F418501
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 351 | 182 | 345 | 453 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100018480|Ga0070683_1000184804 |
| Length | 500 |
| Sequence | MGTFIFMFFRDIGQVAPPPNSPGRMATTAQGLPIIKEIMVIMNSRFSNGALRCTLICVCMTLASNYLHAQSDSTDPAIRAALNEISASNVQADIEKLVGFQTRSTLSAQDEASIASGRGIGAAREWIKSEFERYSQNCGGCLEVKTDTFIQPVSERVASPVQITNVYAVLKGTNPKEGSNVVLVTGHYDSRNSSNENVRDPAPGANDDASGTTISLECARVLSKLRFPETIIFLAVAGEEQGLYGSKHFAEFAKAQGWQIEAVLNNDIVGGDKSPGQDAGRVRVFSESIPEDASEREMRMLRALGGENDSPSRELARYVARIAGEYQLPVSPLLEFRRDRYLRGGDHIPFNQAGFAAVRFTEFRENYNHQHQNVRMEKAIEYGDLPKFVDFNYVANVAKVNAATLASLXXXPPPPQNVHLETTELVNDSTLTWDAPTDDRAVSYEVLWRATAAPDWEHSQKFQNTTRATIAVSKDNVFFSVQAMDGSGHKSLPVVPMPER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 3 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 4 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 5 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 6 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 7 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 128 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 129 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 130 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 131 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 132 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 133 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 134 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 135 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 136 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 137 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 139 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 140 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 141 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 142 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 143 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 144 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 145 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 146 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 147 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 148 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 172 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 173 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 174 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 176 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 177 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 179 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 181 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 182 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.29 |
| Metatranscriptomes | 0 |
| Isolates | 1.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.13 |
| Nodule | 0 |
| Rhizoplane | 2.56 |
| Rhizosphere | 89.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1001857 | 3300001904 | Bacteria | 3771 |
| 2 | JGI24737J22298_10000681 | 3300001990 | Bacteria | 11981 |
| 3 | JGI24737J22298_10003893 | 3300001990 | Bacteria | 5243 |
| 4 | JGI24743J22301_10004792 | 3300001991 | Bacteria | 2224 |
| 5 | JGI24735J21928_10000005 | 3300002067 | Bacteria | 356755 |
| 6 | JGI25162J39368_1000016 | 3300002737 | Bacteria | 288734 |
| 7 | rootH1_10000713 | 3300003316 | Bacteria | 3479 |
| 8 | rootH2_10012714 | 3300003320 | Bacteria | 66260 |
| 9 | rootH2_10113384 | 3300003320 | Bacteria | 7920 |
| 10 | rootH1_10012646 | 3300003323 | Bacteria | 62371 |
| 11 | rootH1_10028786 | 3300003323 | Bacteria | 6946 |
| 12 | Ga0070658_10000008 | 3300005327 | Bacteria | 319912 |
| 13 | Ga0070658_10026346 | 3300005327 | Bacteria | 4664 |
| 14 | Ga0070658_10064218 | 3300005327 | Bacteria | 2994 |
| 15 | Ga0070676_10002139 | 3300005328 | Bacteria | 10059 |
| 16 | Ga0070683_100018480 | 3300005329 | Bacteria | 6176 |
| 17 | Ga0070683_100020085 | 3300005329 | Bacteria | 5941 |
| 18 | Ga0068869_100001760 | 3300005334 | Bacteria | 12948 |
| 19 | Ga0070680_100043669 | 3300005336 | Bacteria | 3641 |
| 20 | Ga0068868_100030713 | 3300005338 | Bacteria | 4120 |
| 21 | Ga0068868_100046766 | 3300005338 | Bacteria | 3387 |
| 22 | Ga0068868_100088239 | 3300005338 | Bacteria | 2496 |
| 23 | Ga0070660_100036082 | 3300005339 | Bacteria | 3744 |
| 24 | Ga0070660_100084899 | 3300005339 | Bacteria | 2489 |
| 25 | Ga0070671_100076596 | 3300005355 | Bacteria | 2794 |
| 26 | Ga0070673_100044406 | 3300005364 | Bacteria | 3441 |
| 27 | Ga0070714_100098024 | 3300005435 | Bacteria | 2578 |
| 28 | Ga0070713_100020596 | 3300005436 | Bacteria | 5059 |
| 29 | Ga0070713_100222210 | 3300005436 | Unclassified | 1714 |
| 30 | Ga0070710_10045524 | 3300005437 | Bacteria | 2440 |
| 31 | Ga0070711_100010890 | 3300005439 | Bacteria | 5638 |
| 32 | Ga0070711_100058396 | 3300005439 | Bacteria | 2675 |
| 33 | Ga0070708_100003211 | 3300005445 | Bacteria | 12753 |
| 34 | Ga0070678_100004429 | 3300005456 | Bacteria | 7968 |
| 35 | Ga0070662_100000790 | 3300005457 | Bacteria | 19431 |
| 36 | Ga0070662_100053614 | 3300005457 | Bacteria | 2920 |
| 37 | Ga0070681_10000672 | 3300005458 | Bacteria | 28308 |
| 38 | Ga0070681_10002267 | 3300005458 | Bacteria | 17569 |
| 39 | Ga0068867_100001754 | 3300005459 | Bacteria | 15105 |
| 40 | Ga0068867_100033250 | 3300005459 | Bacteria | 3733 |
| 41 | Ga0070707_100055870 | 3300005468 | Unclassified | 3784 |
| 42 | Ga0070699_100020400 | 3300005518 | Bacteria | 5716 |
| 43 | Ga0070679_100056216 | 3300005530 | Bacteria | 3921 |
| 44 | Ga0070679_100149157 | 3300005530 | Bacteria | 2316 |
| 45 | Ga0070684_100004101 | 3300005535 | Bacteria | 11024 |
| 46 | Ga0070684_100008449 | 3300005535 | Bacteria | 8049 |
| 47 | Ga0070684_100028348 | 3300005535 | Bacteria | 4736 |
| 48 | Ga0068853_100005185 | 3300005539 | Bacteria | 10193 |
| 49 | Ga0068853_100021912 | 3300005539 | Bacteria | 5329 |
| 50 | Ga0068853_100049747 | 3300005539 | Bacteria | 3603 |
| 51 | Ga0068853_100064644 | 3300005539 | Bacteria | 3173 |
| 52 | Ga0068853_100113435 | 3300005539 | Bacteria | 2410 |
| 53 | Ga0068853_100214192 | 3300005539 | Bacteria | 1757 |
| 54 | Ga0070695_100087561 | 3300005545 | Bacteria | 2072 |
| 55 | Ga0070665_100000118 | 3300005548 | Bacteria | 149830 |
| 56 | Ga0068855_100000155 | 3300005563 | Bacteria | 86903 |
| 57 | Ga0068855_100002647 | 3300005563 | Bacteria | 22069 |
| 58 | Ga0068855_100004995 | 3300005563 | Bacteria | 16182 |
| 59 | Ga0068855_100009255 | 3300005563 | Bacteria | 11902 |
| 60 | Ga0068855_100022662 | 3300005563 | Bacteria | 7524 |
| 61 | Ga0068855_100033941 | 3300005563 | Bacteria | 6087 |
| 62 | Ga0068855_100045502 | 3300005563 | Bacteria | 5192 |
| 63 | Ga0068855_100158389 | 3300005563 | Bacteria | 2571 |
| 64 | Ga0068855_100164577 | 3300005563 | Bacteria | 2515 |
| 65 | Ga0068855_100396462 | 3300005563 | Bacteria | 1513 |
| 66 | Ga0070664_100002954 | 3300005564 | Bacteria | 13751 |
| 67 | Ga0068857_100000154 | 3300005577 | Bacteria | 42680 |
| 68 | Ga0068857_100067925 | 3300005577 | Bacteria | 3173 |
| 69 | Ga0068854_100006297 | 3300005578 | Bacteria | 7548 |
| 70 | Ga0068854_100016730 | 3300005578 | Bacteria | 4893 |
| 71 | Ga0068854_100031805 | 3300005578 | Bacteria | 3669 |
| 72 | Ga0068856_100000371 | 3300005614 | Bacteria | 49295 |
| 73 | Ga0068856_100000612 | 3300005614 | Bacteria | 39134 |
| 74 | Ga0068856_100003296 | 3300005614 | Bacteria | 16416 |
| 75 | Ga0068856_100005418 | 3300005614 | Bacteria | 12572 |
| 76 | Ga0068856_100013472 | 3300005614 | Bacteria | 7914 |
| 77 | Ga0068856_100092064 | 3300005614 | Bacteria | 3016 |
| 78 | Ga0068852_100025919 | 3300005616 | Bacteria | 4758 |
| 79 | Ga0068864_100009168 | 3300005618 | Bacteria | 8158 |
| 80 | Ga0068866_10005626 | 3300005718 | Bacteria | 5187 |
| 81 | Ga0068851_10043626 | 3300005834 | Unclassified | 2261 |
| 82 | Ga0068863_100049305 | 3300005841 | Bacteria | 3993 |
| 83 | Ga0068863_100111529 | 3300005841 | Bacteria | 2605 |
| 84 | Ga0068858_100000491 | 3300005842 | Bacteria | 41299 |
| 85 | Ga0068858_100067844 | 3300005842 | Bacteria | 3304 |
| 86 | Ga0068858_100068348 | 3300005842 | Bacteria | 3292 |
| 87 | Ga0068860_100085910 | 3300005843 | Bacteria | 2993 |
| 88 | Ga0070717_10008717 | 3300006028 | Bacteria | 7586 |
| 89 | Ga0070717_10015203 | 3300006028 | Bacteria | 5940 |
| 90 | Ga0070717_10017106 | 3300006028 | Bacteria | 5634 |
| 91 | Ga0070717_10052063 | 3300006028 | Bacteria | 3371 |
| 92 | Ga0070717_10115948 | 3300006028 | Bacteria | 2290 |
| 93 | Ga0075366_10000717 | 3300006195 | Bacteria | 15728 |
| 94 | Ga0075366_10024059 | 3300006195 | Bacteria | 3552 |
| 95 | Ga0097621_100000174 | 3300006237 | Bacteria | 40714 |
| 96 | Ga0097621_100001137 | 3300006237 | Bacteria | 18447 |
| 97 | Ga0097621_100005864 | 3300006237 | Bacteria | 8679 |
| 98 | Ga0068871_100000060 | 3300006358 | Bacteria | 59245 |
| 99 | Ga0068871_100002001 | 3300006358 | Bacteria | 13800 |
| 100 | Ga0068871_100003610 | 3300006358 | Bacteria | 10627 |
| 101 | Ga0068865_100000345 | 3300006881 | Bacteria | 25771 |
| 102 | Ga0075436_100002588 | 3300006914 | Bacteria | 12438 |
| 103 | Ga0075435_100003661 | 3300007076 | Bacteria | 10469 |
| 104 | Ga0105240_10000371 | 3300009093 | Bacteria | 84390 |
| 105 | Ga0105240_10004289 | 3300009093 | Bacteria | 21785 |
| 106 | Ga0105240_10008014 | 3300009093 | Bacteria | 15215 |
| 107 | Ga0105240_10017291 | 3300009093 | Bacteria | 9724 |
| 108 | Ga0105240_10044224 | 3300009093 | Bacteria | 5662 |
| 109 | Ga0105245_10143772 | 3300009098 | Bacteria | 2249 |
| 110 | Ga0105241_10003593 | 3300009174 | Bacteria | 11536 |
| 111 | Ga0105241_10004801 | 3300009174 | Bacteria | 9955 |
| 112 | Ga0105241_10004960 | 3300009174 | Bacteria | 9814 |
| 113 | Ga0105241_10026855 | 3300009174 | Bacteria | 4285 |
| 114 | Ga0105241_10046364 | 3300009174 | Bacteria | 3301 |
| 115 | Ga0105242_10063003 | 3300009176 | Bacteria | 3053 |
| 116 | Ga0105248_10087575 | 3300009177 | Bacteria | 3505 |
| 117 | Ga0105237_10000632 | 3300009545 | Bacteria | 49178 |
| 118 | Ga0105237_10001840 | 3300009545 | Bacteria | 27293 |
| 119 | Ga0105237_10002057 | 3300009545 | Bacteria | 25541 |
| 120 | Ga0105237_10002169 | 3300009545 | Bacteria | 24637 |
| 121 | Ga0105237_10003032 | 3300009545 | Bacteria | 20265 |
| 122 | Ga0105237_10007468 | 3300009545 | Bacteria | 11957 |
| 123 | Ga0105237_10045474 | 3300009545 | Bacteria | 4417 |
| 124 | Ga0105237_10104739 | 3300009545 | Bacteria | 2820 |
| 125 | Ga0105238_10000339 | 3300009551 | Bacteria | 51013 |
| 126 | Ga0105238_10040527 | 3300009551 | Bacteria | 4719 |
| 127 | Ga0105238_10047634 | 3300009551 | Bacteria | 4321 |
| 128 | Ga0105238_10085256 | 3300009551 | Bacteria | 3147 |
| 129 | Ga0105239_10000166 | 3300010375 | Bacteria | 94743 |
| 130 | Ga0105239_10001606 | 3300010375 | Bacteria | 29871 |
| 131 | Ga0105239_10002482 | 3300010375 | Bacteria | 23507 |
| 132 | Ga0105239_10002716 | 3300010375 | Bacteria | 22264 |
| 133 | Ga0105239_10003051 | 3300010375 | Bacteria | 20817 |
| 134 | Ga0105239_10020086 | 3300010375 | Bacteria | 7370 |
| 135 | Ga0105239_10051980 | 3300010375 | Bacteria | 4492 |
| 136 | Ga0105239_10075879 | 3300010375 | Bacteria | 3696 |
| 137 | Ga0105246_10017539 | 3300011119 | Bacteria | 4552 |
| 138 | Ga0105246_10101250 | 3300011119 | Bacteria | 2098 |
| 139 | Ga0157373_10020769 | 3300013100 | Bacteria | 4768 |
| 140 | Ga0157373_10047342 | 3300013100 | Bacteria | 3067 |
| 141 | Ga0157371_10045690 | 3300013102 | Bacteria | 3116 |
| 142 | Ga0157370_10014756 | 3300013104 | Bacteria | 7977 |
| 143 | Ga0157369_10000269 | 3300013105 | Bacteria | 69979 |
| 144 | Ga0157369_10027888 | 3300013105 | Bacteria | 6255 |
| 145 | Ga0157369_10070658 | 3300013105 | Bacteria | 3750 |
| 146 | Ga0157369_10241101 | 3300013105 | Bacteria | 1888 |
| 147 | Ga0157374_10000384 | 3300013296 | Bacteria | 40618 |
| 148 | Ga0157374_10000742 | 3300013296 | Bacteria | 28401 |
| 149 | Ga0157374_10002065 | 3300013296 | Bacteria | 16892 |
| 150 | Ga0157374_10010475 | 3300013296 | Bacteria | 7975 |
| 151 | Ga0157374_10031944 | 3300013296 | Bacteria | 4790 |
| 152 | Ga0157374_10078578 | 3300013296 | Bacteria | 3125 |
| 153 | Ga0157378_10000121 | 3300013297 | Bacteria | 75263 |
| 154 | Ga0157378_10013627 | 3300013297 | Bacteria | 7109 |
| 155 | Ga0163162_10000012 | 3300013306 | Bacteria | 292674 |
| 156 | Ga0163162_10014555 | 3300013306 | Bacteria | 7687 |
| 157 | Ga0157372_10002460 | 3300013307 | Bacteria | 20067 |
| 158 | Ga0157372_10003372 | 3300013307 | Bacteria | 17233 |
| 159 | Ga0157372_10003996 | 3300013307 | Bacteria | 15821 |
| 160 | Ga0157372_10018181 | 3300013307 | Bacteria | 7557 |
| 161 | Ga0157372_10048760 | 3300013307 | Bacteria | 4708 |
| 162 | Ga0157372_10066581 | 3300013307 | Bacteria | 4047 |
| 163 | Ga0157372_10070552 | 3300013307 | Bacteria | 3931 |
| 164 | Ga0157372_10187650 | 3300013307 | Bacteria | 2394 |
| 165 | Ga0157375_10004936 | 3300013308 | Bacteria | 11601 |
| 166 | Ga0157376_10002663 | 3300014969 | Bacteria | 12137 |
| 167 | Ga0157376_10037824 | 3300014969 | Bacteria | 3922 |
| 168 | Ga0182005_1010804 | 3300015265 | Bacteria | 2618 |
| 169 | Ga0209437_100262 | 3300025233 | Bacteria | 81344 |
| 170 | Ga0209026_1004337 | 3300025250 | Bacteria | 4250 |
| 171 | Ga0209129_1011175 | 3300025258 | Bacteria | 2167 |
| 172 | Ga0209455_1009132 | 3300025272 | Bacteria | 2628 |
| 173 | Ga0207656_10045817 | 3300025321 | Unclassified | 1873 |
| 174 | Ga0207692_10074134 | 3300025898 | Bacteria | 1803 |
| 175 | Ga0207642_10001957 | 3300025899 | Bacteria | 6354 |
| 176 | Ga0207647_10000231 | 3300025904 | Bacteria | 46261 |
| 177 | Ga0207645_10000229 | 3300025907 | Bacteria | 46502 |
| 178 | Ga0207645_10019424 | 3300025907 | Bacteria | 4454 |
| 179 | Ga0207705_10000026 | 3300025909 | Bacteria | 256051 |
| 180 | Ga0207705_10070890 | 3300025909 | Bacteria | 2526 |
| 181 | Ga0207654_10001012 | 3300025911 | Bacteria | 15381 |
| 182 | Ga0207654_10002331 | 3300025911 | Bacteria | 9744 |
| 183 | Ga0207654_10019560 | 3300025911 | Bacteria | 3576 |
| 184 | Ga0207707_10003830 | 3300025912 | Bacteria | 13330 |
| 185 | Ga0207707_10006867 | 3300025912 | Bacteria | 9926 |
| 186 | Ga0207707_10040095 | 3300025912 | Bacteria | 4092 |
| 187 | Ga0207695_10000142 | 3300025913 | Bacteria | 214715 |
| 188 | Ga0207695_10013341 | 3300025913 | Bacteria | 9806 |
| 189 | Ga0207695_10017626 | 3300025913 | Bacteria | 8299 |
| 190 | Ga0207695_10025045 | 3300025913 | Bacteria | 6692 |
| 191 | Ga0207695_10025321 | 3300025913 | Bacteria | 6646 |
| 192 | Ga0207695_10101172 | 3300025913 | Bacteria | 2877 |
| 193 | Ga0207695_10143641 | 3300025913 | Bacteria | 2332 |
| 194 | Ga0207671_10000110 | 3300025914 | Bacteria | 126480 |
| 195 | Ga0207671_10000815 | 3300025914 | Bacteria | 39441 |
| 196 | Ga0207671_10001918 | 3300025914 | Bacteria | 23087 |
| 197 | Ga0207671_10004491 | 3300025914 | Bacteria | 13287 |
| 198 | Ga0207671_10010705 | 3300025914 | Bacteria | 7542 |
| 199 | Ga0207671_10014423 | 3300025914 | Bacteria | 6246 |
| 200 | Ga0207671_10060055 | 3300025914 | Bacteria | 2820 |
| 201 | Ga0207693_10024114 | 3300025915 | Bacteria | 4830 |
| 202 | Ga0207663_10023893 | 3300025916 | Bacteria | 3515 |
| 203 | Ga0207663_10057937 | 3300025916 | Bacteria | 2443 |
| 204 | Ga0207660_10005575 | 3300025917 | Bacteria | 8176 |
| 205 | Ga0207657_10046812 | 3300025919 | Bacteria | 3787 |
| 206 | Ga0207652_10004129 | 3300025921 | Bacteria | 11851 |
| 207 | Ga0207652_10034677 | 3300025921 | Bacteria | 4254 |
| 208 | Ga0207652_10103559 | 3300025921 | Bacteria | 2516 |
| 209 | Ga0207694_10017090 | 3300025924 | Bacteria | 5481 |
| 210 | Ga0207694_10024962 | 3300025924 | Bacteria | 4541 |
| 211 | Ga0207694_10071503 | 3300025924 | Bacteria | 2711 |
| 212 | Ga0207694_10124089 | 3300025924 | Bacteria | 2064 |
| 213 | Ga0207650_10002753 | 3300025925 | Bacteria | 12132 |
| 214 | Ga0207687_10119811 | 3300025927 | Bacteria | 1966 |
| 215 | Ga0207700_10182623 | 3300025928 | Bacteria | 1758 |
| 216 | Ga0207664_10021903 | 3300025929 | Unclassified | 4762 |
| 217 | Ga0207664_10026695 | 3300025929 | Bacteria | 4367 |
| 218 | Ga0207690_10021533 | 3300025932 | Bacteria | 3999 |
| 219 | Ga0207706_10001203 | 3300025933 | Bacteria | 26147 |
| 220 | Ga0207706_10017411 | 3300025933 | Bacteria | 6473 |
| 221 | Ga0207709_10027926 | 3300025935 | Bacteria | 3257 |
| 222 | Ga0207704_10000047 | 3300025938 | Bacteria | 84386 |
| 223 | Ga0207665_10001232 | 3300025939 | Bacteria | 17250 |
| 224 | Ga0207689_10008260 | 3300025942 | Bacteria | 9072 |
| 225 | Ga0207661_10027552 | 3300025944 | Bacteria | 4341 |
| 226 | Ga0207661_10083363 | 3300025944 | Bacteria | 2645 |
| 227 | Ga0207661_10085952 | 3300025944 | Bacteria | 2609 |
| 228 | Ga0207679_10014370 | 3300025945 | Bacteria | 5205 |
| 229 | Ga0207667_10000015 | 3300025949 | Bacteria | 417534 |
| 230 | Ga0207667_10000311 | 3300025949 | Bacteria | 67671 |
| 231 | Ga0207667_10000953 | 3300025949 | Bacteria | 36919 |
| 232 | Ga0207667_10028587 | 3300025949 | Bacteria | 6054 |
| 233 | Ga0207667_10037921 | 3300025949 | Bacteria | 5150 |
| 234 | Ga0207667_10049392 | 3300025949 | Bacteria | 4443 |
| 235 | Ga0207667_10080665 | 3300025949 | Bacteria | 3371 |
| 236 | Ga0207667_10097279 | 3300025949 | Bacteria | 3038 |
| 237 | Ga0207651_10009099 | 3300025960 | Bacteria | 5408 |
| 238 | Ga0207640_10004803 | 3300025981 | Bacteria | 7344 |
| 239 | Ga0207640_10078067 | 3300025981 | Bacteria | 2252 |
| 240 | Ga0207677_10004894 | 3300026023 | Bacteria | 7231 |
| 241 | Ga0207677_10009184 | 3300026023 | Bacteria | 5553 |
| 242 | Ga0207677_10027229 | 3300026023 | Bacteria | 3597 |
| 243 | Ga0207677_10050850 | 3300026023 | Bacteria | 2806 |
| 244 | Ga0207677_10075580 | 3300026023 | Bacteria | 2395 |
| 245 | Ga0207703_10005831 | 3300026035 | Bacteria | 9866 |
| 246 | Ga0207703_10019406 | 3300026035 | Bacteria | 5312 |
| 247 | Ga0207703_10025253 | 3300026035 | Bacteria | 4673 |
| 248 | Ga0207703_10118920 | 3300026035 | Bacteria | 2266 |
| 249 | Ga0207639_10046326 | 3300026041 | Bacteria | 3281 |
| 250 | Ga0207639_10069759 | 3300026041 | Bacteria | 2743 |
| 251 | Ga0207639_10080401 | 3300026041 | Bacteria | 2578 |
| 252 | Ga0207678_10060657 | 3300026067 | Bacteria | 3253 |
| 253 | Ga0207702_10000163 | 3300026078 | Bacteria | 79263 |
| 254 | Ga0207702_10001803 | 3300026078 | Bacteria | 21088 |
| 255 | Ga0207702_10004790 | 3300026078 | Bacteria | 11926 |
| 256 | Ga0207702_10005756 | 3300026078 | Bacteria | 10785 |
| 257 | Ga0207702_10018916 | 3300026078 | Bacteria | 5698 |
| 258 | Ga0207702_10031986 | 3300026078 | Bacteria | 4388 |
| 259 | Ga0207641_10013916 | 3300026088 | Bacteria | 6598 |
| 260 | Ga0207648_10001813 | 3300026089 | Bacteria | 23430 |
| 261 | Ga0207648_10032822 | 3300026089 | Bacteria | 4581 |
| 262 | Ga0207676_10002019 | 3300026095 | Bacteria | 14768 |
| 263 | Ga0207674_10001717 | 3300026116 | Bacteria | 28034 |
| 264 | Ga0207674_10043465 | 3300026116 | Bacteria | 4633 |
| 265 | Ga0207683_10001294 | 3300026121 | Bacteria | 22621 |
| 266 | Ga0207698_10010879 | 3300026142 | Bacteria | 5874 |
| 267 | Ga0207698_10247764 | 3300026142 | Bacteria | 1628 |
| 268 | Ga0268266_10000121 | 3300028379 | Bacteria | 154995 |
| 269 | Ga0268264_10014314 | 3300028381 | Bacteria | 6523 |
| 270 | Ga0307517_10000198 | 3300028786 | Bacteria | 102181 |
| 271 | Ga0307515_10000081 | 3300028794 | Bacteria | 224753 |
| 272 | Ga0307515_10008521 | 3300028794 | Bacteria | 19968 |
| 273 | Ga0307509_10032359 | 3300031507 | Bacteria | 5763 |
| 274 | Ga0307412_10145233 | 3300031911 | Bacteria | 1743 |
| 275 | Ga0307507_10000078 | 3300033179 | Bacteria | 151026 |
| 276 | Ga0307510_10051124 | 3300033180 | Bacteria | 4375 |
| 277 | Ga0373926_0000895 | 3300035083 | Bacteria | 8561 |
| 278 | Ga0373935_0055172 | 3300035692 | Bacteria | 2532 |
| 279 | Ga0373927_0022535 | 3300035695 | Bacteria | 4126 |
| 280 | Ga0373947_0035749 | 3300035725 | Bacteria | 2942 |
| 281 | Ga0373925_0002780 | 3300037068 | Bacteria | 13827 |
| 282 | Ga0373925_0058034 | 3300037068 | Bacteria | 2901 |
| 283 | Ga0395899_0019326 | 3300037312 | Bacteria | 5176 |
| 284 | Ga0395900_0000140 | 3300037418 | Bacteria | 121917 |
| 285 | Ga0395900_0000275 | 3300037418 | Bacteria | 78207 |
| 286 | Ga0395900_0011378 | 3300037418 | Bacteria | 9106 |
| 287 | Ga0395898_0001454 | 3300037466 | Bacteria | 33553 |
| 288 | Ga0395898_0085054 | 3300037466 | Bacteria | 3049 |
| 289 | Ga0395905_0000248 | 3300037471 | Bacteria | 81042 |
| 290 | Ga0395905_0009775 | 3300037471 | Bacteria | 9353 |
| 291 | Ga0436364_1450020 | 3300037853 | Bacteria | 3836 |
| 292 | Ga0395901_0000145 | 3300038443 | Bacteria | 91739 |
| 293 | Ga0395901_0007206 | 3300038443 | Bacteria | 11216 |
| 294 | Ga0436361_1205912 | 3300039447 | Bacteria | 6506 |
| 295 | Ga0436363_1344398 | 3300039450 | Bacteria | 2985 |
| 296 | Ga0466963_0043294 | 3300044694 | Bacteria | 2960 |
| 297 | Ga0466967_0026328 | 3300045976 | Bacteria | 4816 |
| 298 | Ga0495650_0001672 | 3300046471 | Bacteria | 20481 |
| 299 | Ga0495580_0007691 | 3300046472 | Bacteria | 8641 |
| 300 | Ga0495580_0019237 | 3300046472 | Bacteria | 5074 |
| 301 | Ga0495580_0031015 | 3300046472 | Bacteria | 3866 |
| 302 | Ga0495582_0012742 | 3300046473 | Bacteria | 4633 |
| 303 | Ga0495585_0000323 | 3300046492 | Bacteria | 47094 |
| 304 | Ga0495585_0000359 | 3300046492 | Bacteria | 44166 |
| 305 | Ga0495583_0009149 | 3300046506 | Bacteria | 5953 |
| 306 | Ga0495606_0000074 | 3300046507 | Bacteria | 170848 |
| 307 | Ga0495606_0004155 | 3300046507 | Bacteria | 14678 |
| 308 | Ga0495606_0009273 | 3300046507 | Bacteria | 8352 |
| 309 | Ga0495606_0018110 | 3300046507 | Bacteria | 5294 |
| 310 | Ga0495610_0004515 | 3300046512 | Bacteria | 10250 |
| 311 | Ga0495630_0243450 | 3300046517 | Bacteria | 1374 |
| 312 | Ga0495631_0115052 | 3300046518 | Bacteria | 1156 |
| 313 | Ga0495648_0014368 | 3300046524 | Bacteria | 5799 |
| 314 | Ga0495666_0057643 | 3300046526 | Bacteria | 1859 |
| 315 | Ga0495654_0046546 | 3300046530 | Bacteria | 2136 |
| 316 | Ga0495665_0001842 | 3300046531 | Bacteria | 11452 |
| 317 | Ga0495609_0002134 | 3300046538 | Bacteria | 12437 |
| 318 | Ga0495633_0000006 | 3300046558 | Bacteria | 326774 |
| 319 | Ga0495633_0010534 | 3300046558 | Bacteria | 5041 |
| 320 | Ga0495668_0000011 | 3300046616 | Bacteria | 472186 |
| 321 | Ga0495625_0000270 | 3300046660 | Bacteria | 80894 |
| 322 | Ga0495625_0000462 | 3300046660 | Bacteria | 60985 |
| 323 | Ga0495625_0003734 | 3300046660 | Bacteria | 14825 |
| 324 | Ga0495625_0037574 | 3300046660 | Bacteria | 3552 |
| 325 | Ga0495658_0026361 | 3300046683 | Bacteria | 3114 |
| 326 | Ga0495649_0000082 | 3300046694 | Bacteria | 82099 |
| 327 | Ga0495687_002555 | 3300047443 | Bacteria | 14392 |
| 328 | Ga0495684_0044804 | 3300047471 | Bacteria | 3386 |
| 329 | Ga0495686_0001903 | 3300047472 | Bacteria | 20836 |
| 330 | Ga0495614_0060302 | 3300048089 | Bacteria | 1630 |
| 331 | Ga0496102_0019514 | 3300048905 | Bacteria | 5972 |
| 332 | Ga0496103_0067991 | 3300048906 | Bacteria | 2226 |
| 333 | Ga0496105_0135984 | 3300048908 | Bacteria | 2025 |
| 334 | Ga0496109_0131064 | 3300048912 | Bacteria | 2340 |
| 335 | Ga0496112_0136869 | 3300048915 | Bacteria | 2419 |
| 336 | Ga0496112_0182064 | 3300048915 | Unclassified | 2065 |
| 337 | Ga0496112_0267985 | 3300048915 | Unclassified | 1656 |
| 338 | Ga0496113_0089472 | 3300048916 | Unclassified | 2370 |
| 339 | Ga0495682_0028877 | 3300049460 | Bacteria | 2054 |
| 340 | nmdc:mga0k408_561_c1 | 3300050493 | Bacteria | 20467 |
| 341 | nmdc:mga0k408_609_c1 | 3300050493 | Bacteria | 19796 |
| 342 | nmdc:mga08x19_2234_c1 | 3300050514 | Bacteria | 11824 |
| 343 | Ga0500608_000630 | 3300053122 | Bacteria | 12952 |
| 344 | Ga0500618_000148 | 3300053125 | Bacteria | 58264 |
| 345 | Ga0500642_0009248 | 3300053130 | Bacteria | 3410 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025921 | Ga0207652_10103559 | Ga0207652_101035592 | 363 |
| 2 | 3300046518 | Ga0495631_0115052 | Ga0495631_0115052_21_1112 | 363 |
| 3 | 3300046507 | Ga0495606_0018110 | Ga0495606_0018110_769_2115 | 383 |
| 4 | 3300025907 | Ga0207645_10019424 | Ga0207645_100194243 | 384 |
| 5 | 3300026067 | Ga0207678_10060657 | Ga0207678_100606572 | 384 |
| 6 | 3300005327 | Ga0070658_10064218 | Ga0070658_100642182 | 385 |
| 7 | 3300005355 | Ga0070671_100076596 | Ga0070671_1000765962 | 385 |
| 8 | 3300046660 | Ga0495625_0003734 | Ga0495625_0003734_9032_10378 | 390 |
| 9 | 3300005329 | Ga0070683_100020085 | Ga0070683_1000200854 | 398 |
| 10 | 3300005535 | Ga0070684_100004101 | Ga0070684_1000041017 | 398 |
| 11 | 3300025898 | Ga0207692_10074134 | Ga0207692_100741342 | 398 |
| 12 | 3300025944 | Ga0207661_10083363 | Ga0207661_100833632 | 398 |
| 13 | 3300005563 | Ga0068855_100158389 | Ga0068855_1001583893 | 401 |
| 14 | 3300013105 | Ga0157369_10070658 | Ga0157369_100706584 | 401 |
| 15 | 3300009174 | Ga0105241_10046364 | Ga0105241_100463645 | 404 |
| 16 | 3300005338 | Ga0068868_100088239 | Ga0068868_1000882391 | 406 |
| 17 | 3300005518 | Ga0070699_100020400 | Ga0070699_1000204002 | 406 |
| 18 | 3300005458 | Ga0070681_10000672 | Ga0070681_1000067225 | 407 |
| 19 | 3300005535 | Ga0070684_100028348 | Ga0070684_1000283485 | 407 |
| 20 | 3300005539 | Ga0068853_100021912 | Ga0068853_1000219125 | 407 |
| 21 | 3300005563 | Ga0068855_100004995 | Ga0068855_1000049955 | 407 |
| 22 | 3300005577 | Ga0068857_100067925 | Ga0068857_1000679254 | 407 |
| 23 | 3300005578 | Ga0068854_100031805 | Ga0068854_1000318053 | 407 |
| 24 | 3300005614 | Ga0068856_100003296 | Ga0068856_10000329612 | 407 |
| 25 | 3300005834 | Ga0068851_10043626 | Ga0068851_100436262 | 407 |
| 26 | 3300005842 | Ga0068858_100068348 | Ga0068858_1000683485 | 407 |
| 27 | 3300006237 | Ga0097621_100001137 | Ga0097621_10000113710 | 407 |
| 28 | 3300006358 | Ga0068871_100002001 | Ga0068871_1000020015 | 407 |
| 29 | 3300009093 | Ga0105240_10044224 | Ga0105240_100442246 | 407 |
| 30 | 3300009551 | Ga0105238_10000339 | Ga0105238_100003395 | 407 |
| 31 | 3300010375 | Ga0105239_10020086 | Ga0105239_100200865 | 407 |
| 32 | 3300013105 | Ga0157369_10000269 | Ga0157369_100002695 | 407 |
| 33 | 3300013296 | Ga0157374_10031944 | Ga0157374_100319443 | 407 |
| 34 | 3300013297 | Ga0157378_10013627 | Ga0157378_100136278 | 407 |
| 35 | 3300013307 | Ga0157372_10003996 | Ga0157372_100039965 | 407 |
| 36 | 3300014969 | Ga0157376_10037824 | Ga0157376_100378244 | 407 |
| 37 | 3300025321 | Ga0207656_10045817 | Ga0207656_100458172 | 407 |
| 38 | 3300025912 | Ga0207707_10003830 | Ga0207707_100038305 | 407 |
| 39 | 3300025913 | Ga0207695_10143641 | Ga0207695_101436413 | 407 |
| 40 | 3300025921 | Ga0207652_10034677 | Ga0207652_100346774 | 407 |
| 41 | 3300025924 | Ga0207694_10017090 | Ga0207694_100170903 | 407 |
| 42 | 3300025949 | Ga0207667_10000311 | Ga0207667_1000031154 | 407 |
| 43 | 3300026035 | Ga0207703_10019406 | Ga0207703_100194065 | 407 |
| 44 | 3300026041 | Ga0207639_10046326 | Ga0207639_100463262 | 407 |
| 45 | 3300026078 | Ga0207702_10004790 | Ga0207702_100047901 | 407 |
| 46 | 3300026116 | Ga0207674_10043465 | Ga0207674_100434655 | 407 |
| 47 | 3300047471 | Ga0495684_0044804 | Ga0495684_0044804_151_1590 | 407 |
| 48 | 3300048905 | Ga0496102_0019514 | Ga0496102_0019514_2129_3556 | 407 |
| 49 | 3300048916 | Ga0496113_0089472 | Ga0496113_0089472_202_1629 | 407 |
| 50 | 3300005339 | Ga0070660_100084899 | Ga0070660_1000848991 | 408 |
| 51 | 3300005437 | Ga0070710_10045524 | Ga0070710_100455242 | 408 |
| 52 | 3300005439 | Ga0070711_100058396 | Ga0070711_1000583964 | 408 |
| 53 | 3300006028 | Ga0070717_10052063 | Ga0070717_100520635 | 408 |
| 54 | 3300025916 | Ga0207663_10057937 | Ga0207663_100579373 | 408 |
| 55 | 3300037068 | Ga0373925_0058034 | Ga0373925_0058034_1123_2502 | 408 |
| 56 | 3300044694 | Ga0466963_0043294 | Ga0466963_0043294_1557_2879 | 408 |
| 57 | 3300026035 | Ga0207703_10025253 | Ga0207703_100252532 | 409 |
| 58 | 3300045976 | Ga0466967_0026328 | Ga0466967_0026328_152_1573 | 409 |
| 59 | 3300005841 | Ga0068863_100111529 | Ga0068863_1001115291 | 410 |
| 60 | 3300009177 | Ga0105248_10087575 | Ga0105248_100875751 | 410 |
| 61 | 3300048912 | Ga0496109_0131064 | Ga0496109_0131064_70_1440 | 410 |
| 62 | 3300005578 | Ga0068854_100016730 | Ga0068854_1000167305 | 411 |
| 63 | 3300025981 | Ga0207640_10078067 | Ga0207640_100780673 | 411 |
| 64 | 3300026023 | Ga0207677_10050850 | Ga0207677_100508501 | 411 |
| 65 | 3300005535 | Ga0070684_100008449 | Ga0070684_10000844910 | 412 |
| 66 | 3300005539 | Ga0068853_100049747 | Ga0068853_1000497471 | 412 |
| 67 | 3300005563 | Ga0068855_100022662 | Ga0068855_1000226625 | 412 |
| 68 | 3300005614 | Ga0068856_100005418 | Ga0068856_1000054185 | 412 |
| 69 | 3300005618 | Ga0068864_100009168 | Ga0068864_1000091685 | 412 |
| 70 | 3300005841 | Ga0068863_100049305 | Ga0068863_1000493055 | 412 |
| 71 | 3300005842 | Ga0068858_100067844 | Ga0068858_1000678443 | 412 |
| 72 | 3300006237 | Ga0097621_100005864 | Ga0097621_1000058647 | 412 |
| 73 | 3300006358 | Ga0068871_100003610 | Ga0068871_1000036102 | 412 |
| 74 | 3300013307 | Ga0157372_10187650 | Ga0157372_101876502 | 412 |
| 75 | 3300025933 | Ga0207706_10017411 | Ga0207706_100174115 | 412 |
| 76 | 3300025944 | Ga0207661_10085952 | Ga0207661_100859522 | 412 |
| 77 | 3300026023 | Ga0207677_10004894 | Ga0207677_100048945 | 412 |
| 78 | 3300026041 | Ga0207639_10080401 | Ga0207639_100804013 | 412 |
| 79 | 3300026078 | Ga0207702_10001803 | Ga0207702_1000180311 | 412 |
| 80 | 3300026088 | Ga0207641_10013916 | Ga0207641_100139165 | 412 |
| 81 | 3300013307 | Ga0157372_10066581 | Ga0157372_100665814 | 414 |
| 82 | 3300005539 | Ga0068853_100064644 | Ga0068853_1000646445 | 415 |
| 83 | 3300005614 | Ga0068856_100092064 | Ga0068856_1000920642 | 415 |
| 84 | 3300013296 | Ga0157374_10078578 | Ga0157374_100785784 | 415 |
| 85 | 3300015265 | Ga0182005_1010804 | Ga0182005_10108042 | 415 |
| 86 | 3300025919 | Ga0207657_10046812 | Ga0207657_100468122 | 415 |
| 87 | 3300025932 | Ga0207690_10021533 | Ga0207690_100215335 | 415 |
| 88 | 3300048906 | Ga0496103_0067991 | Ga0496103_0067991_135_1502 | 415 |
| 89 | 3300048908 | Ga0496105_0135984 | Ga0496105_0135984_223_1593 | 415 |
| 90 | 3300005457 | Ga0070662_100053614 | Ga0070662_1000536142 | 417 |
| 91 | 3300025928 | Ga0207700_10182623 | Ga0207700_101826232 | 417 |
| 92 | 3300009174 | Ga0105241_10004801 | Ga0105241_100048019 | 419 |
| 93 | 3300013307 | Ga0157372_10018181 | Ga0157372_100181814 | 419 |
| 94 | 3300026078 | Ga0207702_10005756 | Ga0207702_100057565 | 419 |
| 95 | 3300048915 | Ga0496112_0267985 | Ga0496112_0267985_227_1558 | 419 |
| 96 | 3300025909 | Ga0207705_10070890 | Ga0207705_100708902 | 420 |
| 97 | 3300046473 | Ga0495582_0012742 | Ga0495582_0012742_3335_4621 | 421 |
| 98 | 3300046517 | Ga0495630_0243450 | Ga0495630_0243450_16_1302 | 421 |
| 99 | 3300005436 | Ga0070713_100020596 | Ga0070713_1000205964 | 426 |
| 100 | 3300005468 | Ga0070707_100055870 | Ga0070707_1000558702 | 426 |
| 101 | 3300006028 | Ga0070717_10017106 | Ga0070717_100171062 | 426 |
| 102 | 3300006914 | Ga0075436_100002588 | Ga0075436_1000025887 | 426 |
| 103 | 3300007076 | Ga0075435_100003661 | Ga0075435_1000036619 | 426 |
| 104 | 3300025915 | Ga0207693_10024114 | Ga0207693_100241142 | 426 |
| 105 | 3300025929 | Ga0207664_10021903 | Ga0207664_100219037 | 426 |
| 106 | 3300025939 | Ga0207665_10001232 | Ga0207665_1000123212 | 426 |
| 107 | 3300035083 | Ga0373926_0000895 | Ga0373926_0000895_6151_7608 | 426 |
| 108 | 3300035695 | Ga0373927_0022535 | Ga0373927_0022535_30_1358 | 426 |
| 109 | 3300035725 | Ga0373947_0035749 | Ga0373947_0035749_1050_2507 | 426 |
| 110 | 3300037068 | Ga0373925_0002780 | Ga0373925_0002780_2963_4420 | 426 |
| 111 | 3300037853 | Ga0436364_1450020 | Ga0436364_1450020_1808_3139 | 426 |
| 112 | 3300039450 | Ga0436363_1344398 | Ga0436363_1344398_707_2038 | 426 |
| 113 | 3300046472 | Ga0495580_0007691 | Ga0495580_0007691_5997_7454 | 426 |
| 114 | 3300046472 | Ga0495580_0019237 | Ga0495580_0019237_191_1546 | 426 |
| 115 | 3300046472 | Ga0495580_0031015 | Ga0495580_0031015_986_2335 | 426 |
| 116 | 3300046526 | Ga0495666_0057643 | Ga0495666_0057643_169_1626 | 426 |
| 117 | 3300046531 | Ga0495665_0001842 | Ga0495665_0001842_5128_6585 | 426 |
| 118 | 3300048915 | Ga0496112_0182064 | Ga0496112_0182064_147_1607 | 426 |
| 119 | 3300050514 | nmdc:mga08x19_2234_c1 | nmdc:mga08x19_2234_c1_4127_5584 | 426 |
| 120 | 3300005329 | Ga0070683_100018480 | Ga0070683_1000184804 | 427 |
| 121 | 3300005334 | Ga0068869_100001760 | Ga0068869_1000017605 | 427 |
| 122 | 3300005435 | Ga0070714_100098024 | Ga0070714_1000980241 | 427 |
| 123 | 3300005436 | Ga0070713_100222210 | Ga0070713_1002222101 | 427 |
| 124 | 3300005439 | Ga0070711_100010890 | Ga0070711_1000108904 | 427 |
| 125 | 3300005445 | Ga0070708_100003211 | Ga0070708_1000032118 | 427 |
| 126 | 3300005458 | Ga0070681_10002267 | Ga0070681_1000226716 | 427 |
| 127 | 3300005459 | Ga0068867_100033250 | Ga0068867_1000332504 | 427 |
| 128 | 3300005530 | Ga0070679_100149157 | Ga0070679_1001491572 | 427 |
| 129 | 3300005545 | Ga0070695_100087561 | Ga0070695_1000875611 | 427 |
| 130 | 3300005563 | Ga0068855_100033941 | Ga0068855_1000339414 | 427 |
| 131 | 3300005563 | Ga0068855_100164577 | Ga0068855_1001645772 | 427 |
| 132 | 3300005564 | Ga0070664_100002954 | Ga0070664_10000295414 | 427 |
| 133 | 3300005577 | Ga0068857_100000154 | Ga0068857_1000001545 | 427 |
| 134 | 3300005578 | Ga0068854_100006297 | Ga0068854_1000062973 | 427 |
| 135 | 3300005614 | Ga0068856_100000612 | Ga0068856_1000006123 | 427 |
| 136 | 3300005614 | Ga0068856_100013472 | Ga0068856_1000134727 | 427 |
| 137 | 3300005718 | Ga0068866_10005626 | Ga0068866_100056261 | 427 |
| 138 | 3300005842 | Ga0068858_100000491 | Ga0068858_1000004914 | 427 |
| 139 | 3300005843 | Ga0068860_100085910 | Ga0068860_1000859103 | 427 |
| 140 | 3300006028 | Ga0070717_10008717 | Ga0070717_100087172 | 427 |
| 141 | 3300006028 | Ga0070717_10015203 | Ga0070717_100152032 | 427 |
| 142 | 3300006028 | Ga0070717_10115948 | Ga0070717_101159482 | 427 |
| 143 | 3300009098 | Ga0105245_10143772 | Ga0105245_101437722 | 427 |
| 144 | 3300009545 | Ga0105237_10007468 | Ga0105237_100074683 | 427 |
| 145 | 3300013100 | Ga0157373_10020769 | Ga0157373_100207694 | 427 |
| 146 | 3300013100 | Ga0157373_10047342 | Ga0157373_100473423 | 427 |
| 147 | 3300013104 | Ga0157370_10014756 | Ga0157370_100147569 | 427 |
| 148 | 3300013105 | Ga0157369_10027888 | Ga0157369_100278888 | 427 |
| 149 | 3300013296 | Ga0157374_10000384 | Ga0157374_1000038434 | 427 |
| 150 | 3300013297 | Ga0157378_10000121 | Ga0157378_100001215 | 427 |
| 151 | 3300013307 | Ga0157372_10002460 | Ga0157372_100024604 | 427 |
| 152 | 3300013307 | Ga0157372_10048760 | Ga0157372_100487602 | 427 |
| 153 | 3300013307 | Ga0157372_10070552 | Ga0157372_100705524 | 427 |
| 154 | 3300025899 | Ga0207642_10001957 | Ga0207642_100019572 | 427 |
| 155 | 3300025912 | Ga0207707_10006867 | Ga0207707_100068673 | 427 |
| 156 | 3300025913 | Ga0207695_10025321 | Ga0207695_100253217 | 427 |
| 157 | 3300025913 | Ga0207695_10101172 | Ga0207695_101011722 | 427 |
| 158 | 3300025916 | Ga0207663_10023893 | Ga0207663_100238932 | 427 |
| 159 | 3300025925 | Ga0207650_10002753 | Ga0207650_100027539 | 427 |
| 160 | 3300025927 | Ga0207687_10119811 | Ga0207687_101198112 | 427 |
| 161 | 3300025929 | Ga0207664_10026695 | Ga0207664_100266952 | 427 |
| 162 | 3300025942 | Ga0207689_10008260 | Ga0207689_100082605 | 427 |
| 163 | 3300025944 | Ga0207661_10027552 | Ga0207661_100275521 | 427 |
| 164 | 3300025945 | Ga0207679_10014370 | Ga0207679_100143705 | 427 |
| 165 | 3300025949 | Ga0207667_10028587 | Ga0207667_100285874 | 427 |
| 166 | 3300025949 | Ga0207667_10097279 | Ga0207667_100972793 | 427 |
| 167 | 3300025981 | Ga0207640_10004803 | Ga0207640_100048033 | 427 |
| 168 | 3300026023 | Ga0207677_10009184 | Ga0207677_100091845 | 427 |
| 169 | 3300026035 | Ga0207703_10005831 | Ga0207703_100058311 | 427 |
| 170 | 3300026078 | Ga0207702_10018916 | Ga0207702_100189165 | 427 |
| 171 | 3300026078 | Ga0207702_10031986 | Ga0207702_100319863 | 427 |
| 172 | 3300026089 | Ga0207648_10032822 | Ga0207648_100328224 | 427 |
| 173 | 3300026095 | Ga0207676_10002019 | Ga0207676_100020199 | 427 |
| 174 | 3300026116 | Ga0207674_10001717 | Ga0207674_100017175 | 427 |
| 175 | 3300026142 | Ga0207698_10247764 | Ga0207698_102477642 | 427 |
| 176 | 3300028381 | Ga0268264_10014314 | Ga0268264_100143142 | 427 |
| 177 | 3300035692 | Ga0373935_0055172 | Ga0373935_0055172_1041_2399 | 427 |
| 178 | 3300048915 | Ga0496112_0136869 | Ga0496112_0136869_91_1521 | 427 |
| 179 | 3300014969 | Ga0157376_10002663 | Ga0157376_100026637 | 428 |
| 180 | 3300001990 | JGI24737J22298_10000681 | JGI24737J22298_100006813 | 432 |
| 181 | 3300002067 | JGI24735J21928_10000005 | JGI24735J21928_100000057 | 432 |
| 182 | 3300002737 | JGI25162J39368_1000016 | JGI25162J39368_100001665 | 432 |
| 183 | 3300003316 | rootH1_10000713 | rootH1_100007131 | 432 |
| 184 | 3300005563 | Ga0068855_100009255 | Ga0068855_10000925511 | 432 |
| 185 | 3300005563 | Ga0068855_100045502 | Ga0068855_1000455024 | 432 |
| 186 | 3300006195 | Ga0075366_10000717 | Ga0075366_100007173 | 432 |
| 187 | 3300006195 | Ga0075366_10024059 | Ga0075366_100240593 | 432 |
| 188 | 3300009545 | Ga0105237_10003032 | Ga0105237_100030323 | 432 |
| 189 | 3300009545 | Ga0105237_10045474 | Ga0105237_100454743 | 432 |
| 190 | 3300010375 | Ga0105239_10002716 | Ga0105239_1000271615 | 432 |
| 191 | 3300010375 | Ga0105239_10003051 | Ga0105239_1000305116 | 432 |
| 192 | 3300010375 | Ga0105239_10075879 | Ga0105239_100758792 | 432 |
| 193 | 3300013102 | Ga0157371_10045690 | Ga0157371_100456901 | 432 |
| 194 | 3300013105 | Ga0157369_10241101 | Ga0157369_102411012 | 432 |
| 195 | 3300013306 | Ga0163162_10014555 | Ga0163162_100145559 | 432 |
| 196 | 3300013307 | Ga0157372_10003372 | Ga0157372_1000337211 | 432 |
| 197 | 3300013308 | Ga0157375_10004936 | Ga0157375_100049362 | 432 |
| 198 | 3300025233 | Ga0209437_100262 | Ga0209437_10026263 | 432 |
| 199 | 3300025258 | Ga0209129_1011175 | Ga0209129_10111751 | 432 |
| 200 | 3300025914 | Ga0207671_10001918 | Ga0207671_100019186 | 432 |
| 201 | 3300025914 | Ga0207671_10004491 | Ga0207671_100044913 | 432 |
| 202 | 3300025949 | Ga0207667_10037921 | Ga0207667_100379213 | 432 |
| 203 | 3300025949 | Ga0207667_10080665 | Ga0207667_100806651 | 432 |
| 204 | 3300028794 | Ga0307515_10000081 | Ga0307515_1000008124 | 432 |
| 205 | 3300028794 | Ga0307515_10008521 | Ga0307515_100085212 | 432 |
| 206 | 3300033179 | Ga0307507_10000078 | Ga0307507_100000788 | 432 |
| 207 | 3300046471 | Ga0495650_0001672 | Ga0495650_0001672_9016_10362 | 432 |
| 208 | 3300046492 | Ga0495585_0000323 | Ga0495585_0000323_17526_18872 | 432 |
| 209 | 3300046492 | Ga0495585_0000359 | Ga0495585_0000359_8575_9921 | 432 |
| 210 | 3300046506 | Ga0495583_0009149 | Ga0495583_0009149_1310_2656 | 432 |
| 211 | 3300046507 | Ga0495606_0000074 | Ga0495606_0000074_9617_10996 | 432 |
| 212 | 3300046507 | Ga0495606_0009273 | Ga0495606_0009273_3310_4656 | 432 |
| 213 | 3300046512 | Ga0495610_0004515 | Ga0495610_0004515_2152_3498 | 432 |
| 214 | 3300046524 | Ga0495648_0014368 | Ga0495648_0014368_3374_4720 | 432 |
| 215 | 3300046530 | Ga0495654_0046546 | Ga0495654_0046546_115_1461 | 432 |
| 216 | 3300046538 | Ga0495609_0002134 | Ga0495609_0002134_9484_10830 | 432 |
| 217 | 3300046558 | Ga0495633_0000006 | Ga0495633_0000006_229893_231269 | 432 |
| 218 | 3300046558 | Ga0495633_0010534 | Ga0495633_0010534_2601_3947 | 432 |
| 219 | 3300046616 | Ga0495668_0000011 | Ga0495668_0000011_207045_208391 | 432 |
| 220 | 3300046660 | Ga0495625_0000270 | Ga0495625_0000270_70506_71852 | 432 |
| 221 | 3300046660 | Ga0495625_0000462 | Ga0495625_0000462_34554_35900 | 432 |
| 222 | 3300046660 | Ga0495625_0037574 | Ga0495625_0037574_344_1690 | 432 |
| 223 | 3300046683 | Ga0495658_0026361 | Ga0495658_0026361_1460_2806 | 432 |
| 224 | 3300046694 | Ga0495649_0000082 | Ga0495649_0000082_71726_73072 | 432 |
| 225 | 3300048089 | Ga0495614_0060302 | Ga0495614_0060302_109_1455 | 432 |
| 226 | 3300049460 | Ga0495682_0028877 | Ga0495682_0028877_471_1817 | 432 |
| 227 | 3300050493 | nmdc:mga0k408_561_c1 | nmdc:mga0k408_561_c1_18209_19555 | 432 |
| 228 | 3300050493 | nmdc:mga0k408_609_c1 | nmdc:mga0k408_609_c1_14174_15520 | 432 |
| 229 | 3300053125 | Ga0500618_000148 | Ga0500618_000148_53777_55123 | 432 |
| 230 | iso_pu_bacteria | 2599185184 | 2599481934 | 432 |
| 231 | iso_pu_bacteria | 2919437846 | 2919440410 | 432 |
| 232 | iso_pu_bacteria | 2928078545 | 2928084093 | 432 |
| 233 | iso_pu_bacteria | 2928147474 | 2928152860 | 432 |
| 234 | iso_pu_bacteria | 2932082852 | 2932088457 | 432 |
| 235 | 3300047472 | Ga0495686_0001903 | Ga0495686_0001903_1535_2941 | 433 |
| 236 | 3300001904 | JGI24736J21556_1001857 | JGI24736J21556_10018572 | 434 |
| 237 | 3300001990 | JGI24737J22298_10003893 | JGI24737J22298_100038932 | 434 |
| 238 | 3300001991 | JGI24743J22301_10004792 | JGI24743J22301_100047922 | 434 |
| 239 | 3300003320 | rootH2_10012714 | rootH2_1001271412 | 434 |
| 240 | 3300003320 | rootH2_10113384 | rootH2_101133843 | 434 |
| 241 | 3300003323 | rootH1_10012646 | rootH1_1001264610 | 434 |
| 242 | 3300003323 | rootH1_10028786 | rootH1_100287865 | 434 |
| 243 | 3300005327 | Ga0070658_10000008 | Ga0070658_10000008164 | 434 |
| 244 | 3300005327 | Ga0070658_10026346 | Ga0070658_100263462 | 434 |
| 245 | 3300005328 | Ga0070676_10002139 | Ga0070676_100021392 | 434 |
| 246 | 3300005336 | Ga0070680_100043669 | Ga0070680_1000436693 | 434 |
| 247 | 3300005338 | Ga0068868_100030713 | Ga0068868_1000307131 | 434 |
| 248 | 3300005338 | Ga0068868_100046766 | Ga0068868_1000467663 | 434 |
| 249 | 3300005339 | Ga0070660_100036082 | Ga0070660_1000360822 | 434 |
| 250 | 3300005364 | Ga0070673_100044406 | Ga0070673_1000444062 | 434 |
| 251 | 3300005456 | Ga0070678_100004429 | Ga0070678_1000044292 | 434 |
| 252 | 3300005457 | Ga0070662_100000790 | Ga0070662_1000007903 | 434 |
| 253 | 3300005459 | Ga0068867_100001754 | Ga0068867_10000175413 | 434 |
| 254 | 3300005530 | Ga0070679_100056216 | Ga0070679_1000562163 | 434 |
| 255 | 3300005539 | Ga0068853_100005185 | Ga0068853_1000051853 | 434 |
| 256 | 3300005539 | Ga0068853_100113435 | Ga0068853_1001134351 | 434 |
| 257 | 3300005539 | Ga0068853_100214192 | Ga0068853_1002141922 | 434 |
| 258 | 3300005548 | Ga0070665_100000118 | Ga0070665_10000011877 | 434 |
| 259 | 3300005563 | Ga0068855_100000155 | Ga0068855_10000015539 | 434 |
| 260 | 3300005563 | Ga0068855_100002647 | Ga0068855_1000026478 | 434 |
| 261 | 3300005563 | Ga0068855_100396462 | Ga0068855_1003964621 | 434 |
| 262 | 3300005614 | Ga0068856_100000371 | Ga0068856_10000037123 | 434 |
| 263 | 3300005616 | Ga0068852_100025919 | Ga0068852_1000259194 | 434 |
| 264 | 3300006237 | Ga0097621_100000174 | Ga0097621_10000017427 | 434 |
| 265 | 3300006358 | Ga0068871_100000060 | Ga0068871_10000006038 | 434 |
| 266 | 3300006881 | Ga0068865_100000345 | Ga0068865_10000034529 | 434 |
| 267 | 3300009093 | Ga0105240_10000371 | Ga0105240_1000037122 | 434 |
| 268 | 3300009093 | Ga0105240_10004289 | Ga0105240_100042897 | 434 |
| 269 | 3300009093 | Ga0105240_10008014 | Ga0105240_100080143 | 434 |
| 270 | 3300009093 | Ga0105240_10017291 | Ga0105240_100172912 | 434 |
| 271 | 3300009174 | Ga0105241_10003593 | Ga0105241_100035939 | 434 |
| 272 | 3300009174 | Ga0105241_10004960 | Ga0105241_100049602 | 434 |
| 273 | 3300009174 | Ga0105241_10026855 | Ga0105241_100268553 | 434 |
| 274 | 3300009176 | Ga0105242_10063003 | Ga0105242_100630032 | 434 |
| 275 | 3300009545 | Ga0105237_10000632 | Ga0105237_1000063242 | 434 |
| 276 | 3300009545 | Ga0105237_10001840 | Ga0105237_1000184010 | 434 |
| 277 | 3300009545 | Ga0105237_10002057 | Ga0105237_1000205727 | 434 |
| 278 | 3300009545 | Ga0105237_10002169 | Ga0105237_100021693 | 434 |
| 279 | 3300009545 | Ga0105237_10104739 | Ga0105237_101047393 | 434 |
| 280 | 3300009551 | Ga0105238_10040527 | Ga0105238_100405272 | 434 |
| 281 | 3300009551 | Ga0105238_10047634 | Ga0105238_100476341 | 434 |
| 282 | 3300009551 | Ga0105238_10085256 | Ga0105238_100852563 | 434 |
| 283 | 3300010375 | Ga0105239_10000166 | Ga0105239_1000016671 | 434 |
| 284 | 3300010375 | Ga0105239_10001606 | Ga0105239_1000160626 | 434 |
| 285 | 3300010375 | Ga0105239_10002482 | Ga0105239_1000248225 | 434 |
| 286 | 3300010375 | Ga0105239_10051980 | Ga0105239_100519802 | 434 |
| 287 | 3300011119 | Ga0105246_10017539 | Ga0105246_100175392 | 434 |
| 288 | 3300011119 | Ga0105246_10101250 | Ga0105246_101012502 | 434 |
| 289 | 3300013296 | Ga0157374_10000742 | Ga0157374_100007426 | 434 |
| 290 | 3300013296 | Ga0157374_10002065 | Ga0157374_100020655 | 434 |
| 291 | 3300013296 | Ga0157374_10010475 | Ga0157374_100104752 | 434 |
| 292 | 3300013306 | Ga0163162_10000012 | Ga0163162_1000001289 | 434 |
| 293 | 3300025250 | Ga0209026_1004337 | Ga0209026_10043372 | 434 |
| 294 | 3300025272 | Ga0209455_1009132 | Ga0209455_10091322 | 434 |
| 295 | 3300025904 | Ga0207647_10000231 | Ga0207647_1000023141 | 434 |
| 296 | 3300025907 | Ga0207645_10000229 | Ga0207645_100002292 | 434 |
| 297 | 3300025909 | Ga0207705_10000026 | Ga0207705_10000026165 | 434 |
| 298 | 3300025911 | Ga0207654_10001012 | Ga0207654_1000101214 | 434 |
| 299 | 3300025911 | Ga0207654_10002331 | Ga0207654_100023314 | 434 |
| 300 | 3300025911 | Ga0207654_10019560 | Ga0207654_100195602 | 434 |
| 301 | 3300025912 | Ga0207707_10040095 | Ga0207707_100400952 | 434 |
| 302 | 3300025913 | Ga0207695_10000142 | Ga0207695_1000014261 | 434 |
| 303 | 3300025913 | Ga0207695_10013341 | Ga0207695_100133419 | 434 |
| 304 | 3300025913 | Ga0207695_10017626 | Ga0207695_100176262 | 434 |
| 305 | 3300025913 | Ga0207695_10025045 | Ga0207695_100250455 | 434 |
| 306 | 3300025914 | Ga0207671_10000110 | Ga0207671_1000011042 | 434 |
| 307 | 3300025914 | Ga0207671_10000815 | Ga0207671_1000081510 | 434 |
| 308 | 3300025914 | Ga0207671_10010705 | Ga0207671_100107052 | 434 |
| 309 | 3300025914 | Ga0207671_10014423 | Ga0207671_100144232 | 434 |
| 310 | 3300025914 | Ga0207671_10060055 | Ga0207671_100600553 | 434 |
| 311 | 3300025917 | Ga0207660_10005575 | Ga0207660_100055755 | 434 |
| 312 | 3300025921 | Ga0207652_10004129 | Ga0207652_100041297 | 434 |
| 313 | 3300025924 | Ga0207694_10024962 | Ga0207694_100249621 | 434 |
| 314 | 3300025924 | Ga0207694_10071503 | Ga0207694_100715033 | 434 |
| 315 | 3300025924 | Ga0207694_10124089 | Ga0207694_101240892 | 434 |
| 316 | 3300025933 | Ga0207706_10001203 | Ga0207706_1000120315 | 434 |
| 317 | 3300025935 | Ga0207709_10027926 | Ga0207709_100279262 | 434 |
| 318 | 3300025938 | Ga0207704_10000047 | Ga0207704_1000004772 | 434 |
| 319 | 3300025949 | Ga0207667_10000015 | Ga0207667_10000015244 | 434 |
| 320 | 3300025949 | Ga0207667_10000953 | Ga0207667_1000095313 | 434 |
| 321 | 3300025949 | Ga0207667_10049392 | Ga0207667_100493925 | 434 |
| 322 | 3300025960 | Ga0207651_10009099 | Ga0207651_100090992 | 434 |
| 323 | 3300026023 | Ga0207677_10027229 | Ga0207677_100272293 | 434 |
| 324 | 3300026023 | Ga0207677_10075580 | Ga0207677_100755801 | 434 |
| 325 | 3300026035 | Ga0207703_10118920 | Ga0207703_101189202 | 434 |
| 326 | 3300026041 | Ga0207639_10069759 | Ga0207639_100697592 | 434 |
| 327 | 3300026078 | Ga0207702_10000163 | Ga0207702_1000016340 | 434 |
| 328 | 3300026089 | Ga0207648_10001813 | Ga0207648_1000181321 | 434 |
| 329 | 3300026121 | Ga0207683_10001294 | Ga0207683_100012948 | 434 |
| 330 | 3300026142 | Ga0207698_10010879 | Ga0207698_100108796 | 434 |
| 331 | 3300028379 | Ga0268266_10000121 | Ga0268266_1000012179 | 434 |
| 332 | 3300028786 | Ga0307517_10000198 | Ga0307517_1000019882 | 434 |
| 333 | 3300031507 | Ga0307509_10032359 | Ga0307509_100323592 | 434 |
| 334 | 3300031911 | Ga0307412_10145233 | Ga0307412_101452331 | 434 |
| 335 | 3300033180 | Ga0307510_10051124 | Ga0307510_100511242 | 434 |
| 336 | 3300037312 | Ga0395899_0019326 | Ga0395899_0019326_2581_3933 | 434 |
| 337 | 3300037418 | Ga0395900_0000140 | Ga0395900_0000140_112468_113850 | 434 |
| 338 | 3300037418 | Ga0395900_0000275 | Ga0395900_0000275_8987_10339 | 434 |
| 339 | 3300037418 | Ga0395900_0011378 | Ga0395900_0011378_834_2186 | 434 |
| 340 | 3300037466 | Ga0395898_0001454 | Ga0395898_0001454_6030_7382 | 434 |
| 341 | 3300037466 | Ga0395898_0085054 | Ga0395898_0085054_613_1965 | 434 |
| 342 | 3300037471 | Ga0395905_0000248 | Ga0395905_0000248_39570_40922 | 434 |
| 343 | 3300037471 | Ga0395905_0009775 | Ga0395905_0009775_2347_3699 | 434 |
| 344 | 3300038443 | Ga0395901_0000145 | Ga0395901_0000145_80154_81506 | 434 |
| 345 | 3300038443 | Ga0395901_0007206 | Ga0395901_0007206_1351_2703 | 434 |
| 346 | 3300039447 | Ga0436361_1205912 | Ga0436361_1205912_503_1855 | 434 |
| 347 | 3300046507 | Ga0495606_0004155 | Ga0495606_0004155_8471_9823 | 434 |
| 348 | 3300047443 | Ga0495687_002555 | Ga0495687_002555_6256_7608 | 434 |
| 349 | 3300053122 | Ga0500608_000630 | Ga0500608_000630_7289_8641 | 434 |
| 350 | 3300053130 | Ga0500642_0009248 | Ga0500642_0009248_1448_2803 | 434 |
| 351 | iso_pu_bacteria | 2977232053 | 2977234041 | 434 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2anp-assembly1.cif.gz_A | functional glutamate 151 to histidine mutant of the aminopeptidase from aeromonas proteolytica. | 0.8697 | 4 | 345 |
| 1amp-assembly1.cif.gz_A | crystal structure of aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family | 0.8615 | 4 | 345 |
| 3b7i-assembly1.cif.gz_A | crystal structure of the s228a mutant of the aminopeptidase from vibrio proteolyticus in complex with leucine phosphonic acid | 0.8596 | 4 | 345 |
| 2anp-assembly1.cif.gz_A | functional glutamate 151 to histidine mutant of the aminopeptidase from aeromonas proteolytica. | 0.8584 | 4 | 345 |
| 3b3s-assembly1.cif.gz_A | crystal structure of the m180a mutant of the aminopeptidase from vibrio proteolyticus in complex with leucine | 0.8568 | 4 | 345 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1cp6A00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.8397 | 4 | 345 | 3.40.630.10 |
| 1cp6A00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.8288 | 4 | 345 | 3.40.630.10 |
| af_Q8WZ42_19723_19821_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8167 | 344 | 430 | 2.60.40.10 |
| af_O18023_1307_1414_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8105 | 345 | 429 | 2.60.40.10 |
| af_A0A2R8RVM5_101_187_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8096 | 346 | 425 | 2.60.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519M4J9-F1-model_v4 | Fibronectin type III domain-containing protein | 0.9942 | 339 | 434 |
|
| AF-A0A4Q3UNM7-F1-model_v4 | Fibronectin type-III domain-containing protein | 0.9765 | 349 | 434 |
|
| AF-A0A223P210-F1-model_v4 | Peptidase M28 | 0.9718 | 2 | 434 |
GO:0006508
GO:0008235 |
| AF-A0A1V6C3B7-F1-model_v4 | Bacterial leucyl aminopeptidase (EC 3.4.11.10) | 0.9716 | 6 | 430 |
GO:0004177
GO:0006508 GO:0008235 |
| AF-A0A353R7W0-F1-model_v4 | Peptidase M28 | 0.9693 | 4 | 354 |
GO:0006508
GO:0008235 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar