F418559

General Info

Members Datasets Scaffolds Average Seq Length
351 183 702 360

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100000001|Ga0068855_100000001783
Length 409
Sequence MAKEPKDTKKKTAPAADAQPLDLETIKKDLLAKAKKDGAIDQRDITAAIADTPENADILDALYTDLADAGVQVSSDVNALPGEDLPPIAGDDEWTAEDGEEVITEDQNYLDDIADDSVRLYLREIGKIPLLSAEEEFDLAQRIKRGDAAVKDLAAFQESGSKDKKKLEEIAXDKMAEANMRLVVSIAKRYVGRGLDLLDLIQEGNTGLLRAVEKFDPDKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLLRTQRRLTQELNREPTNEEIAAAMEIEVDKVEHIMKIKQDISSLDASIRDDEEDSVLSDFIEDEDTISPEDSATNQLLKEQVKGMLGALTEREQKILKLRFGLEDGKQHTLEEVGQEFSVTRERIRQIEAKALAKLRKHKDAKKLHDYIK

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
99 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
104 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
105 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
106 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
107 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
108 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
149 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
150 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
151 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
152 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
153 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
154 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
157 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
158 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
159 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
160 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
161 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
162 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
163 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
164 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
165 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
166 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
167 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
168 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
169 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
170 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
171 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
172 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
173 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
176 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
179 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
180 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
181 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
182 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.5
Nodule 0
Rhizoplane 0.57
Rhizosphere 74.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100000001 3300005563 Bacteria 818777
2 JGI24741J21665_1000398 3300001915 Bacteria 13132
3 JGI24740J21852_10003576 3300001979 Bacteria 6791
4 JGI24737J22298_10000068 3300001990 Bacteria 30563
5 JGI24735J21928_10000055 3300002067 Bacteria 48760
6 JGI24742J22300_10000070 3300002244 Bacteria 14887
7 rootH2_10000311 3300003320 Bacteria 277677
8 Ga0058862_10121158 3300004803 Bacteria 2701
9 Ga0065704_10085049 3300005289 Bacteria 3204
10 Ga0070658_10000097 3300005327 Bacteria 77127
11 Ga0070658_10000228 3300005327 Bacteria 49676
12 Ga0070658_10000484 3300005327 Bacteria 34597
13 Ga0070658_10010498 3300005327 Bacteria 7424
14 Ga0070658_10061391 3300005327 Bacteria 3062
15 Ga0070676_10011578 3300005328 Bacteria 4797
16 Ga0070690_100014032 3300005330 Bacteria 4749
17 Ga0070670_100033162 3300005331 Bacteria 4448
18 Ga0070680_100000241 3300005336 Bacteria 36226
19 Ga0070680_100313075 3300005336 Bacteria 1332
20 Ga0070682_100202611 3300005337 Bacteria 1401
21 Ga0070660_100000158 3300005339 Bacteria 44096
22 Ga0070660_100000169 3300005339 Bacteria 42786
23 Ga0070660_100000226 3300005339 Bacteria 37370
24 Ga0070660_100046449 3300005339 Bacteria 3328
25 Ga0070691_10012204 3300005341 Bacteria 3935
26 Ga0070661_100082495 3300005344 Bacteria 2374
27 Ga0070669_100134610 3300005353 Bacteria 1900
28 Ga0070673_100000196 3300005364 Bacteria 29915
29 Ga0070688_100068278 3300005365 Bacteria 2266
30 Ga0070659_100000131 3300005366 Bacteria 57281
31 Ga0070659_100082638 3300005366 Bacteria 2566
32 Ga0070667_100000001 3300005367 Bacteria 1108638
33 Ga0070681_10156801 3300005458 Bacteria 2201
34 Ga0070685_10001076 3300005466 Bacteria 14635
35 Ga0070685_10003561 3300005466 Bacteria 7904
36 Ga0070679_100000332 3300005530 Bacteria 40130
37 Ga0070679_100000499 3300005530 Bacteria 33449
38 Ga0070679_100031712 3300005530 Bacteria 5224
39 Ga0070679_100051299 3300005530 Bacteria 4109
40 Ga0070679_100136461 3300005530 Bacteria 2434
41 Ga0070672_100009953 3300005543 Bacteria 6576
42 Ga0070693_100020562 3300005547 Bacteria 3483
43 Ga0070665_100083305 3300005548 Bacteria 3203
44 Ga0068855_100000324 3300005563 Bacteria 59520
45 Ga0068855_100005245 3300005563 Bacteria 15810
46 Ga0068855_100011636 3300005563 Bacteria 10632
47 Ga0068855_100015134 3300005563 Bacteria 9289
48 Ga0068855_100015189 3300005563 Bacteria 9273
49 Ga0068857_100000001 3300005577 Bacteria 254081
50 Ga0068857_100022116 3300005577 Bacteria 5593
51 Ga0068857_100250908 3300005577 Bacteria 1622
52 Ga0068854_100035485 3300005578 Bacteria 3490
53 Ga0068854_100177702 3300005578 Bacteria 1661
54 Ga0068856_100000002 3300005614 Bacteria 372816
55 Ga0068856_100012876 3300005614 Bacteria 8096
56 Ga0068852_100005458 3300005616 Bacteria 9096
57 Ga0068863_100104064 3300005841 Bacteria 2700
58 Ga0068858_100010008 3300005842 Bacteria 9008
59 Ga0068860_100012430 3300005843 Bacteria 8385
60 Ga0068862_100160879 3300005844 Bacteria 2004
61 Ga0081455_10000020 3300005937 Bacteria 172997
62 Ga0081539_10051450 3300005985 Bacteria 2321
63 Ga0070717_10202487 3300006028 Bacteria 1739
64 Ga0075365_10058932 3300006038 Bacteria 2557
65 Ga0075365_10105726 3300006038 Bacteria 1931
66 Ga0075365_10156337 3300006038 Bacteria 1587
67 Ga0075368_10000088 3300006042 Bacteria 22805
68 Ga0075368_10024814 3300006042 Bacteria 2298
69 Ga0075363_100000029 3300006048 Bacteria 27762
70 Ga0075364_10000161 3300006051 Bacteria 29761
71 Ga0075364_10007538 3300006051 Bacteria 6469
72 Ga0075364_10124966 3300006051 Bacteria 1724
73 Ga0075367_10000007 3300006178 Bacteria 45077
74 Ga0075367_10000242 3300006178 Bacteria 18517
75 Ga0075369_10000004 3300006186 Bacteria 154675
76 Ga0075369_10000048 3300006186 Bacteria 30990
77 Ga0075369_10013369 3300006186 Bacteria 3258
78 Ga0075366_10000003 3300006195 Bacteria 114017
79 Ga0075366_10000015 3300006195 Bacteria 66498
80 Ga0075366_10000030 3300006195 Bacteria 49629
81 Ga0075366_10000064 3300006195 Bacteria 39771
82 Ga0097621_100000001 3300006237 Bacteria 632268
83 Ga0097621_100000130 3300006237 Bacteria 44188
84 Ga0075370_10000063 3300006353 Bacteria 32195
85 Ga0075370_10035936 3300006353 Bacteria 2782
86 Ga0068871_100000001 3300006358 Bacteria 215987
87 Ga0068871_100000006 3300006358 Bacteria 116822
88 Ga0105240_10235987 3300009093 Bacteria 2122
89 Ga0111539_10010609 3300009094 Bacteria 11600
90 Ga0105245_10000001 3300009098 Bacteria 939270
91 Ga0105245_10409303 3300009098 Bacteria 1357
92 Ga0105243_10181526 3300009148 Bacteria 1831
93 Ga0105241_10000009 3300009174 Bacteria 258876
94 Ga0105241_10001004 3300009174 Bacteria 21417
95 Ga0105241_10024490 3300009174 Bacteria 4482
96 Ga0105242_10001258 3300009176 Bacteria 19993
97 Ga0105248_10188865 3300009177 Bacteria 2321
98 Ga0105238_10000151 3300009551 Bacteria 76390
99 Ga0105238_10081063 3300009551 Bacteria 3234
100 Ga0105238_10125772 3300009551 Bacteria 2542
101 Ga0105249_10000744 3300009553 Bacteria 29317
102 Ga0105249_10029942 3300009553 Bacteria 4917
103 Ga0105033_100189 3300009986 Bacteria 4740
104 Ga0105239_10002455 3300010375 Bacteria 23626
105 Ga0105239_10009666 3300010375 Bacteria 10845
106 Ga0105239_10173060 3300010375 Bacteria 2415
107 Ga0157371_10002482 3300013102 Bacteria 17534
108 Ga0157369_10000273 3300013105 Bacteria 69535
109 Ga0157369_10016734 3300013105 Bacteria 8242
110 Ga0157369_10018169 3300013105 Bacteria 7887
111 Ga0157369_10159571 3300013105 Bacteria 2380
112 Ga0157374_10000014 3300013296 Bacteria 396846
113 Ga0157374_10002318 3300013296 Bacteria 16050
114 Ga0157374_10003583 3300013296 Bacteria 13073
115 Ga0157374_10033473 3300013296 Bacteria 4689
116 Ga0157374_10099058 3300013296 Bacteria 2791
117 Ga0157378_10203670 3300013297 Bacteria 1873
118 Ga0157372_10000774 3300013307 Bacteria 34598
119 Ga0157372_10012683 3300013307 Bacteria 8979
120 Ga0157372_10015808 3300013307 Bacteria 8097
121 Ga0157372_10173195 3300013307 Bacteria 2497
122 Ga0163163_10008260 3300014325 Bacteria 9241
123 Ga0163163_10019410 3300014325 Bacteria 6386
124 Ga0163163_10235020 3300014325 Bacteria 1882
125 Ga0157377_10053574 3300014745 Bacteria 2281
126 Ga0157376_10000001 3300014969 Bacteria 842910
127 Ga0206356_10657575 3300020070 Bacteria 1853
128 Ga0207645_10014628 3300025907 Bacteria 5243
129 Ga0207705_10000019 3300025909 Bacteria 317770
130 Ga0207705_10000057 3300025909 Bacteria 157369
131 Ga0207705_10000231 3300025909 Bacteria 55679
132 Ga0207705_10002131 3300025909 Bacteria 15361
133 Ga0207705_10083937 3300025909 Bacteria 2325
134 Ga0207654_10000002 3300025911 Bacteria 1460142
135 Ga0207654_10055160 3300025911 Bacteria 2299
136 Ga0207654_10067861 3300025911 Bacteria 2108
137 Ga0207654_10102374 3300025911 Bacteria 1767
138 Ga0207707_10010266 3300025912 Bacteria 8126
139 Ga0207707_10013359 3300025912 Bacteria 7158
140 Ga0207695_10056979 3300025913 Bacteria 4063
141 Ga0207695_10206607 3300025913 Bacteria 1876
142 Ga0207660_10000180 3300025917 Bacteria 40305
143 Ga0207657_10000502 3300025919 Bacteria 41290
144 Ga0207657_10003173 3300025919 Bacteria 17584
145 Ga0207657_10023455 3300025919 Bacteria 5745
146 Ga0207652_10003400 3300025921 Bacteria 13140
147 Ga0207652_10037375 3300025921 Bacteria 4110
148 Ga0207652_10249630 3300025921 Bacteria 1600
149 Ga0207652_10310781 3300025921 Bacteria 1423
150 Ga0207694_10001155 3300025924 Bacteria 22934
151 Ga0207694_10181483 3300025924 Bacteria 1707
152 Ga0207694_10182152 3300025924 Bacteria 1704
153 Ga0207650_10006693 3300025925 Bacteria 7858
154 Ga0207687_10000001 3300025927 Bacteria 1130810
155 Ga0207687_10000004 3300025927 Bacteria 841177
156 Ga0207687_10000008 3300025927 Bacteria 497738
157 Ga0207687_10023727 3300025927 Bacteria 4091
158 Ga0207664_10000161 3300025929 Bacteria 53847
159 Ga0207644_10036256 3300025931 Bacteria 3461
160 Ga0207690_10001822 3300025932 Bacteria 13077
161 Ga0207690_10204590 3300025932 Bacteria 1501
162 Ga0207686_10002162 3300025934 Bacteria 10824
163 Ga0207709_10108585 3300025935 Bacteria 1850
164 Ga0207691_10048127 3300025940 Bacteria 3910
165 Ga0207667_10000003 3300025949 Bacteria 822935
166 Ga0207667_10000577 3300025949 Bacteria 47784
167 Ga0207667_10004707 3300025949 Bacteria 16698
168 Ga0207667_10010449 3300025949 Bacteria 10850
169 Ga0207667_10023342 3300025949 Bacteria 6812
170 Ga0207667_10023585 3300025949 Bacteria 6774
171 Ga0207667_10034628 3300025949 Bacteria 5421
172 Ga0207651_10001595 3300025960 Bacteria 10386
173 Ga0207712_10072962 3300025961 Bacteria 2474
174 Ga0207712_10258704 3300025961 Bacteria 1410
175 Ga0207658_10000003 3300025986 Bacteria 1151934
176 Ga0207703_10029719 3300026035 Bacteria 4314
177 Ga0207702_10000001 3300026078 Bacteria 895738
178 Ga0207702_10038776 3300026078 Bacteria 3990
179 Ga0207641_10091066 3300026088 Bacteria 2668
180 Ga0207641_10110193 3300026088 Bacteria 2439
181 Ga0207674_10000021 3300026116 Bacteria 161986
182 Ga0207674_10016071 3300026116 Bacteria 8199
183 Ga0207674_10125112 3300026116 Bacteria 2537
184 Ga0207674_10367570 3300026116 Bacteria 1390
185 Ga0207698_10010288 3300026142 Bacteria 6000
186 Ga0207698_10014281 3300026142 Bacteria 5274
187 Ga0210002_1004533 3300027617 Bacteria 2072
188 Ga0209813_10000003 3300027866 Bacteria 207060
189 Ga0209813_10012369 3300027866 Bacteria 2254
190 Ga0209974_10004134 3300027876 Bacteria 5187
191 Ga0268266_10002107 3300028379 Bacteria 21977
192 Ga0268266_10062784 3300028379 Bacteria 3207
193 Ga0268265_10234813 3300028380 Bacteria 1614
194 Ga0268264_10002081 3300028381 Bacteria 17870
195 Ga0268264_10040640 3300028381 Bacteria 3843
196 Ga0265337_1000048 3300028556 Bacteria 53749
197 Ga0265337_1000791 3300028556 Bacteria 16642
198 Ga0265337_1003484 3300028556 Bacteria 6799
199 Ga0265326_10000208 3300028558 Bacteria 29214
200 Ga0265326_10000917 3300028558 Bacteria 10679
201 Ga0265326_10002637 3300028558 Bacteria 6007
202 Ga0265326_10022498 3300028558 Bacteria 1805
203 Ga0265326_10045778 3300028558 Bacteria 1240
204 Ga0265319_1044591 3300028563 Bacteria 1486
205 Ga0265334_10000004 3300028573 Bacteria 243436
206 Ga0265334_10000041 3300028573 Bacteria 98258
207 Ga0265334_10001327 3300028573 Bacteria 11930
208 Ga0265334_10010386 3300028573 Bacteria 3934
209 Ga0265322_10002738 3300028654 Bacteria 5404
210 Ga0265322_10008048 3300028654 Bacteria 3074
211 Ga0265336_10000020 3300028666 Bacteria 213480
212 Ga0265336_10023535 3300028666 Bacteria 1952
213 Ga0265338_10000003 3300028800 Bacteria 733923
214 Ga0265338_10000093 3300028800 Bacteria 168444
215 Ga0265338_10001060 3300028800 Bacteria 45733
216 Ga0265338_10001799 3300028800 Bacteria 33714
217 Ga0265338_10002189 3300028800 Bacteria 29934
218 Ga0265338_10002656 3300028800 Bacteria 26294
219 Ga0265338_10003103 3300028800 Bacteria 23792
220 Ga0265338_10003205 3300028800 Bacteria 23342
221 Ga0265338_10004463 3300028800 Bacteria 18876
222 Ga0265338_10025470 3300028800 Bacteria 6000
223 Ga0265338_10056817 3300028800 Bacteria 3466
224 Ga0265338_10065073 3300028800 Bacteria 3166
225 Ga0265338_10102261 3300028800 Bacteria 2330
226 Ga0265338_10215779 3300028800 Bacteria 1437
227 Ga0265324_10002301 3300029957 Bacteria 9933
228 Ga0265324_10008000 3300029957 Bacteria 4236
229 Ga0265340_10001423 3300031247 Bacteria 13734
230 Ga0265339_10044765 3300031249 Bacteria 2439
231 Ga0265339_10049672 3300031249 Bacteria 2296
232 Ga0265327_10000025 3300031251 Bacteria 380054
233 Ga0265327_10001879 3300031251 Bacteria 24298
234 Ga0265327_10019705 3300031251 Bacteria 4136
235 Ga0265316_10022626 3300031344 Bacteria 5293
236 Ga0265313_10037105 3300031595 Bacteria 2440
237 Ga0265314_10101193 3300031711 Bacteria 1852
238 Ga0307516_10124102 3300031730 Bacteria 2369
239 Ga0395900_0000434 3300037418 Bacteria 60035
240 Ga0395900_0013775 3300037418 Bacteria 8254
241 Ga0395900_0024306 3300037418 Bacteria 6204
242 Ga0395898_0004623 3300037466 Bacteria 15027
243 Ga0395898_0016917 3300037466 Bacteria 7445
244 Ga0395905_0002998 3300037471 Bacteria 18308
245 Ga0395905_0061933 3300037471 Bacteria 3500
246 Ga0395905_0148677 3300037471 Bacteria 2204
247 Ga0395901_0004862 3300038443 Bacteria 13561
248 Ga0395901_0012573 3300038443 Bacteria 8590
249 Ga0395901_0057984 3300038443 Bacteria 4028
250 Ga0395901_0277491 3300038443 Bacteria 1742
251 Ga0451807_2078009 3300041486 Bacteria 2262
252 Ga0495629_0008743 3300046459 Bacteria 7446
253 Ga0495622_0000008 3300046557 Bacteria 232461
254 Ga0495588_0000322 3300046674 Bacteria 31828
255 Ga0495658_0002196 3300046683 Bacteria 9875
256 Ga0495649_0000025 3300046694 Bacteria 175449
257 Ga0495672_0000323 3300047320 Bacteria 63547
258 Ga0495602_0068077 3300048088 Bacteria 3060
259 Ga0496100_0011756 3300048903 Bacteria 4993
260 Ga0496126_0262858 3300048929 Bacteria 1434
261 Ga0501031_0000789 3300049568 Bacteria 19049
262 Ga0501032_0001140 3300049569 Bacteria 21269
263 Ga0501034_0008367 3300049571 Bacteria 10937
264 Ga0501034_0056811 3300049571 Bacteria 3936
265 Ga0501036_0001992 3300049572 Bacteria 15858
266 Ga0501037_0000146 3300049573 Bacteria 65527
267 Ga0501037_0092212 3300049573 Bacteria 2191
268 Ga0501037_0183439 3300049573 Bacteria 1484
269 Ga0501038_0005119 3300049574 Bacteria 12181
270 Ga0501043_0002239 3300049579 Bacteria 16470
271 Ga0501046_0000061 3300049580 Bacteria 120487
272 Ga0501047_0000024 3300049581 Bacteria 230397
273 Ga0501047_0000637 3300049581 Bacteria 36844
274 Ga0501048_0000002 3300049582 Bacteria 108048
275 Ga0501048_0054868 3300049582 Bacteria 2831
276 Ga0501070_0014554 3300049586 Bacteria 6620
277 Ga0501070_0017559 3300049586 Bacteria 6006
278 Ga0501073_0058441 3300049589 Bacteria 2695
279 Ga0501080_0000007 3300049742 Bacteria 135749
280 Ga0501083_0042106 3300049744 Bacteria 3097
281 Ga0501083_0136157 3300049744 Bacteria 1609
282 Ga0501035_0000005 3300049822 Bacteria 392980
283 Ga0501035_0004999 3300049822 Bacteria 12560
284 Ga0501044_0003400 3300049823 Bacteria 17928
285 nmdc:mga03n38_23556_c1 3300050490 Bacteria 2506
286 nmdc:mga03n38_53_c1 3300050490 Bacteria 18217
287 nmdc:mga00v17_12456_c2 3300050491 Bacteria 2336
288 nmdc:mga00v17_13380_c1 3300050491 Bacteria 4554
289 nmdc:mga00v17_171242_c1 3300050491 Bacteria 1400
290 nmdc:mga00v17_50469_c1 3300050491 Bacteria 2528
291 nmdc:mga00v17_69000_c1 3300050491 Bacteria 2186
292 nmdc:mga0yw44_137228_c1 3300050492 Bacteria 1587
293 nmdc:mga0yw44_26128_c1 3300050492 Bacteria 3331
294 nmdc:mga0yw44_37839_c1 3300050492 Bacteria 2395
295 nmdc:mga0yw44_74714_c1 3300050492 Bacteria 2112
296 nmdc:mga0yw44_7_c1 3300050492 Bacteria 260877
297 nmdc:mga0k408_15_c1 3300050493 Bacteria 124193
298 nmdc:mga0k408_181_c1 3300050493 Bacteria 33119
299 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
300 nmdc:mga0k408_56_c1 3300050493 Bacteria 57024
301 nmdc:mga0k408_59_c1 3300050493 Bacteria 39640
302 nmdc:mga06z11_144_c1 3300050494 Bacteria 28448
303 nmdc:mga06z11_2_c1 3300050494 Bacteria 169056
304 nmdc:mga04h51_10661_c1 3300050495 Bacteria 2529
305 nmdc:mga04h51_3_c1 3300050495 Bacteria 207078
306 nmdc:mga07m45_19726_c1 3300050496 Bacteria 3654
307 nmdc:mga07m45_885_c1 3300050496 Bacteria 13073
308 nmdc:mga08y16_6406_c1 3300050511 Bacteria 12340
309 nmdc:mga0sz30_10_c3 3300050516 Bacteria 40799
310 nmdc:mga0sz30_11774_c1 3300050516 Bacteria 2624
311 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
312 Ga0500610_0000011 3300053079 Bacteria 91172
313 Ga0500610_0004071 3300053079 Bacteria 5733
314 Ga0500643_000009 3300053087 Bacteria 444150
315 Ga0500644_0000436 3300053088 Bacteria 19303
316 Ga0500644_0000704 3300053088 Bacteria 11847
317 Ga0500644_0027551 3300053088 Bacteria 1769
318 Ga0500646_0000253 3300053090 Bacteria 16386
319 Ga0500583_0000085 3300053092 Bacteria 52578
320 Ga0500583_0001791 3300053092 Bacteria 6289
321 Ga0500583_0002012 3300053092 Bacteria 5989
322 Ga0500651_0000011 3300053093 Bacteria 246573
323 Ga0500651_0022760 3300053093 Bacteria 3917
324 Ga0500651_0086810 3300053093 Bacteria 1932
325 Ga0500566_0000001 3300053094 Bacteria 1101031
326 Ga0500650_0000040 3300053098 Bacteria 48637
327 Ga0500555_000001 3300053103 Bacteria 1353713
328 Ga0500555_000002 3300053103 Bacteria 1314346
329 Ga0500556_0000419 3300053104 Bacteria 30563
330 Ga0500562_000001 3300053108 Bacteria 1178987
331 Ga0500562_000002 3300053108 Bacteria 977234
332 Ga0500594_0000001 3300053118 Bacteria 1178472
333 Ga0500614_000001 3300053123 Bacteria 1274484
334 Ga0500614_001870 3300053123 Bacteria 4865
335 Ga0500614_005800 3300053123 Bacteria 2594
336 Ga0500642_0002412 3300053130 Bacteria 5483
337 Ga0500652_000012 3300053131 Bacteria 155076
338 Ga0500655_000798 3300053133 Bacteria 6192
339 Ga0500655_004856 3300053133 Bacteria 2416
340 Ga0500561_0000002 3300053137 Bacteria 394147
341 Ga0500568_0015748 3300053139 Bacteria 3378
342 Ga0500577_0001073 3300053142 Bacteria 7051
343 Ga0500577_0001601 3300053142 Bacteria 5799
344 Ga0500589_000003 3300053147 Bacteria 220717
345 Ga0500616_0000005 3300053153 Bacteria 961725
346 Ga0500633_0007245 3300053160 Bacteria 2781
347 Ga0500649_000006 3300053722 Bacteria 116211
348 Ga0500570_000001 3300053724 Bacteria 243552
349 Ga0500611_000391 3300053727 Bacteria 4460
350 Ga0587083_0009177 3300059505 Bacteria 1570
351 Ga0501082_0016454 3300060353 Bacteria 6366
352 Ga0068855_100000001
353 JGI24741J21665_1000398
354 JGI24740J21852_10003576
355 JGI24737J22298_10000068
356 JGI24735J21928_10000055
357 JGI24742J22300_10000070
358 rootH2_10000311
359 Ga0058862_10121158
360 Ga0065704_10085049
361 Ga0070658_10000097
362 Ga0070658_10000228
363 Ga0070658_10000484
364 Ga0070658_10010498
365 Ga0070658_10061391
366 Ga0070676_10011578
367 Ga0070690_100014032
368 Ga0070670_100033162
369 Ga0070680_100000241
370 Ga0070680_100313075
371 Ga0070682_100202611
372 Ga0070660_100000158
373 Ga0070660_100000169
374 Ga0070660_100000226
375 Ga0070660_100046449
376 Ga0070691_10012204
377 Ga0070661_100082495
378 Ga0070669_100134610
379 Ga0070673_100000196
380 Ga0070688_100068278
381 Ga0070659_100000131
382 Ga0070659_100082638
383 Ga0070667_100000001
384 Ga0070681_10156801
385 Ga0070685_10001076
386 Ga0070685_10003561
387 Ga0070679_100000332
388 Ga0070679_100000499
389 Ga0070679_100031712
390 Ga0070679_100051299
391 Ga0070679_100136461
392 Ga0070672_100009953
393 Ga0070693_100020562
394 Ga0070665_100083305
395 Ga0068855_100000324
396 Ga0068855_100005245
397 Ga0068855_100011636
398 Ga0068855_100015134
399 Ga0068855_100015189
400 Ga0068857_100000001
401 Ga0068857_100022116
402 Ga0068857_100250908
403 Ga0068854_100035485
404 Ga0068854_100177702
405 Ga0068856_100000002
406 Ga0068856_100012876
407 Ga0068852_100005458
408 Ga0068863_100104064
409 Ga0068858_100010008
410 Ga0068860_100012430
411 Ga0068862_100160879
412 Ga0081455_10000020
413 Ga0081539_10051450
414 Ga0070717_10202487
415 Ga0075365_10058932
416 Ga0075365_10105726
417 Ga0075365_10156337
418 Ga0075368_10000088
419 Ga0075368_10024814
420 Ga0075363_100000029
421 Ga0075364_10000161
422 Ga0075364_10007538
423 Ga0075364_10124966
424 Ga0075367_10000007
425 Ga0075367_10000242
426 Ga0075369_10000004
427 Ga0075369_10000048
428 Ga0075369_10013369
429 Ga0075366_10000003
430 Ga0075366_10000015
431 Ga0075366_10000030
432 Ga0075366_10000064
433 Ga0097621_100000001
434 Ga0097621_100000130
435 Ga0075370_10000063
436 Ga0075370_10035936
437 Ga0068871_100000001
438 Ga0068871_100000006
439 Ga0105240_10235987
440 Ga0111539_10010609
441 Ga0105245_10000001
442 Ga0105245_10409303
443 Ga0105243_10181526
444 Ga0105241_10000009
445 Ga0105241_10001004
446 Ga0105241_10024490
447 Ga0105242_10001258
448 Ga0105248_10188865
449 Ga0105238_10000151
450 Ga0105238_10081063
451 Ga0105238_10125772
452 Ga0105249_10000744
453 Ga0105249_10029942
454 Ga0105033_100189
455 Ga0105239_10002455
456 Ga0105239_10009666
457 Ga0105239_10173060
458 Ga0157371_10002482
459 Ga0157369_10000273
460 Ga0157369_10016734
461 Ga0157369_10018169
462 Ga0157369_10159571
463 Ga0157374_10000014
464 Ga0157374_10002318
465 Ga0157374_10003583
466 Ga0157374_10033473
467 Ga0157374_10099058
468 Ga0157378_10203670
469 Ga0157372_10000774
470 Ga0157372_10012683
471 Ga0157372_10015808
472 Ga0157372_10173195
473 Ga0163163_10008260
474 Ga0163163_10019410
475 Ga0163163_10235020
476 Ga0157377_10053574
477 Ga0157376_10000001
478 Ga0206356_10657575
479 Ga0207645_10014628
480 Ga0207705_10000019
481 Ga0207705_10000057
482 Ga0207705_10000231
483 Ga0207705_10002131
484 Ga0207705_10083937
485 Ga0207654_10000002
486 Ga0207654_10055160
487 Ga0207654_10067861
488 Ga0207654_10102374
489 Ga0207707_10010266
490 Ga0207707_10013359
491 Ga0207695_10056979
492 Ga0207695_10206607
493 Ga0207660_10000180
494 Ga0207657_10000502
495 Ga0207657_10003173
496 Ga0207657_10023455
497 Ga0207652_10003400
498 Ga0207652_10037375
499 Ga0207652_10249630
500 Ga0207652_10310781
501 Ga0207694_10001155
502 Ga0207694_10181483
503 Ga0207694_10182152
504 Ga0207650_10006693
505 Ga0207687_10000001
506 Ga0207687_10000004
507 Ga0207687_10000008
508 Ga0207687_10023727
509 Ga0207664_10000161
510 Ga0207644_10036256
511 Ga0207690_10001822
512 Ga0207690_10204590
513 Ga0207686_10002162
514 Ga0207709_10108585
515 Ga0207691_10048127
516 Ga0207667_10000003
517 Ga0207667_10000577
518 Ga0207667_10004707
519 Ga0207667_10010449
520 Ga0207667_10023342
521 Ga0207667_10023585
522 Ga0207667_10034628
523 Ga0207651_10001595
524 Ga0207712_10072962
525 Ga0207712_10258704
526 Ga0207658_10000003
527 Ga0207703_10029719
528 Ga0207702_10000001
529 Ga0207702_10038776
530 Ga0207641_10091066
531 Ga0207641_10110193
532 Ga0207674_10000021
533 Ga0207674_10016071
534 Ga0207674_10125112
535 Ga0207674_10367570
536 Ga0207698_10010288
537 Ga0207698_10014281
538 Ga0210002_1004533
539 Ga0209813_10000003
540 Ga0209813_10012369
541 Ga0209974_10004134
542 Ga0268266_10002107
543 Ga0268266_10062784
544 Ga0268265_10234813
545 Ga0268264_10002081
546 Ga0268264_10040640
547 Ga0265337_1000048
548 Ga0265337_1000791
549 Ga0265337_1003484
550 Ga0265326_10000208
551 Ga0265326_10000917
552 Ga0265326_10002637
553 Ga0265326_10022498
554 Ga0265326_10045778
555 Ga0265319_1044591
556 Ga0265334_10000004
557 Ga0265334_10000041
558 Ga0265334_10001327
559 Ga0265334_10010386
560 Ga0265322_10002738
561 Ga0265322_10008048
562 Ga0265336_10000020
563 Ga0265336_10023535
564 Ga0265338_10000003
565 Ga0265338_10000093
566 Ga0265338_10001060
567 Ga0265338_10001799
568 Ga0265338_10002189
569 Ga0265338_10002656
570 Ga0265338_10003103
571 Ga0265338_10003205
572 Ga0265338_10004463
573 Ga0265338_10025470
574 Ga0265338_10056817
575 Ga0265338_10065073
576 Ga0265338_10102261
577 Ga0265338_10215779
578 Ga0265324_10002301
579 Ga0265324_10008000
580 Ga0265340_10001423
581 Ga0265339_10044765
582 Ga0265339_10049672
583 Ga0265327_10000025
584 Ga0265327_10001879
585 Ga0265327_10019705
586 Ga0265316_10022626
587 Ga0265313_10037105
588 Ga0265314_10101193
589 Ga0307516_10124102
590 Ga0395900_0000434
591 Ga0395900_0013775
592 Ga0395900_0024306
593 Ga0395898_0004623
594 Ga0395898_0016917
595 Ga0395905_0002998
596 Ga0395905_0061933
597 Ga0395905_0148677
598 Ga0395901_0004862
599 Ga0395901_0012573
600 Ga0395901_0057984
601 Ga0395901_0277491
602 Ga0451807_2078009
603 Ga0495629_0008743
604 Ga0495622_0000008
605 Ga0495588_0000322
606 Ga0495658_0002196
607 Ga0495649_0000025
608 Ga0495672_0000323
609 Ga0495602_0068077
610 Ga0496100_0011756
611 Ga0496126_0262858
612 Ga0501031_0000789
613 Ga0501032_0001140
614 Ga0501034_0008367
615 Ga0501034_0056811
616 Ga0501036_0001992
617 Ga0501037_0000146
618 Ga0501037_0092212
619 Ga0501037_0183439
620 Ga0501038_0005119
621 Ga0501043_0002239
622 Ga0501046_0000061
623 Ga0501047_0000024
624 Ga0501047_0000637
625 Ga0501048_0000002
626 Ga0501048_0054868
627 Ga0501070_0014554
628 Ga0501070_0017559
629 Ga0501073_0058441
630 Ga0501080_0000007
631 Ga0501083_0042106
632 Ga0501083_0136157
633 Ga0501035_0000005
634 Ga0501035_0004999
635 Ga0501044_0003400
636 nmdc:mga03n38_23556_c1
637 nmdc:mga03n38_53_c1
638 nmdc:mga00v17_12456_c2
639 nmdc:mga00v17_13380_c1
640 nmdc:mga00v17_171242_c1
641 nmdc:mga00v17_50469_c1
642 nmdc:mga00v17_69000_c1
643 nmdc:mga0yw44_137228_c1
644 nmdc:mga0yw44_26128_c1
645 nmdc:mga0yw44_37839_c1
646 nmdc:mga0yw44_74714_c1
647 nmdc:mga0yw44_7_c1
648 nmdc:mga0k408_15_c1
649 nmdc:mga0k408_181_c1
650 nmdc:mga0k408_1_c1
651 nmdc:mga0k408_56_c1
652 nmdc:mga0k408_59_c1
653 nmdc:mga06z11_144_c1
654 nmdc:mga06z11_2_c1
655 nmdc:mga04h51_10661_c1
656 nmdc:mga04h51_3_c1
657 nmdc:mga07m45_19726_c1
658 nmdc:mga07m45_885_c1
659 nmdc:mga08y16_6406_c1
660 nmdc:mga0sz30_10_c3
661 nmdc:mga0sz30_11774_c1
662 nmdc:mga0sz30_2_c1
663 Ga0500610_0000011
664 Ga0500610_0004071
665 Ga0500643_000009
666 Ga0500644_0000436
667 Ga0500644_0000704
668 Ga0500644_0027551
669 Ga0500646_0000253
670 Ga0500583_0000085
671 Ga0500583_0001791
672 Ga0500583_0002012
673 Ga0500651_0000011
674 Ga0500651_0022760
675 Ga0500651_0086810
676 Ga0500566_0000001
677 Ga0500650_0000040
678 Ga0500555_000001
679 Ga0500555_000002
680 Ga0500556_0000419
681 Ga0500562_000001
682 Ga0500562_000002
683 Ga0500594_0000001
684 Ga0500614_000001
685 Ga0500614_001870
686 Ga0500614_005800
687 Ga0500642_0002412
688 Ga0500652_000012
689 Ga0500655_000798
690 Ga0500655_004856
691 Ga0500561_0000002
692 Ga0500568_0015748
693 Ga0500577_0001073
694 Ga0500577_0001601
695 Ga0500589_000003
696 Ga0500616_0000005
697 Ga0500633_0007245
698 Ga0500649_000006
699 Ga0500570_000001
700 Ga0500611_000391
701 Ga0587083_0009177
702 Ga0501082_0016454

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

344

397

0.98

PF00140

Sigma70_r1_2

Sigma-70 factor, region 1.2

116

149

0.97

PF04542

Sigma70_r2

Sigma-70 region 2

175

245

0.97

PF04539

Sigma70_r3

Sigma-70 region 3

254

332

0.95

PF03979

Sigma70_r1_1

Sigma-70 factor, region 1.1

22

106

0.81

Map