 Bacteria 4367
218 Ga0207690_10021533 3300025932 Bacteria 3999
219 Ga0207706_10001203 3300025933 Bacteria 26147
220 Ga0207706_10017411 3300025933 Bacteria 6473
221 Ga0207709_10027926 3300025935 Bacteria 3257
222 Ga0207704_10000047 3300025938 Bacteria 84386
223 Ga0207665_10001232 3300025939 Bacteria 17250
224 Ga0207689_10008260 3300025942 Bacteria 9072
225 Ga0207661_10027552 3300025944 Bacteria 4341
226 Ga0207661_10083363 3300025944 Bacteria 2645
227 Ga0207661_10085952 3300025944 Bacteria 2609
228 Ga0207679_10014370 3300025945 Bacteria 5205
229 Ga0207667_10000015 3300025949 Bacteria 417534
230 Ga0207667_10000311 3300025949 Bacteria 67671
231 Ga0207667_10000953 3300025949 Bacteria 36919
232 Ga0207667_10028587 3300025949 Bacteria 6054
233 Ga0207667_10037921 3300025949 Bacteria 5150
234 Ga0207667_10049392 3300025949 Bacteria 4443
235 Ga0207667_10080665 3300025949 Bacteria 3371
236 Ga0207667_10097279 3300025949 Bacteria 3038
237 Ga0207651_10009099 3300025960 Bacteria 5408
238 Ga0207640_10004803 3300025981 Bacteria 7344
239 Ga0207640_10078067 3300025981 Bacteria 2252
240 Ga0207677_10004894 3300026023 Bacteria 7231
241 Ga0207677_10009184 3300026023 Bacteria 5553
242 Ga0207677_10027229 3300026023 Bacteria 3597
243 Ga0207677_10050850 3300026023 Bacteria 2806
244 Ga0207677_10075580 3300026023 Bacteria 2395
245 Ga0207703_10005831 3300026035 Bacteria 9866
246 Ga0207703_10019406 3300026035 Bacteria 5312
247 Ga0207703_10025253 3300026035 Bacteria 4673
248 Ga0207703_10118920 3300026035 Bacteria 2266
249 Ga0207639_10046326 3300026041 Bacteria 3281
250 Ga0207639_10069759 3300026041 Bacteria 2743
251 Ga0207639_10080401 3300026041 Bacteria 2578
252 Ga0207678_10060657 3300026067 Bacteria 3253
253 Ga0207702_10000163 3300026078 Bacteria 79263
254 Ga0207702_10001803 3300026078 Bacteria 21088
255 Ga0207702_10004790 3300026078 Bacteria 11926
256 Ga0207702_10005756 3300026078 Bacteria 10785
257 Ga0207702_10018916 3300026078 Bacteria 5698
258 Ga0207702_10031986 3300026078 Bacteria 4388
259 Ga0207641_10013916 3300026088 Bacteria 6598
260 Ga0207648_10001813 3300026089 Bacteria 23430
261 Ga0207648_10032822 3300026089 Bacteria 4581
262 Ga0207676_10002019 3300026095 Bacteria 14768
263 Ga0207674_10001717 3300026116 Bacteria 28034
264 Ga0207674_10043465 3300026116 Bacteria 4633
265 Ga0207683_10001294 3300026121 Bacteria 22621
266 Ga0207698_10010879 3300026142 Bacteria 5874
267 Ga0207698_10247764 3300026142 Bacteria 1628
268 Ga0268266_10000121 3300028379 Bacteria 154995
269 Ga0268264_10014314 3300028381 Bacteria 6523
270 Ga0307517_10000198 3300028786 Bacteria 102181
271 Ga0307515_10000081 3300028794 Bacteria 224753
272 Ga0307515_10008521 3300028794 Bacteria 19968
273 Ga0307509_10032359 3300031507 Bacteria 5763
274 Ga0307412_10145233 3300031911 Bacteria 1743
275 Ga0307507_10000078 3300033179 Bacteria 151026
276 Ga0307510_10051124 3300033180 Bacteria 4375
277 Ga0373926_0000895 3300035083 Bacteria 8561
278 Ga0373935_0055172 3300035692 Bacteria 2532
279 Ga0373927_0022535 3300035695 Bacteria 4126
280 Ga0373947_0035749 3300035725 Bacteria 2942
281 Ga0373925_0002780 3300037068 Bacteria 13827
282 Ga0373925_0058034 3300037068 Bacteria 2901
283 Ga0395899_0019326 3300037312 Bacteria 5176
284 Ga0395900_0000140 3300037418 Bacteria 121917
285 Ga0395900_0000275 3300037418 Bacteria 78207
286 Ga0395900_0011378 3300037418 Bacteria 9106
287 Ga0395898_0001454 3300037466 Bacteria 33553
288 Ga0395898_0085054 3300037466 Bacteria 3049
289 Ga0395905_0000248 3300037471 Bacteria 81042
290 Ga0395905_0009775 3300037471 Bacteria 9353
291 Ga0436364_1450020 3300037853 Bacteria 3836
292 Ga0395901_0000145 3300038443 Bacteria 91739
293 Ga0395901_0007206 3300038443 Bacteria 11216
294 Ga0436361_1205912 3300039447 Bacteria 6506
295 Ga0436363_1344398 3300039450 Bacteria 2985
296 Ga0466963_0043294 3300044694 Bacteria 2960
297 Ga0466967_0026328 3300045976 Bacteria 4816
298 Ga0495650_0001672 3300046471 Bacteria 20481
299 Ga0495580_0007691 3300046472 Bacteria 8641
300 Ga0495580_0019237 3300046472 Bacteria 5074
301 Ga0495580_0031015 3300046472 Bacteria 3866
302 Ga0495582_0012742 3300046473 Bacteria 4633
303 Ga0495585_0000323 3300046492 Bacteria 47094
304 Ga0495585_0000359 3300046492 Bacteria 44166
305 Ga0495583_0009149 3300046506 Bacteria 5953
306 Ga0495606_0000074 3300046507 Bacteria 170848
307 Ga0495606_0004155 3300046507 Bacteria 14678
308 Ga0495606_0009273 3300046507 Bacteria 8352
309 Ga0495606_0018110 3300046507 Bacteria 5294
310 Ga0495610_0004515 3300046512 Bacteria 10250
311 Ga0495630_0243450 3300046517 Bacteria 1374
312 Ga0495631_0115052 3300046518 Bacteria 1156
313 Ga0495648_0014368 3300046524 Bacteria 5799
314 Ga0495666_0057643 3300046526 Bacteria 1859
315 Ga0495654_0046546 3300046530 Bacteria 2136
316 Ga0495665_0001842 3300046531 Bacteria 11452
317 Ga0495609_0002134 3300046538 Bacteria 12437
318 Ga0495633_0000006 3300046558 Bacteria 326774
319 Ga0495633_0010534 3300046558 Bacteria 5041
320 Ga0495668_0000011 3300046616 Bacteria 472186
321 Ga0495625_0000270 3300046660 Bacteria 80894
322 Ga0495625_0000462 3300046660 Bacteria 60985
323 Ga0495625_0003734 3300046660 Bacteria 14825
324 Ga0495625_0037574 3300046660 Bacteria 3552
325 Ga0495658_0026361 3300046683 Bacteria 3114
326 Ga0495649_0000082 3300046694 Bacteria 82099
327 Ga0495687_002555 3300047443 Bacteria 14392
328 Ga0495684_0044804 3300047471 Bacteria 3386
329 Ga0495686_0001903 3300047472 Bacteria 20836
330 Ga0495614_0060302 3300048089 Bacteria 1630
331 Ga0496102_0019514 3300048905 Bacteria 5972
332 Ga0496103_0067991 3300048906 Bacteria 2226
333 Ga0496105_0135984 3300048908 Bacteria 2025
334 Ga0496109_0131064 3300048912 Bacteria 2340
335 Ga0496112_0136869 3300048915 Bacteria 2419
336 Ga0496112_0182064 3300048915 Unclassified 2065
337 Ga0496112_0267985 3300048915 Unclassified 1656
338 Ga0496113_0089472 3300048916 Unclassified 2370
339 Ga0495682_0028877 3300049460 Bacteria 2054
340 nmdc:mga0k408_561_c1 3300050493 Bacteria 20467
341 nmdc:mga0k408_609_c1 3300050493 Bacteria 19796
342 nmdc:mga08x19_2234_c1 3300050514 Bacteria 11824
343 Ga0500608_000630 3300053122 Bacteria 12952
344 Ga0500618_000148 3300053125 Bacteria 58264
345 Ga0500642_0009248 3300053130 Bacteria 3410

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025921 Ga0207652_10103559 Ga0207652_101035592 363
2 3300046518 Ga0495631_0115052 Ga0495631_0115052_21_1112 363
3 3300046507 Ga0495606_0018110 Ga0495606_0018110_769_2115 383
4 3300025907 Ga0207645_10019424 Ga0207645_100194243 384
5 3300026067 Ga0207678_10060657 Ga0207678_100606572 384
6 3300005327 Ga0070658_10064218 Ga0070658_100642182 385
7 3300005355 Ga0070671_100076596 Ga0070671_1000765962 385
8 3300046660 Ga0495625_0003734 Ga0495625_0003734_9032_10378 390
9 3300005329 Ga0070683_100020085 Ga0070683_1000200854 398
10 3300005535 Ga0070684_100004101 Ga0070684_1000041017 398
11 3300025898 Ga0207692_10074134 Ga0207692_100741342 398
12 3300025944 Ga0207661_10083363 Ga0207661_100833632 398
13 3300005563 Ga0068855_100158389 Ga0068855_1001583893 401
14 3300013105 Ga0157369_10070658 Ga0157369_100706584 401
15 3300009174 Ga0105241_10046364 Ga0105241_100463645 404
16 3300005338 Ga0068868_100088239 Ga0068868_1000882391 406
17 3300005518 Ga0070699_100020400 Ga0070699_1000204002 406
18 3300005458 Ga0070681_10000672 Ga0070681_1000067225 407
19 3300005535 Ga0070684_100028348 Ga0070684_1000283485 407
20 3300005539 Ga0068853_100021912 Ga0068853_1000219125 407
21 3300005563 Ga0068855_100004995 Ga0068855_1000049955 407
22 3300005577 Ga0068857_100067925 Ga0068857_1000679254 407
23 3300005578 Ga0068854_100031805 Ga0068854_1000318053 407
24 3300005614 Ga0068856_100003296 Ga0068856_10000329612 407
25 3300005834 Ga0068851_10043626 Ga0068851_100436262 407
26 3300005842 Ga0068858_100068348 Ga0068858_1000683485 407
27 3300006237 Ga0097621_100001137 Ga0097621_10000113710 407
28 3300006358 Ga0068871_100002001 Ga0068871_1000020015 407
29 3300009093 Ga0105240_10044224 Ga0105240_100442246 407
30 3300009551 Ga0105238_10000339 Ga0105238_100003395 407
31 3300010375 Ga0105239_10020086 Ga0105239_100200865 407
32 3300013105 Ga0157369_10000269 Ga0157369_100002695 407
33 3300013296 Ga0157374_10031944 Ga0157374_100319443 407
34 3300013297 Ga0157378_10013627 Ga0157378_100136278 407
35 3300013307 Ga0157372_10003996 Ga0157372_100039965 407
36 3300014969 Ga0157376_10037824 Ga0157376_100378244 407
37 3300025321 Ga0207656_10045817 Ga0207656_100458172 407
38 3300025912 Ga0207707_10003830 Ga0207707_100038305 407
39 3300025913 Ga0207695_10143641 Ga0207695_101436413 407
40 3300025921 Ga0207652_10034677 Ga0207652_100346774 407
41 3300025924 Ga0207694_10017090 Ga0207694_100170903 407
42 3300025949 Ga0207667_10000311 Ga0207667_1000031154 407
43 3300026035 Ga0207703_10019406 Ga0207703_100194065 407
44 3300026041 Ga0207639_10046326 Ga0207639_100463262 407
45 3300026078 Ga0207702_10004790 Ga0207702_100047901 407
46 3300026116 Ga0207674_10043465 Ga0207674_100434655 407
47 3300047471 Ga0495684_0044804 Ga0495684_0044804_151_1590 407
48 3300048905 Ga0496102_0019514 Ga0496102_0019514_2129_3556 407
49 3300048916 Ga0496113_0089472 Ga0496113_0089472_202_1629 407
50 3300005339 Ga0070660_100084899 Ga0070660_1000848991 408
51 3300005437 Ga0070710_10045524 Ga0070710_100455242 408
52 3300005439 Ga0070711_100058396 Ga0070711_1000583964 408
53 3300006028 Ga0070717_10052063 Ga0070717_100520635 408
54 3300025916 Ga0207663_10057937 Ga0207663_100579373 408
55 3300037068 Ga0373925_0058034 Ga0373925_0058034_1123_2502 408
56 3300044694 Ga0466963_0043294 Ga0466963_0043294_1557_2879 408
57 3300026035 Ga0207703_10025253 Ga0207703_100252532 409
58 3300045976 Ga0466967_0026328 Ga0466967_0026328_152_1573 409
59 3300005841 Ga0068863_100111529 Ga0068863_1001115291 410
60 3300009177 Ga0105248_10087575 Ga0105248_100875751 410
61 3300048912 Ga0496109_0131064 Ga0496109_0131064_70_1440 410
62 3300005578 Ga0068854_100016730 Ga0068854_1000167305 411
63 3300025981 Ga0207640_10078067 Ga0207640_100780673 411
64 3300026023 Ga0207677_10050850 Ga0207677_100508501 411
65 3300005535 Ga0070684_100008449 Ga0070684_10000844910 412
66 3300005539 Ga0068853_100049747 Ga0068853_1000497471 412
67 3300005563 Ga0068855_100022662 Ga0068855_1000226625 412
68 3300005614 Ga0068856_100005418 Ga0068856_1000054185 412
69 3300005618 Ga0068864_100009168 Ga0068864_1000091685 412
70 3300005841 Ga0068863_100049305 Ga0068863_1000493055 412
71 3300005842 Ga0068858_100067844 Ga0068858_1000678443 412
72 3300006237 Ga0097621_100005864 Ga0097621_1000058647 412
73 3300006358 Ga0068871_100003610 Ga0068871_1000036102 412
74 3300013307 Ga0157372_10187650 Ga0157372_101876502 412
75 3300025933 Ga0207706_10017411 Ga0207706_100174115 412
76 3300025944 Ga0207661_10085952 Ga0207661_100859522 412
77 3300026023 Ga0207677_10004894 Ga0207677_100048945 412
78 3300026041 Ga0207639_10080401 Ga0207639_100804013 412
79 3300026078 Ga0207702_10001803 Ga0207702_1000180311 412
80 3300026088 Ga0207641_10013916 Ga0207641_100139165 412
81 3300013307 Ga0157372_10066581 Ga0157372_100665814 414
82 3300005539 Ga0068853_100064644 Ga0068853_1000646445 415
83 3300005614 Ga0068856_100092064 Ga0068856_1000920642 415
84 3300013296 Ga0157374_10078578 Ga0157374_100785784 415
85 3300015265 Ga0182005_1010804 Ga0182005_10108042 415
86 3300025919 Ga0207657_10046812 Ga0207657_100468122 415
87 3300025932 Ga0207690_10021533 Ga0207690_100215335 415
88 3300048906 Ga0496103_0067991 Ga0496103_0067991_135_1502 415
89 3300048908 Ga0496105_0135984 Ga0496105_0135984_223_1593 415
90 3300005457 Ga0070662_100053614 Ga0070662_1000536142 417
91 3300025928 Ga0207700_10182623 Ga0207700_101826232 417
92 3300009174 Ga0105241_10004801 Ga0105241_100048019 419
93 3300013307 Ga0157372_10018181 Ga0157372_100181814 419
94 3300026078 Ga0207702_10005756 Ga0207702_100057565 419
95 3300048915 Ga0496112_0267985 Ga0496112_0267985_227_1558 419
96 3300025909 Ga0207705_10070890 Ga0207705_100708902 420
97 3300046473 Ga0495582_0012742 Ga0495582_0012742_3335_4621 421
98 3300046517 Ga0495630_0243450 Ga0495630_0243450_16_1302 421
99 3300005436 Ga0070713_100020596 Ga0070713_1000205964 426
100 3300005468 Ga0070707_100055870 Ga0070707_1000558702 426
101 3300006028 Ga0070717_10017106 Ga0070717_100171062 426
102 3300006914 Ga0075436_100002588 Ga0075436_1000025887 426
103 3300007076 Ga0075435_100003661 Ga0075435_1000036619 426
104 3300025915 Ga0207693_10024114 Ga0207693_100241142 426
105 3300025929 Ga0207664_10021903 Ga0207664_100219037 426
106 3300025939 Ga0207665_10001232 Ga0207665_1000123212 426
107 3300035083 Ga0373926_0000895 Ga0373926_0000895_6151_7608 426
108 3300035695 Ga0373927_0022535 Ga0373927_0022535_30_1358 426
109 3300035725 Ga0373947_0035749 Ga0373947_0035749_1050_2507 426
110 3300037068 Ga0373925_0002780 Ga0373925_0002780_2963_4420 426
111 3300037853 Ga0436364_1450020 Ga0436364_1450020_1808_3139 426
112 3300039450 Ga0436363_1344398 Ga0436363_1344398_707_2038 426
113 3300046472 Ga0495580_0007691 Ga0495580_0007691_5997_7454 426
114 3300046472 Ga0495580_0019237 Ga0495580_0019237_191_1546 426
115 3300046472 Ga0495580_0031015 Ga0495580_0031015_986_2335 426
116 3300046526 Ga0495666_0057643 Ga0495666_0057643_169_1626 426
117 3300046531 Ga0495665_0001842 Ga0495665_0001842_5128_6585 426
118 3300048915 Ga0496112_0182064 Ga0496112_0182064_147_1607 426
119 3300050514 nmdc:mga08x19_2234_c1 nmdc:mga08x19_2234_c1_4127_5584 426
120 3300005329 Ga0070683_100018480 Ga0070683_1000184804 427
121 3300005334 Ga0068869_100001760 Ga0068869_1000017605 427
122 3300005435 Ga0070714_100098024 Ga0070714_1000980241 427
123 3300005436 Ga0070713_100222210 Ga0070713_1002222101 427
124 3300005439 Ga0070711_100010890 Ga0070711_1000108904 427
125 3300005445 Ga0070708_100003211 Ga0070708_1000032118 427
126 3300005458 Ga0070681_10002267 Ga0070681_1000226716 427
127 3300005459 Ga0068867_100033250 Ga0068867_1000332504 427
128 3300005530 Ga0070679_100149157 Ga0070679_1001491572 427
129 3300005545 Ga0070695_100087561 Ga0070695_1000875611 427
130 3300005563 Ga0068855_100033941 Ga0068855_1000339414 427
131 3300005563 Ga0068855_100164577 Ga0068855_1001645772 427
132 3300005564 Ga0070664_100002954 Ga0070664_10000295414 427
133 3300005577 Ga0068857_100000154 Ga0068857_1000001545 427
134 3300005578 Ga0068854_100006297 Ga0068854_1000062973 427
135 3300005614 Ga0068856_100000612 Ga0068856_1000006123 427
136 3300005614 Ga0068856_100013472 Ga0068856_1000134727 427
137 3300005718 Ga0068866_10005626 Ga0068866_100056261 427
138 3300005842 Ga0068858_100000491 Ga0068858_1000004914 427
139 3300005843 Ga0068860_100085910 Ga0068860_1000859103 427
140 3300006028 Ga0070717_10008717 Ga0070717_100087172 427
141 3300006028 Ga0070717_10015203 Ga0070717_100152032 427
142 3300006028 Ga0070717_10115948 Ga0070717_101159482 427
143 3300009098 Ga0105245_10143772 Ga0105245_101437722 427
144 3300009545 Ga0105237_10007468 Ga0105237_100074683 427
145 3300013100 Ga0157373_10020769 Ga0157373_100207694 427
146 3300013100 Ga0157373_10047342 Ga0157373_100473423 427
147 3300013104 Ga0157370_10014756 Ga0157370_100147569 427
148 3300013105 Ga0157369_10027888 Ga0157369_100278888 427
149 3300013296 Ga0157374_10000384 Ga0157374_1000038434 427
150 3300013297 Ga0157378_10000121 Ga0157378_100001215 427
151 3300013307 Ga0157372_10002460 Ga0157372_100024604 427
152 3300013307 Ga0157372_10048760 Ga0157372_100487602 427
153 3300013307 Ga0157372_10070552 Ga0157372_100705524 427
154 3300025899 Ga0207642_10001957 Ga0207642_100019572 427
155 3300025912 Ga0207707_10006867 Ga0207707_100068673 427
156 3300025913 Ga0207695_10025321 Ga0207695_100253217 427
157 3300025913 Ga0207695_10101172 Ga0207695_101011722 427
158 3300025916 Ga0207663_10023893 Ga0207663_100238932 427
159 3300025925 Ga0207650_10002753 Ga0207650_100027539 427
160 3300025927 Ga0207687_10119811 Ga0207687_101198112 427
161 3300025929 Ga0207664_10026695 Ga0207664_100266952 427
162 3300025942 Ga0207689_10008260 Ga0207689_100082605 427
163 3300025944 Ga0207661_10027552 Ga0207661_100275521 427
164 3300025945 Ga0207679_10014370 Ga0207679_100143705 427
165 3300025949 Ga0207667_10028587 Ga0207667_100285874 427
166 3300025949 Ga0207667_10097279 Ga0207667_100972793 427
167 3300025981 Ga0207640_10004803 Ga0207640_100048033 427
168 3300026023 Ga0207677_10009184 Ga0207677_100091845 427
169 3300026035 Ga0207703_10005831 Ga0207703_100058311 427
170 3300026078 Ga0207702_10018916 Ga0207702_100189165 427
171 3300026078 Ga0207702_10031986 Ga0207702_100319863 427
172 3300026089 Ga0207648_10032822 Ga0207648_100328224 427
173 3300026095 Ga0207676_10002019 Ga0207676_100020199 427
174 3300026116 Ga0207674_10001717 Ga0207674_100017175 427
175 3300026142 Ga0207698_10247764 Ga0207698_102477642 427
176 3300028381 Ga0268264_10014314 Ga0268264_100143142 427
177 3300035692 Ga0373935_0055172 Ga0373935_0055172_1041_2399 427
178 3300048915 Ga0496112_0136869 Ga0496112_0136869_91_1521 427
179 3300014969 Ga0157376_10002663 Ga0157376_100026637 428
180 3300001990 JGI24737J22298_10000681 JGI24737J22298_100006813 432
181 3300002067 JGI24735J21928_10000005 JGI24735J21928_100000057 432
182 3300002737 JGI25162J39368_1000016 JGI25162J39368_100001665 432
183 3300003316 rootH1_10000713 rootH1_100007131 432
184 3300005563 Ga0068855_100009255 Ga0068855_10000925511 432
185 3300005563 Ga0068855_100045502 Ga0068855_1000455024 432
186 3300006195 Ga0075366_10000717 Ga0075366_100007173 432
187 3300006195 Ga0075366_10024059 Ga0075366_100240593 432
188 3300009545 Ga0105237_10003032 Ga0105237_100030323 432
189 3300009545 Ga0105237_10045474 Ga0105237_100454743 432
190 3300010375 Ga0105239_10002716 Ga0105239_1000271615 432
191 3300010375 Ga0105239_10003051 Ga0105239_1000305116 432
192 3300010375 Ga0105239_10075879 Ga0105239_100758792 432
193 3300013102 Ga0157371_10045690 Ga0157371_100456901 432
194 3300013105 Ga0157369_10241101 Ga0157369_102411012 432
195 3300013306 Ga0163162_10014555 Ga0163162_100145559 432
196 3300013307 Ga0157372_10003372 Ga0157372_1000337211 432
197 3300013308 Ga0157375_10004936 Ga0157375_100049362 432
198 3300025233 Ga0209437_100262 Ga0209437_10026263 432
199 3300025258 Ga0209129_1011175 Ga0209129_10111751 432
200 3300025914 Ga0207671_10001918 Ga0207671_100019186 432
201 3300025914 Ga0207671_10004491 Ga0207671_100044913 432
202 3300025949 Ga0207667_10037921 Ga0207667_100379213 432
203 3300025949 Ga0207667_10080665 Ga0207667_100806651 432
204 3300028794 Ga0307515_10000081 Ga0307515_1000008124 432
205 3300028794 Ga0307515_10008521 Ga0307515_100085212 432
206 3300033179 Ga0307507_10000078 Ga0307507_100000788 432
207 3300046471 Ga0495650_0001672 Ga0495650_0001672_9016_10362 432
208 3300046492 Ga0495585_0000323 Ga0495585_0000323_17526_18872 432
209 3300046492 Ga0495585_0000359 Ga0495585_0000359_8575_9921 432
210 3300046506 Ga0495583_0009149 Ga0495583_0009149_1310_2656 432
211 3300046507 Ga0495606_0000074 Ga0495606_0000074_9617_10996 432
212 3300046507 Ga0495606_0009273 Ga0495606_0009273_3310_4656 432
213 3300046512 Ga0495610_0004515 Ga0495610_0004515_2152_3498 432
214 3300046524 Ga0495648_0014368 Ga0495648_0014368_3374_4720 432
215 3300046530 Ga0495654_0046546 Ga0495654_0046546_115_1461 432
216 3300046538 Ga0495609_0002134 Ga0495609_0002134_9484_10830 432
217 3300046558 Ga0495633_0000006 Ga0495633_0000006_229893_231269 432
218 3300046558 Ga0495633_0010534 Ga0495633_0010534_2601_3947 432
219 3300046616 Ga0495668_0000011 Ga0495668_0000011_207045_208391 432
220 3300046660 Ga0495625_0000270 Ga0495625_0000270_70506_71852 432
221 3300046660 Ga0495625_0000462 Ga0495625_0000462_34554_35900 432
222 3300046660 Ga0495625_0037574 Ga0495625_0037574_344_1690 432
223 3300046683 Ga0495658_0026361 Ga0495658_0026361_1460_2806 432
224 3300046694 Ga0495649_0000082 Ga0495649_0000082_71726_73072 432
225 3300048089 Ga0495614_0060302 Ga0495614_0060302_109_1455 432
226 3300049460 Ga0495682_0028877 Ga0495682_0028877_471_1817 432
227 3300050493 nmdc:mga0k408_561_c1 nmdc:mga0k408_561_c1_18209_19555 432
228 3300050493 nmdc:mga0k408_609_c1 nmdc:mga0k408_609_c1_14174_15520 432
229 3300053125 Ga0500618_000148 Ga0500618_000148_53777_55123 432
230 iso_pu_bacteria 2599185184 2599481934 432
231 iso_pu_bacteria 2919437846 2919440410 432
232 iso_pu_bacteria 2928078545 2928084093 432
233 iso_pu_bacteria 2928147474 2928152860 432
234 iso_pu_bacteria 2932082852 2932088457 432
235 3300047472 Ga0495686_0001903 Ga0495686_0001903_1535_2941 433
236 3300001904 JGI24736J21556_1001857 JGI24736J21556_10018572 434
237 3300001990 JGI24737J22298_10003893 JGI24737J22298_100038932 434
238 3300001991 JGI24743J22301_10004792 JGI24743J22301_100047922 434
239 3300003320 rootH2_10012714 rootH2_1001271412 434
240 3300003320 rootH2_10113384 rootH2_101133843 434
241 3300003323 rootH1_10012646 rootH1_1001264610 434
242 3300003323 rootH1_10028786 rootH1_100287865 434
243 3300005327 Ga0070658_10000008 Ga0070658_10000008164 434
244 3300005327 Ga0070658_10026346 Ga0070658_100263462 434
245 3300005328 Ga0070676_10002139 Ga0070676_100021392 434
246 3300005336 Ga0070680_100043669 Ga0070680_1000436693 434
247 3300005338 Ga0068868_100030713 Ga0068868_1000307131 434
248 3300005338 Ga0068868_100046766 Ga0068868_1000467663 434
249 3300005339 Ga0070660_100036082 Ga0070660_1000360822 434
250 3300005364 Ga0070673_100044406 Ga0070673_1000444062 434
251 3300005456 Ga0070678_100004429 Ga0070678_1000044292 434
252 3300005457 Ga0070662_100000790 Ga0070662_1000007903 434
253 3300005459 Ga0068867_100001754 Ga0068867_10000175413 434
254 3300005530 Ga0070679_100056216 Ga0070679_1000562163 434
255 3300005539 Ga0068853_100005185 Ga0068853_1000051853 434
256 3300005539 Ga0068853_100113435 Ga0068853_1001134351 434
257 3300005539 Ga0068853_100214192 Ga0068853_1002141922 434
258 3300005548 Ga0070665_100000118 Ga0070665_10000011877 434
259 3300005563 Ga0068855_100000155 Ga0068855_10000015539 434
260 3300005563 Ga0068855_100002647 Ga0068855_1000026478 434
261 3300005563 Ga0068855_100396462 Ga0068855_1003964621 434
262 3300005614 Ga0068856_100000371 Ga0068856_10000037123 434
263 3300005616 Ga0068852_100025919 Ga0068852_1000259194 434
264 3300006237 Ga0097621_100000174 Ga0097621_10000017427 434
265 3300006358 Ga0068871_100000060 Ga0068871_10000006038 434
266 3300006881 Ga0068865_100000345 Ga0068865_10000034529 434
267 3300009093 Ga0105240_10000371 Ga0105240_1000037122 434
268 3300009093 Ga0105240_10004289 Ga0105240_100042897 434
269 3300009093 Ga0105240_10008014 Ga0105240_100080143 434
270 3300009093 Ga0105240_10017291 Ga0105240_100172912 434
271 3300009174 Ga0105241_10003593 Ga0105241_100035939 434
272 3300009174 Ga0105241_10004960 Ga0105241_100049602 434
273 3300009174 Ga0105241_10026855 Ga0105241_100268553 434
274 3300009176 Ga0105242_10063003 Ga0105242_100630032 434
275 3300009545 Ga0105237_10000632 Ga0105237_1000063242 434
276 3300009545 Ga0105237_10001840 Ga0105237_1000184010 434
277 3300009545 Ga0105237_10002057 Ga0105237_1000205727 434
278 3300009545 Ga0105237_10002169 Ga0105237_100021693 434
279 3300009545 Ga0105237_10104739 Ga0105237_101047393 434
280 3300009551 Ga0105238_10040527 Ga0105238_100405272 434
281 3300009551 Ga0105238_10047634 Ga0105238_100476341 434
282 3300009551 Ga0105238_10085256 Ga0105238_100852563 434
283 3300010375 Ga0105239_10000166 Ga0105239_1000016671 434
284 3300010375 Ga0105239_10001606 Ga0105239_1000160626 434
285 3300010375 Ga0105239_10002482 Ga0105239_1000248225 434
286 3300010375 Ga0105239_10051980 Ga0105239_100519802 434
287 3300011119 Ga0105246_10017539 Ga0105246_100175392 434
288 3300011119 Ga0105246_10101250 Ga0105246_101012502 434
289 3300013296 Ga0157374_10000742 Ga0157374_100007426 434
290 3300013296 Ga0157374_10002065 Ga0157374_100020655 434
291 3300013296 Ga0157374_10010475 Ga0157374_100104752 434
292 3300013306 Ga0163162_10000012 Ga0163162_1000001289 434
293 3300025250 Ga0209026_1004337 Ga0209026_10043372 434
294 3300025272 Ga0209455_1009132 Ga0209455_10091322 434
295 3300025904 Ga0207647_10000231 Ga0207647_1000023141 434
296 3300025907 Ga0207645_10000229 Ga0207645_100002292 434
297 3300025909 Ga0207705_10000026 Ga0207705_10000026165 434
298 3300025911 Ga0207654_10001012 Ga0207654_1000101214 434
299 3300025911 Ga0207654_10002331 Ga0207654_100023314 434
300 3300025911 Ga0207654_10019560 Ga0207654_100195602 434
301 3300025912 Ga0207707_10040095 Ga0207707_100400952 434
302 3300025913 Ga0207695_10000142 Ga0207695_1000014261 434
303 3300025913 Ga0207695_10013341 Ga0207695_100133419 434
304 3300025913 Ga0207695_10017626 Ga0207695_100176262 434
305 3300025913 Ga0207695_10025045 Ga0207695_100250455 434
306 3300025914 Ga0207671_10000110 Ga0207671_1000011042 434
307 3300025914 Ga0207671_10000815 Ga0207671_1000081510 434
308 3300025914 Ga0207671_10010705 Ga0207671_100107052 434
309 3300025914 Ga0207671_10014423 Ga0207671_100144232 434
310 3300025914 Ga0207671_10060055 Ga0207671_100600553 434
311 3300025917 Ga0207660_10005575 Ga0207660_100055755 434
312 3300025921 Ga0207652_10004129 Ga0207652_100041297 434
313 3300025924 Ga0207694_10024962 Ga0207694_100249621 434
314 3300025924 Ga0207694_10071503 Ga0207694_100715033 434
315 3300025924 Ga0207694_10124089 Ga0207694_101240892 434
316 3300025933 Ga0207706_10001203 Ga0207706_1000120315 434
317 3300025935 Ga0207709_10027926 Ga0207709_100279262 434
318 3300025938 Ga0207704_10000047 Ga0207704_1000004772 434
319 3300025949 Ga0207667_10000015 Ga0207667_10000015244 434
320 3300025949 Ga0207667_10000953 Ga0207667_1000095313 434
321 3300025949 Ga0207667_10049392 Ga0207667_100493925 434
322 3300025960 Ga0207651_10009099 Ga0207651_100090992 434
323 3300026023 Ga0207677_10027229 Ga0207677_100272293 434
324 3300026023 Ga0207677_10075580 Ga0207677_100755801 434
325 3300026035 Ga0207703_10118920 Ga0207703_101189202 434
326 3300026041 Ga0207639_10069759 Ga0207639_100697592 434
327 3300026078 Ga0207702_10000163 Ga0207702_1000016340 434
328 3300026089 Ga0207648_10001813 Ga0207648_1000181321 434
329 3300026121 Ga0207683_10001294 Ga0207683_100012948 434
330 3300026142 Ga0207698_10010879 Ga0207698_100108796 434
331 3300028379 Ga0268266_10000121 Ga0268266_1000012179 434
332 3300028786 Ga0307517_10000198 Ga0307517_1000019882 434
333 3300031507 Ga0307509_10032359 Ga0307509_100323592 434
334 3300031911 Ga0307412_10145233 Ga0307412_101452331 434
335 3300033180 Ga0307510_10051124 Ga0307510_100511242 434
336 3300037312 Ga0395899_0019326 Ga0395899_0019326_2581_3933 434
337 3300037418 Ga0395900_0000140 Ga0395900_0000140_112468_113850 434
338 3300037418 Ga0395900_0000275 Ga0395900_0000275_8987_10339 434
339 3300037418 Ga0395900_0011378 Ga0395900_0011378_834_2186 434
340 3300037466 Ga0395898_0001454 Ga0395898_0001454_6030_7382 434
341 3300037466 Ga0395898_0085054 Ga0395898_0085054_613_1965 434
342 3300037471 Ga0395905_0000248 Ga0395905_0000248_39570_40922 434
343 3300037471 Ga0395905_0009775 Ga0395905_0009775_2347_3699 434
344 3300038443 Ga0395901_0000145 Ga0395901_0000145_80154_81506 434
345 3300038443 Ga0395901_0007206 Ga0395901_0007206_1351_2703 434
346 3300039447 Ga0436361_1205912 Ga0436361_1205912_503_1855 434
347 3300046507 Ga0495606_0004155 Ga0495606_0004155_8471_9823 434
348 3300047443 Ga0495687_002555 Ga0495687_002555_6256_7608 434
349 3300053122 Ga0500608_000630 Ga0500608_000630_7289_8641 434
350 3300053130 Ga0500642_0009248 Ga0500642_0009248_1448_2803 434
351 iso_pu_bacteria 2977232053 2977234041 434

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04389

Peptidase_M28

Peptidase family M28

165

389

0.88

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

183

481

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2anp-assembly1.cif.gz_A functional glutamate 151 to histidine mutant of the aminopeptidase from aeromonas proteolytica. 0.8697 4 345
1amp-assembly1.cif.gz_A crystal structure of aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family 0.8615 4 345
3b7i-assembly1.cif.gz_A crystal structure of the s228a mutant of the aminopeptidase from vibrio proteolyticus in complex with leucine phosphonic acid 0.8596 4 345
2anp-assembly1.cif.gz_A functional glutamate 151 to histidine mutant of the aminopeptidase from aeromonas proteolytica. 0.8584 4 345
3b3s-assembly1.cif.gz_A crystal structure of the m180a mutant of the aminopeptidase from vibrio proteolyticus in complex with leucine 0.8568 4 345
ID Description Score Start End Superfamily
1cp6A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8397 4 345 3.40.630.10
1cp6A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8288 4 345 3.40.630.10
af_Q8WZ42_19723_19821_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8167 344 430 2.60.40.10
af_O18023_1307_1414_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8105 345 429 2.60.40.10
af_A0A2R8RVM5_101_187_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8096 346 425 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A519M4J9-F1-model_v4 Fibronectin type III domain-containing protein 0.9942 339 434
AF-A0A4Q3UNM7-F1-model_v4 Fibronectin type-III domain-containing protein 0.9765 349 434
AF-A0A223P210-F1-model_v4 Peptidase M28 0.9718 2 434 GO:0006508
GO:0008235
AF-A0A1V6C3B7-F1-model_v4 Bacterial leucyl aminopeptidase (EC 3.4.11.10) 0.9716 6 430 GO:0004177
GO:0006508
GO:0008235
AF-A0A353R7W0-F1-model_v4 Peptidase M28 0.9693 4 354 GO:0006508
GO:0008235

Feature Viewer

pLDDT pTM Quality
88.7 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map