F418562

General Info

Members Datasets Scaffolds Average Seq Length
351 245 351 146

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_101429129|Ga0068855_1014291292
Length 155
Sequence VSETRTTYYLPPGLPAPRPTEPALEQPYWDAVRKERLQVQRCGACAGWQWGPEWICHRCLSRDMRWEEVAPEGRIYSWERVWHAAHPALVGHTPYVAVLVELPQAGGVRMVGNLLGDPQQEVRIGAPVKAVFEHHEDAEPPFTLVHWRTVEDAKG

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
158 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
161 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
179 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
182 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
183 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
184 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
237 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
238 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
239 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
240 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
241 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
242 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.25
Nodule 0
Rhizoplane 0.57
Rhizosphere 84.05
Stem 0
Stem Tuber 0
Unclassified 1.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10059056 3300003911 Bacteria 828
2 Ga0065715_10165715 3300005293 Bacteria 1588
3 Ga0070676_10028193 3300005328 Bacteria 3188
4 Ga0070676_10989300 3300005328 Bacteria 631
5 Ga0070690_100034416 3300005330 Bacteria 3175
6 Ga0070690_100220746 3300005330 Bacteria 1328
7 Ga0070690_100811826 3300005330 Bacteria 726
8 Ga0070670_100009779 3300005331 Bacteria 8190
9 Ga0068869_100046454 3300005334 Bacteria 3131
10 Ga0070680_100000809 3300005336 Bacteria 22038
11 Ga0070682_100000343 3300005337 Bacteria 32035
12 Ga0068868_100061985 3300005338 Bacteria 2963
13 Ga0068868_100804989 3300005338 Bacteria 848
14 Ga0070660_100000092 3300005339 Bacteria 54311
15 Ga0070689_100402816 3300005340 Bacteria 1157
16 Ga0070689_100796573 3300005340 Bacteria 831
17 Ga0070687_100180111 3300005343 Bacteria 1265
18 Ga0070661_100001263 3300005344 Bacteria 17772
19 Ga0070668_100279470 3300005347 Bacteria 1394
20 Ga0070669_100113766 3300005353 Bacteria 2056
21 Ga0070671_100396639 3300005355 Bacteria 1180
22 Ga0070673_100030976 3300005364 Bacteria 4010
23 Ga0070659_100002620 3300005366 Bacteria 12789
24 Ga0070667_101388537 3300005367 Bacteria 659
25 Ga0070703_10002360 3300005406 Bacteria 5444
26 Ga0070710_10759802 3300005437 Bacteria 689
27 Ga0070705_100000097 3300005440 Bacteria 49136
28 Ga0070694_100001563 3300005444 Bacteria 13463
29 Ga0070708_100017201 3300005445 Bacteria 6023
30 Ga0070708_100164854 3300005445 Bacteria 2067
31 Ga0070708_100284432 3300005445 Bacteria 1557
32 Ga0070678_100043397 3300005456 Bacteria 3203
33 Ga0070662_100004633 3300005457 Bacteria 8716
34 Ga0068867_100000688 3300005459 Bacteria 22451
35 Ga0070685_10941612 3300005466 Bacteria 645
36 Ga0070706_100021182 3300005467 Bacteria 5986
37 Ga0070706_100031496 3300005467 Bacteria 4890
38 Ga0070706_101104758 3300005467 Bacteria 730
39 Ga0070707_100012260 3300005468 Bacteria 8006
40 Ga0070707_100103697 3300005468 Bacteria 2756
41 Ga0070707_100367824 3300005468 Bacteria 1397
42 Ga0070698_100001984 3300005471 Bacteria 22716
43 Ga0070698_100003330 3300005471 Bacteria 17684
44 Ga0070698_100287771 3300005471 Bacteria 1574
45 Ga0070699_100023184 3300005518 Bacteria 5348
46 Ga0070699_100062335 3300005518 Bacteria 3232
47 Ga0070699_100210315 3300005518 Bacteria 1731
48 Ga0070699_100929663 3300005518 Bacteria 797
49 Ga0070699_101175257 3300005518 Bacteria 704
50 Ga0070679_100008626 3300005530 Bacteria 9608
51 Ga0070684_100032545 3300005535 Bacteria 4444
52 Ga0070697_100033060 3300005536 Bacteria 4164
53 Ga0070697_100176255 3300005536 Bacteria 1811
54 Ga0070697_100384704 3300005536 Bacteria 1216
55 Ga0070697_101367527 3300005536 Bacteria 632
56 Ga0068853_100001921 3300005539 Bacteria 15321
57 Ga0070672_100274539 3300005543 Bacteria 1424
58 Ga0070672_100532347 3300005543 Bacteria 1019
59 Ga0070672_101019340 3300005543 Bacteria 734
60 Ga0070695_100046499 3300005545 Bacteria 2769
61 Ga0070696_100069341 3300005546 Bacteria 2477
62 Ga0070693_100011674 3300005547 Bacteria 4427
63 Ga0070665_100007700 3300005548 Bacteria 10937
64 Ga0070665_100010905 3300005548 Bacteria 9192
65 Ga0070704_100000208 3300005549 Bacteria 24431
66 Ga0070704_100238172 3300005549 Bacteria 1488
67 Ga0068855_100001162 3300005563 Bacteria 32633
68 Ga0068855_101399985 3300005563 Bacteria 721
69 Ga0068855_101429129 3300005563 Bacteria 712
70 Ga0070664_100856939 3300005564 Bacteria 851
71 Ga0068857_100009260 3300005577 Bacteria 8544
72 Ga0068857_100026061 3300005577 Bacteria 5150
73 Ga0068854_100001418 3300005578 Bacteria 14479
74 Ga0068856_100001410 3300005614 Bacteria 25205
75 Ga0068864_100020734 3300005618 Bacteria 5500
76 Ga0068864_100613480 3300005618 Bacteria 1057
77 Ga0068866_10664500 3300005718 Bacteria 711
78 Ga0068870_10000045 3300005840 Bacteria 37970
79 Ga0068863_100020310 3300005841 Bacteria 6352
80 Ga0068858_100062388 3300005842 Bacteria 3446
81 Ga0068860_100042183 3300005843 Bacteria 4359
82 Ga0068862_100221839 3300005844 Bacteria 1712
83 Ga0081455_10001289 3300005937 Bacteria 31161
84 Ga0081455_10001486 3300005937 Bacteria 29017
85 Ga0081455_10003938 3300005937 Bacteria 16882
86 Ga0081455_10039261 3300005937 Bacteria 4185
87 Ga0081455_10777546 3300005937 Bacteria 603
88 Ga0081538_10071210 3300005981 Bacteria 1914
89 Ga0081539_10014281 3300005985 Bacteria 5888
90 Ga0075365_10095308 3300006038 Bacteria 2032
91 Ga0075365_10254444 3300006038 Bacteria 1234
92 Ga0075365_10451930 3300006038 Bacteria 907
93 Ga0075365_10556265 3300006038 Bacteria 811
94 Ga0075365_10873126 3300006038 Bacteria 634
95 Ga0075368_10212362 3300006042 Bacteria 821
96 Ga0075363_100067882 3300006048 Bacteria 1933
97 Ga0075363_100157185 3300006048 Bacteria 1286
98 Ga0075363_100568429 3300006048 Bacteria 677
99 Ga0075364_10602653 3300006051 Bacteria 750
100 Ga0075362_10011833 3300006177 Bacteria 3447
101 Ga0075362_10134091 3300006177 Bacteria 1180
102 Ga0075362_10153104 3300006177 Bacteria 1107
103 Ga0075362_10247858 3300006177 Bacteria 876
104 Ga0075367_10013803 3300006178 Bacteria 4357
105 Ga0075367_10019275 3300006178 Bacteria 3781
106 Ga0075367_10290471 3300006178 Bacteria 1028
107 Ga0075367_10395804 3300006178 Bacteria 873
108 Ga0075369_10002040 3300006186 Bacteria 7116
109 Ga0075369_10095563 3300006186 Bacteria 1329
110 Ga0097621_100571068 3300006237 Bacteria 1031
111 Ga0075370_10145366 3300006353 Bacteria 1387
112 Ga0075370_10336841 3300006353 Bacteria 900
113 Ga0068871_100432410 3300006358 Bacteria 1177
114 Ga0075428_100024710 3300006844 Bacteria 6648
115 Ga0075428_100367988 3300006844 Bacteria 1542
116 Ga0075428_101302182 3300006844 Bacteria 764
117 Ga0075430_100001163 3300006846 Bacteria 21045
118 Ga0075430_101253535 3300006846 Bacteria 610
119 Ga0075431_100004149 3300006847 Bacteria 14151
120 Ga0075434_100117690 3300006871 Bacteria 2670
121 Ga0075429_100616507 3300006880 Bacteria 951
122 Ga0068865_100533756 3300006881 Bacteria 983
123 Ga0068865_101089724 3300006881 Bacteria 703
124 Ga0075436_100160843 3300006914 Bacteria 1583
125 Ga0075435_100085430 3300007076 Bacteria 2597
126 Ga0075435_100152992 3300007076 Bacteria 1940
127 Ga0099794_10157712 3300007265 Bacteria 1153
128 Ga0099794_10217062 3300007265 Bacteria 982
129 Ga0105240_11170010 3300009093 Bacteria 815
130 Ga0105240_11312118 3300009093 Bacteria 763
131 Ga0111539_10001599 3300009094 Bacteria 30206
132 Ga0111539_10892142 3300009094 Bacteria 1034
133 Ga0111539_11729824 3300009094 Bacteria 725
134 Ga0105245_10258932 3300009098 Bacteria 1693
135 Ga0105245_11307990 3300009098 Bacteria 774
136 Ga0105247_10878616 3300009101 Bacteria 690
137 Ga0114129_10006586 3300009147 Bacteria 16490
138 Ga0105243_10094623 3300009148 Bacteria 2467
139 Ga0105241_10003277 3300009174 Bacteria 12046
140 Ga0105248_10860099 3300009177 Bacteria 1024
141 Ga0105248_11041900 3300009177 Bacteria 924
142 Ga0105248_11595871 3300009177 Bacteria 739
143 Ga0105237_10305257 3300009545 Bacteria 1594
144 Ga0105238_11484989 3300009551 Bacteria 706
145 Ga0105238_12444184 3300009551 Bacteria 558
146 Ga0105238_12828941 3300009551 Bacteria 522
147 Ga0105249_10032591 3300009553 Bacteria 4715
148 Ga0105249_10507717 3300009553 Bacteria 1251
149 Ga0105249_12071466 3300009553 Bacteria 642
150 Ga0105249_12561755 3300009553 Bacteria 582
151 Ga0099796_10113965 3300010159 Bacteria 1032
152 Ga0105239_10368277 3300010375 Bacteria 1624
153 Ga0105246_10227446 3300011119 Bacteria 1466
154 Ga0157373_10000370 3300013100 Bacteria 36005
155 Ga0157369_10027879 3300013105 Bacteria 6256
156 Ga0157374_10534561 3300013296 Bacteria 1179
157 Ga0163162_11254227 3300013306 Bacteria 842
158 Ga0157515_130084 3300013875 Bacteria 827
159 Ga0163163_10144825 3300014325 Bacteria 2419
160 Ga0182008_10069601 3300014497 Bacteria 1731
161 Ga0206354_10361920 3300020081 Bacteria 1734
162 Ga0213871_10001086 3300021441 Bacteria 4300
163 Ga0207697_10082813 3300025315 Bacteria 1353
164 Ga0207697_10194147 3300025315 Bacteria 892
165 Ga0207653_10007293 3300025885 Bacteria 3448
166 Ga0207688_10076957 3300025901 Bacteria 1900
167 Ga0207688_10131162 3300025901 Bacteria 1469
168 Ga0207680_10705466 3300025903 Bacteria 723
169 Ga0207645_10000264 3300025907 Bacteria 43356
170 Ga0207645_10398025 3300025907 Bacteria 926
171 Ga0207643_10000077 3300025908 Bacteria 64121
172 Ga0207684_10002667 3300025910 Bacteria 17847
173 Ga0207684_10006341 3300025910 Bacteria 10787
174 Ga0207684_10310724 3300025910 Bacteria 1359
175 Ga0207654_10006156 3300025911 Bacteria 6030
176 Ga0207707_10000234 3300025912 Bacteria 59924
177 Ga0207671_10209882 3300025914 Bacteria 1523
178 Ga0207660_10000890 3300025917 Bacteria 19670
179 Ga0207662_10036728 3300025918 Bacteria 2865
180 Ga0207657_10000419 3300025919 Bacteria 45112
181 Ga0207649_10024279 3300025920 Bacteria 3522
182 Ga0207652_10000306 3300025921 Bacteria 50379
183 Ga0207646_10000905 3300025922 Bacteria 38211
184 Ga0207646_10036211 3300025922 Bacteria 4455
185 Ga0207681_10007590 3300025923 Bacteria 6646
186 Ga0207694_11057135 3300025924 Bacteria 687
187 Ga0207650_10049884 3300025925 Bacteria 3093
188 Ga0207644_10753106 3300025931 Bacteria 814
189 Ga0207690_10019619 3300025932 Bacteria 4167
190 Ga0207706_10011147 3300025933 Bacteria 8192
191 Ga0207709_10097241 3300025935 Bacteria 1938
192 Ga0207670_10292038 3300025936 Bacteria 1274
193 Ga0207670_10894559 3300025936 Bacteria 743
194 Ga0207669_10142103 3300025937 Bacteria 1668
195 Ga0207704_10472651 3300025938 Bacteria 1005
196 Ga0207704_11029882 3300025938 Bacteria 697
197 Ga0207691_10410521 3300025940 Bacteria 1154
198 Ga0207691_10546723 3300025940 Bacteria 982
199 Ga0207689_10000138 3300025942 Bacteria 62632
200 Ga0207679_10006218 3300025945 Bacteria 7539
201 Ga0207667_10000287 3300025949 Bacteria 69607
202 Ga0207667_10629465 3300025949 Bacteria 1080
203 Ga0207651_10026375 3300025960 Bacteria 3629
204 Ga0207651_10303630 3300025960 Bacteria 1328
205 Ga0207651_10411830 3300025960 Bacteria 1152
206 Ga0207712_10324979 3300025961 Bacteria 1271
207 Ga0207712_10809384 3300025961 Bacteria 824
208 Ga0207668_10372396 3300025972 Bacteria 1200
209 Ga0207640_10060659 3300025981 Bacteria 2501
210 Ga0207658_11237712 3300025986 Bacteria 682
211 Ga0207677_10420184 3300026023 Bacteria 1138
212 Ga0207703_10175012 3300026035 Bacteria 1890
213 Ga0207703_10893500 3300026035 Bacteria 850
214 Ga0207703_11807690 3300026035 Bacteria 587
215 Ga0207639_10113786 3300026041 Bacteria 2210
216 Ga0207678_10002675 3300026067 Bacteria 16172
217 Ga0207702_10031800 3300026078 Bacteria 4401
218 Ga0207641_10158689 3300026088 Bacteria 2054
219 Ga0207641_10711875 3300026088 Bacteria 989
220 Ga0207648_10001989 3300026089 Bacteria 22320
221 Ga0207674_10000315 3300026116 Bacteria 61743
222 Ga0207674_10014929 3300026116 Bacteria 8560
223 Ga0207674_10269247 3300026116 Bacteria 1651
224 Ga0207675_100015103 3300026118 Bacteria 7205
225 Ga0207683_10047609 3300026121 Bacteria 3755
226 Ga0207428_10082130 3300027907 Bacteria 2515
227 Ga0268266_10181903 3300028379 Bacteria 1914
228 Ga0268265_10828328 3300028380 Bacteria 904
229 Ga0265332_10067846 3300031238 Bacteria 1521
230 Ga0265316_10326425 3300031344 Bacteria 1114
231 Ga0307408_101591979 3300031548 Unclassified 620
232 Ga0307405_10299151 3300031731 Bacteria 1220
233 Ga0307410_10378245 3300031852 Bacteria 1139
234 Ga0307412_10974720 3300031911 Archaea 748
235 Ga0307409_100491161 3300031995 Bacteria 1193
236 Ga0307416_100992930 3300032002 Bacteria 942
237 Ga0307415_100215958 3300032126 Bacteria 1534
238 Ga0307415_100224045 3300032126 Bacteria 1510
239 Ga0373948_0050443 3300034817 Bacteria 893
240 Ga0373959_0076006 3300034820 Bacteria 766
241 Ga0373934_0056385 3300035086 Bacteria 1563
242 Ga0373940_0009299 3300035088 Bacteria 2282
243 Ga0373952_0058054 3300035092 Bacteria 939
244 Ga0373936_0387924 3300035113 Bacteria 640
245 Ga0373939_0078390 3300035114 Bacteria 1092
246 Ga0373939_0236253 3300035114 Bacteria 706
247 Ga0373939_0475998 3300035114 Bacteria 530
248 Ga0373954_0120540 3300035118 Bacteria 1273
249 Ga0373946_0499524 3300035171 Bacteria 624
250 Ga0373961_0176072 3300035241 Bacteria 743
251 Ga0373927_0112821 3300035695 Bacteria 1772
252 Ga0373933_0139654 3300035724 Bacteria 1529
253 Ga0373937_0413330 3300036401 Bacteria 1280
254 Ga0373925_0215942 3300037068 Bacteria 1529
255 Ga0395899_0408721 3300037312 Bacteria 897
256 Ga0395900_1422640 3300037418 Bacteria 606
257 Ga0395901_0030605 3300038443 Bacteria 5546
258 Ga0436365_1159260 3300039437 Bacteria 848
259 Ga0436360_1052254 3300039438 Bacteria 3557
260 Ga0436361_0787177 3300039447 Bacteria 3898
261 Ga0436363_0349805 3300039450 Bacteria 879
262 Ga0451839_0738751 3300041496 Bacteria 1003
263 Ga0451843_1460392 3300041509 Bacteria 641
264 Ga0439448_0002151 3300042005 Bacteria 5309
265 Ga0439458_0003842 3300042157 Bacteria 3473
266 Ga0439444_0011949 3300042437 Bacteria 1416
267 Ga0439459_0001033 3300042438 Bacteria 3971
268 Ga0439460_0027409 3300042461 Bacteria 1600
269 Ga0451577_0016612 3300042876 Bacteria 6810
270 Ga0451577_0082178 3300042876 Bacteria 2873
271 Ga0453683_0009761 3300044673 Bacteria 6399
272 Ga0466963_0032443 3300044694 Bacteria 3382
273 Ga0453684_0033681 3300044712 Bacteria 7134
274 Ga0453684_0257533 3300044712 Bacteria 2000
275 Ga0451576_0174876 3300045051 Bacteria 2241
276 Ga0495629_0297921 3300046459 Bacteria 1105
277 Ga0495580_0187117 3300046472 Bacteria 1429
278 Ga0495669_0020102 3300046684 Bacteria 2887
279 Ga0495581_0608377 3300047315 Bacteria 633
280 Ga0496102_0070421 3300048905 Bacteria 3211
281 Ga0496103_0186006 3300048906 Bacteria 1335
282 Ga0501033_0238735 3300049570 Bacteria 1290
283 Ga0501034_0003169 3300049571 Bacteria 18910
284 Ga0501034_0011580 3300049571 Bacteria 9132
285 Ga0501034_0188285 3300049571 Bacteria 2026
286 Ga0501034_0596145 3300049571 Bacteria 1011
287 Ga0501036_0174517 3300049572 Bacteria 1810
288 Ga0501037_0418867 3300049573 Bacteria 917
289 Ga0501037_1047608 3300049573 Unclassified 530
290 Ga0501038_1040321 3300049574 Bacteria 600
291 Ga0501039_0395297 3300049575 Bacteria 1086
292 Ga0501039_0780010 3300049575 Bacteria 746
293 Ga0501040_0049792 3300049576 Bacteria 2865
294 Ga0501042_0328932 3300049578 Bacteria 1105
295 Ga0501043_0403489 3300049579 Bacteria 1033
296 Ga0501046_0095210 3300049580 Bacteria 2288
297 Ga0501047_0452992 3300049581 Bacteria 1112
298 Ga0501048_0063379 3300049582 Bacteria 2615
299 Ga0501067_0033966 3300049583 Bacteria 2831
300 Ga0501068_0015808 3300049584 Bacteria 4343
301 Ga0501068_0422102 3300049584 Bacteria 861
302 Ga0501071_0415051 3300049587 Bacteria 1028
303 Ga0501072_0220857 3300049588 Bacteria 1510
304 Ga0501074_0275919 3300049590 Bacteria 1195
305 Ga0501075_0083661 3300049591 Bacteria 2417
306 Ga0501077_0027791 3300049593 Bacteria 3593
307 Ga0501079_0131301 3300049741 Bacteria 1949
308 Ga0501079_0554930 3300049741 Bacteria 903
309 Ga0501080_0504614 3300049742 Bacteria 1081
310 Ga0501081_0033176 3300049743 Bacteria 3506
311 Ga0501044_0015018 3300049823 Bacteria 8349
312 Ga0501044_1150947 3300049823 Bacteria 644
313 Ga0501045_0061359 3300049824 Bacteria 2758
314 nmdc:mga03683_11102_c1 3300050489 Bacteria 3248
315 nmdc:mga03683_11321_c1 3300050489 Bacteria 3226
316 nmdc:mga03683_275214_c1 3300050489 Bacteria 786
317 nmdc:mga03683_375756_c1 3300050489 Bacteria 676
318 nmdc:mga03683_5033_c1 3300050489 Bacteria 4430
319 nmdc:mga00v17_625530_c1 3300050491 Bacteria 693
320 nmdc:mga0yw44_202668_c1 3300050492 Bacteria 1311
321 nmdc:mga0yw44_481416_c1 3300050492 Bacteria 842
322 nmdc:mga0yw44_91025_c1 3300050492 Bacteria 1928
323 nmdc:mga0k408_77410_c1 3300050493 Bacteria 1945
324 nmdc:mga06z11_290845_c1 3300050494 Bacteria 969
325 nmdc:mga06z11_8596_c1 3300050494 Bacteria 4268
326 nmdc:mga04h51_70816_c1 3300050495 Bacteria 1217
327 nmdc:mga07m45_326540_c1 3300050496 Bacteria 892
328 nmdc:mga07m45_33878_c1 3300050496 Bacteria 2837
329 nmdc:mga07m45_676190_c1 3300050496 Bacteria 594
330 nmdc:mga07m45_78297_c1 3300050496 Bacteria 1886
331 nmdc:mga0qj67_720_c1 3300050509 Bacteria 22534
332 nmdc:mga06r32_4338_c1 3300050510 Bacteria 12703
333 nmdc:mga08y16_1975_c1 3300050511 Bacteria 20910
334 nmdc:mga0n895_38035_c1 3300050512 Bacteria 4660
335 nmdc:mga0rr50_296605_c1 3300050513 Bacteria 1352
336 nmdc:mga08x19_210786_c1 3300050514 Bacteria 1333
337 nmdc:mga0a205_53004_c1 3300050515 Bacteria 3915
338 nmdc:mga0sz30_211408_c1 3300050516 Bacteria 862
339 nmdc:mga0sz30_567_c1 3300050516 Bacteria 13853
340 Ga0495619_0774566 3300053085 Bacteria 650
341 Ga0500644_0173446 3300053088 Bacteria 878
342 Ga0500646_0327196 3300053090 Bacteria 555
343 Ga0500651_0086312 3300053093 Bacteria 1939
344 Ga0500566_0509363 3300053094 Bacteria 517
345 Ga0500641_0000273 3300053096 Bacteria 19298
346 Ga0500652_282754 3300053131 Bacteria 647
347 Ga0500658_0159653 3300053134 Bacteria 1020
348 Ga0500616_0018966 3300053153 Bacteria 3884
349 Ga0500620_060967 3300053155 Bacteria 1284
350 Ga0501084_0178958 3300054114 Bacteria 1790
351 Ga0501084_0325388 3300054114 Bacteria 1298

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050496 nmdc:mga07m45_676190_c1 nmdc:mga07m45_676190_c1_111_527 127
2 3300049573 Ga0501037_1047608 Ga0501037_1047608_31_474 132
3 3300049582 Ga0501048_0063379 Ga0501048_0063379_372_815 132
4 3300049584 Ga0501068_0422102 Ga0501068_0422102_338_781 132
5 3300049587 Ga0501071_0415051 Ga0501071_0415051_294_737 132
6 3300049590 Ga0501074_0275919 Ga0501074_0275919_266_709 132
7 3300049741 Ga0501079_0131301 Ga0501079_0131301_1090_1533 132
8 3300049743 Ga0501081_0033176 Ga0501081_0033176_1227_1670 132
9 3300054114 Ga0501084_0325388 Ga0501084_0325388_473_916 132
10 3300042437 Ga0439444_0011949 Ga0439444_0011949_392_796 133
11 3300049573 Ga0501037_0418867 Ga0501037_0418867_12_416 133
12 3300049575 Ga0501039_0395297 Ga0501039_0395297_606_1007 133
13 3300007265 Ga0099794_10157712 Ga0099794_101577122 135
14 3300009553 Ga0105249_12071466 Ga0105249_120714662 137
15 3300035114 Ga0373939_0236253 Ga0373939_0236253_58_474 137
16 3300042876 Ga0451577_0082178 Ga0451577_0082178_1922_2341 137
17 3300044673 Ga0453683_0009761 Ga0453683_0009761_5029_5448 137
18 3300044712 Ga0453684_0257533 Ga0453684_0257533_942_1361 137
19 3300046684 Ga0495669_0020102 Ga0495669_0020102_729_1145 137
20 3300053094 Ga0500566_0509363 Ga0500566_0509363_26_451 137
21 3300005437 Ga0070710_10759802 Ga0070710_107598022 138
22 3300006048 Ga0075363_100568429 Ga0075363_1005684292 138
23 3300006178 Ga0075367_10013803 Ga0075367_100138037 138
24 3300006186 Ga0075369_10002040 Ga0075369_100020408 138
25 3300006353 Ga0075370_10145366 Ga0075370_101453662 138
26 3300050489 nmdc:mga03683_5033_c1 nmdc:mga03683_5033_c1_2405_2851 138
27 3300050494 nmdc:mga06z11_8596_c1 nmdc:mga06z11_8596_c1_1340_1786 138
28 3300050496 nmdc:mga07m45_33878_c1 nmdc:mga07m45_33878_c1_1612_2058 138
29 3300050516 nmdc:mga0sz30_567_c1 nmdc:mga0sz30_567_c1_8975_9421 138
30 3300041509 Ga0451843_1460392 Ga0451843_1460392_145_567 140
31 3300049579 Ga0501043_0403489 Ga0501043_0403489_445_867 140
32 3300049581 Ga0501047_0452992 Ga0501047_0452992_472_894 140
33 3300049742 Ga0501080_0504614 Ga0501080_0504614_314_736 140
34 3300031995 Ga0307409_100491161 Ga0307409_1004911612 142
35 3300032002 Ga0307416_100992930 Ga0307416_1009929302 142
36 3300032126 Ga0307415_100215958 Ga0307415_1002159582 142
37 3300041496 Ga0451839_0738751 Ga0451839_0738751_270_704 142
38 3300013875 Ga0157515_130084 Ga0157515_1300842 143
39 3300005328 Ga0070676_10989300 Ga0070676_109893001 144
40 3300005330 Ga0070690_100034416 Ga0070690_1000344162 144
41 3300005338 Ga0068868_100804989 Ga0068868_1008049892 144
42 3300005340 Ga0070689_100402816 Ga0070689_1004028162 144
43 3300005340 Ga0070689_100796573 Ga0070689_1007965731 144
44 3300005445 Ga0070708_100164854 Ga0070708_1001648543 144
45 3300005445 Ga0070708_100284432 Ga0070708_1002844322 144
46 3300005456 Ga0070678_100043397 Ga0070678_1000433972 144
47 3300005466 Ga0070685_10941612 Ga0070685_109416122 144
48 3300005467 Ga0070706_100021182 Ga0070706_1000211821 144
49 3300005468 Ga0070707_100367824 Ga0070707_1003678242 144
50 3300005471 Ga0070698_100001984 Ga0070698_10000198421 144
51 3300005518 Ga0070699_100062335 Ga0070699_1000623354 144
52 3300005518 Ga0070699_100929663 Ga0070699_1009296632 144
53 3300005518 Ga0070699_101175257 Ga0070699_1011752572 144
54 3300005543 Ga0070672_100274539 Ga0070672_1002745392 144
55 3300005543 Ga0070672_100532347 Ga0070672_1005323472 144
56 3300005543 Ga0070672_101019340 Ga0070672_1010193401 144
57 3300005548 Ga0070665_100007700 Ga0070665_1000077006 144
58 3300005548 Ga0070665_100010905 Ga0070665_1000109059 144
59 3300005563 Ga0068855_101399985 Ga0068855_1013999852 144
60 3300005564 Ga0070664_100856939 Ga0070664_1008569392 144
61 3300005577 Ga0068857_100009260 Ga0068857_1000092604 144
62 3300005618 Ga0068864_100613480 Ga0068864_1006134802 144
63 3300005718 Ga0068866_10664500 Ga0068866_106645002 144
64 3300005937 Ga0081455_10001289 Ga0081455_1000128930 144
65 3300006038 Ga0075365_10254444 Ga0075365_102544442 144
66 3300006038 Ga0075365_10451930 Ga0075365_104519302 144
67 3300006038 Ga0075365_10556265 Ga0075365_105562652 144
68 3300006038 Ga0075365_10873126 Ga0075365_108731261 144
69 3300006051 Ga0075364_10602653 Ga0075364_106026532 144
70 3300006177 Ga0075362_10011833 Ga0075362_100118335 144
71 3300006177 Ga0075362_10134091 Ga0075362_101340912 144
72 3300006177 Ga0075362_10153104 Ga0075362_101531042 144
73 3300006178 Ga0075367_10395804 Ga0075367_103958042 144
74 3300006186 Ga0075369_10095563 Ga0075369_100955632 144
75 3300006353 Ga0075370_10336841 Ga0075370_103368412 144
76 3300006358 Ga0068871_100432410 Ga0068871_1004324102 144
77 3300006914 Ga0075436_100160843 Ga0075436_1001608432 144
78 3300007265 Ga0099794_10217062 Ga0099794_102170621 144
79 3300009093 Ga0105240_11170010 Ga0105240_111700101 144
80 3300009094 Ga0111539_10892142 Ga0111539_108921422 144
81 3300009094 Ga0111539_11729824 Ga0111539_117298242 144
82 3300009098 Ga0105245_10258932 Ga0105245_102589322 144
83 3300009101 Ga0105247_10878616 Ga0105247_108786161 144
84 3300009177 Ga0105248_10860099 Ga0105248_108600992 144
85 3300009177 Ga0105248_11041900 Ga0105248_110419002 144
86 3300009177 Ga0105248_11595871 Ga0105248_115958712 144
87 3300009551 Ga0105238_12444184 Ga0105238_124441842 144
88 3300009551 Ga0105238_12828941 Ga0105238_128289411 144
89 3300009553 Ga0105249_10507717 Ga0105249_105077172 144
90 3300009553 Ga0105249_12561755 Ga0105249_125617551 144
91 3300010159 Ga0099796_10113965 Ga0099796_101139652 144
92 3300013296 Ga0157374_10534561 Ga0157374_105345612 144
93 3300013306 Ga0163162_11254227 Ga0163162_112542272 144
94 3300021441 Ga0213871_10001086 Ga0213871_100010862 144
95 3300025315 Ga0207697_10194147 Ga0207697_101941472 144
96 3300025901 Ga0207688_10131162 Ga0207688_101311622 144
97 3300025903 Ga0207680_10705466 Ga0207680_107054662 144
98 3300025907 Ga0207645_10398025 Ga0207645_103980252 144
99 3300025910 Ga0207684_10310724 Ga0207684_103107242 144
100 3300025924 Ga0207694_11057135 Ga0207694_110571352 144
101 3300025936 Ga0207670_10292038 Ga0207670_102920382 144
102 3300025936 Ga0207670_10894559 Ga0207670_108945592 144
103 3300025937 Ga0207669_10142103 Ga0207669_101421032 144
104 3300025938 Ga0207704_11029882 Ga0207704_110298822 144
105 3300025940 Ga0207691_10410521 Ga0207691_104105212 144
106 3300025940 Ga0207691_10546723 Ga0207691_105467232 144
107 3300025960 Ga0207651_10303630 Ga0207651_103036302 144
108 3300025960 Ga0207651_10411830 Ga0207651_104118302 144
109 3300025961 Ga0207712_10809384 Ga0207712_108093842 144
110 3300025972 Ga0207668_10372396 Ga0207668_103723962 144
111 3300026035 Ga0207703_10893500 Ga0207703_108935001 144
112 3300026035 Ga0207703_11807690 Ga0207703_118076902 144
113 3300026088 Ga0207641_10711875 Ga0207641_107118752 144
114 3300026116 Ga0207674_10014929 Ga0207674_100149294 144
115 3300026121 Ga0207683_10047609 Ga0207683_100476092 144
116 3300028379 Ga0268266_10181903 Ga0268266_101819031 144
117 3300031238 Ga0265332_10067846 Ga0265332_100678462 144
118 3300031344 Ga0265316_10326425 Ga0265316_103264252 144
119 3300031548 Ga0307408_101591979 Ga0307408_1015919792 144
120 3300035086 Ga0373934_0056385 Ga0373934_0056385_962_1396 144
121 3300035114 Ga0373939_0475998 Ga0373939_0475998_13_447 144
122 3300035118 Ga0373954_0120540 Ga0373954_0120540_411_845 144
123 3300035171 Ga0373946_0499524 Ga0373946_0499524_144_578 144
124 3300035695 Ga0373927_0112821 Ga0373927_0112821_1127_1561 144
125 3300035724 Ga0373933_0139654 Ga0373933_0139654_918_1352 144
126 3300036401 Ga0373937_0413330 Ga0373937_0413330_637_1071 144
127 3300037068 Ga0373925_0215942 Ga0373925_0215942_175_609 144
128 3300037312 Ga0395899_0408721 Ga0395899_0408721_167_610 144
129 3300037418 Ga0395900_1422640 Ga0395900_1422640_50_493 144
130 3300038443 Ga0395901_0030605 Ga0395901_0030605_1440_1883 144
131 3300039437 Ga0436365_1159260 Ga0436365_1159260_307_744 144
132 3300039438 Ga0436360_1052254 Ga0436360_1052254_948_1382 144
133 3300039447 Ga0436361_0787177 Ga0436361_0787177_1990_2424 144
134 3300039450 Ga0436363_0349805 Ga0436363_0349805_89_523 144
135 3300044694 Ga0466963_0032443 Ga0466963_0032443_2502_2936 144
136 3300049570 Ga0501033_0238735 Ga0501033_0238735_59_493 144
137 3300049571 Ga0501034_0003169 Ga0501034_0003169_9188_9622 144
138 3300049571 Ga0501034_0011580 Ga0501034_0011580_7041_7475 144
139 3300049571 Ga0501034_0188285 Ga0501034_0188285_1202_1636 144
140 3300049571 Ga0501034_0596145 Ga0501034_0596145_562_996 144
141 3300049574 Ga0501038_1040321 Ga0501038_1040321_46_480 144
142 3300049580 Ga0501046_0095210 Ga0501046_0095210_831_1265 144
143 3300049584 Ga0501068_0015808 Ga0501068_0015808_3514_3948 144
144 3300049588 Ga0501072_0220857 Ga0501072_0220857_961_1395 144
145 3300049823 Ga0501044_0015018 Ga0501044_0015018_2747_3181 144
146 3300049823 Ga0501044_1150947 Ga0501044_1150947_54_488 144
147 3300050489 nmdc:mga03683_11321_c1 nmdc:mga03683_11321_c1_2478_2912 144
148 3300050489 nmdc:mga03683_275214_c1 nmdc:mga03683_275214_c1_23_457 144
149 3300050489 nmdc:mga03683_375756_c1 nmdc:mga03683_375756_c1_49_483 144
150 3300050491 nmdc:mga00v17_625530_c1 nmdc:mga00v17_625530_c1_190_624 144
151 3300050492 nmdc:mga0yw44_481416_c1 nmdc:mga0yw44_481416_c1_151_585 144
152 3300050492 nmdc:mga0yw44_91025_c1 nmdc:mga0yw44_91025_c1_1465_1899 144
153 3300050496 nmdc:mga07m45_326540_c1 nmdc:mga07m45_326540_c1_413_847 144
154 3300050514 nmdc:mga08x19_210786_c1 nmdc:mga08x19_210786_c1_758_1201 144
155 3300050516 nmdc:mga0sz30_211408_c1 nmdc:mga0sz30_211408_c1_132_578 144
156 3300053131 Ga0500652_282754 Ga0500652_282754_47_481 144
157 3300053134 Ga0500658_0159653 Ga0500658_0159653_411_845 144
158 3300053153 Ga0500616_0018966 Ga0500616_0018966_1246_1680 144
159 3300005844 Ga0068862_100221839 Ga0068862_1002218392 145
160 3300005937 Ga0081455_10003938 Ga0081455_100039386 145
161 3300005937 Ga0081455_10039261 Ga0081455_100392612 145
162 3300005937 Ga0081455_10777546 Ga0081455_107775461 145
163 3300006178 Ga0075367_10290471 Ga0075367_102904712 145
164 3300009553 Ga0105249_10032591 Ga0105249_100325915 145
165 3300025949 Ga0207667_10629465 Ga0207667_106294652 145
166 3300025961 Ga0207712_10324979 Ga0207712_103249791 145
167 3300026116 Ga0207674_10269247 Ga0207674_102692472 145
168 3300035113 Ga0373936_0387924 Ga0373936_0387924_20_457 145
169 3300046459 Ga0495629_0297921 Ga0495629_0297921_22_462 145
170 3300047315 Ga0495581_0608377 Ga0495581_0608377_62_502 145
171 3300050494 nmdc:mga06z11_290845_c1 nmdc:mga06z11_290845_c1_376_813 145
172 3300053085 Ga0495619_0774566 Ga0495619_0774566_127_567 145
173 3300053088 Ga0500644_0173446 Ga0500644_0173446_36_476 145
174 3300053093 Ga0500651_0086312 Ga0500651_0086312_1396_1833 145
175 3300009098 Ga0105245_11307990 Ga0105245_113079902 146
176 3300005445 Ga0070708_100017201 Ga0070708_1000172015 147
177 3300005467 Ga0070706_100031496 Ga0070706_1000314963 147
178 3300005468 Ga0070707_100012260 Ga0070707_1000122605 147
179 3300005471 Ga0070698_100003330 Ga0070698_10000333018 147
180 3300005518 Ga0070699_100023184 Ga0070699_1000231843 147
181 3300005536 Ga0070697_100033060 Ga0070697_1000330602 147
182 3300006844 Ga0075428_101302182 Ga0075428_1013021821 147
183 3300025910 Ga0207684_10002667 Ga0207684_100026674 147
184 3300025922 Ga0207646_10000905 Ga0207646_100009054 147
185 3300028380 Ga0268265_10828328 Ga0268265_108283282 147
186 3300046472 Ga0495580_0187117 Ga0495580_0187117_27_476 147
187 3300049572 Ga0501036_0174517 Ga0501036_0174517_343_789 147
188 3300049575 Ga0501039_0780010 Ga0501039_0780010_208_654 147
189 3300049576 Ga0501040_0049792 Ga0501040_0049792_910_1356 147
190 3300049578 Ga0501042_0328932 Ga0501042_0328932_415_861 147
191 3300049591 Ga0501075_0083661 Ga0501075_0083661_641_1087 147
192 3300049593 Ga0501077_0027791 Ga0501077_0027791_210_656 147
193 3300049741 Ga0501079_0554930 Ga0501079_0554930_376_822 147
194 3300049824 Ga0501045_0061359 Ga0501045_0061359_73_519 147
195 3300054114 Ga0501084_0178958 Ga0501084_0178958_50_496 147
196 3300003911 JGI25405J52794_10059056 JGI25405J52794_100590562 148
197 3300005293 Ga0065715_10165715 Ga0065715_101657152 148
198 3300005328 Ga0070676_10028193 Ga0070676_100281933 148
199 3300005330 Ga0070690_100220746 Ga0070690_1002207462 148
200 3300005330 Ga0070690_100811826 Ga0070690_1008118262 148
201 3300005331 Ga0070670_100009779 Ga0070670_1000097794 148
202 3300005334 Ga0068869_100046454 Ga0068869_1000464542 148
203 3300005336 Ga0070680_100000809 Ga0070680_10000080918 148
204 3300005337 Ga0070682_100000343 Ga0070682_1000003434 148
205 3300005338 Ga0068868_100061985 Ga0068868_1000619854 148
206 3300005339 Ga0070660_100000092 Ga0070660_10000009240 148
207 3300005343 Ga0070687_100180111 Ga0070687_1001801112 148
208 3300005344 Ga0070661_100001263 Ga0070661_1000012634 148
209 3300005347 Ga0070668_100279470 Ga0070668_1002794702 148
210 3300005353 Ga0070669_100113766 Ga0070669_1001137662 148
211 3300005355 Ga0070671_100396639 Ga0070671_1003966392 148
212 3300005364 Ga0070673_100030976 Ga0070673_1000309763 148
213 3300005366 Ga0070659_100002620 Ga0070659_1000026202 148
214 3300005367 Ga0070667_101388537 Ga0070667_1013885371 148
215 3300005406 Ga0070703_10002360 Ga0070703_100023607 148
216 3300005440 Ga0070705_100000097 Ga0070705_10000009721 148
217 3300005444 Ga0070694_100001563 Ga0070694_1000015637 148
218 3300005457 Ga0070662_100004633 Ga0070662_1000046334 148
219 3300005459 Ga0068867_100000688 Ga0068867_10000068812 148
220 3300005467 Ga0070706_101104758 Ga0070706_1011047581 148
221 3300005468 Ga0070707_100103697 Ga0070707_1001036972 148
222 3300005471 Ga0070698_100287771 Ga0070698_1002877712 148
223 3300005518 Ga0070699_100210315 Ga0070699_1002103152 148
224 3300005530 Ga0070679_100008626 Ga0070679_1000086262 148
225 3300005535 Ga0070684_100032545 Ga0070684_1000325452 148
226 3300005536 Ga0070697_100176255 Ga0070697_1001762552 148
227 3300005536 Ga0070697_100384704 Ga0070697_1003847042 148
228 3300005536 Ga0070697_101367527 Ga0070697_1013675271 148
229 3300005539 Ga0068853_100001921 Ga0068853_10000192114 148
230 3300005545 Ga0070695_100046499 Ga0070695_1000464992 148
231 3300005546 Ga0070696_100069341 Ga0070696_1000693412 148
232 3300005547 Ga0070693_100011674 Ga0070693_1000116745 148
233 3300005549 Ga0070704_100000208 Ga0070704_1000002082 148
234 3300005549 Ga0070704_100238172 Ga0070704_1002381722 148
235 3300005563 Ga0068855_100001162 Ga0068855_10000116228 148
236 3300005563 Ga0068855_101429129 Ga0068855_1014291292 148
237 3300005577 Ga0068857_100026061 Ga0068857_1000260612 148
238 3300005578 Ga0068854_100001418 Ga0068854_1000014181 148
239 3300005614 Ga0068856_100001410 Ga0068856_1000014102 148
240 3300005618 Ga0068864_100020734 Ga0068864_1000207344 148
241 3300005840 Ga0068870_10000045 Ga0068870_1000004532 148
242 3300005841 Ga0068863_100020310 Ga0068863_1000203102 148
243 3300005842 Ga0068858_100062388 Ga0068858_1000623882 148
244 3300005843 Ga0068860_100042183 Ga0068860_1000421832 148
245 3300005937 Ga0081455_10001486 Ga0081455_1000148629 148
246 3300005981 Ga0081538_10071210 Ga0081538_100712102 148
247 3300005985 Ga0081539_10014281 Ga0081539_100142813 148
248 3300006038 Ga0075365_10095308 Ga0075365_100953082 148
249 3300006042 Ga0075368_10212362 Ga0075368_102123621 148
250 3300006048 Ga0075363_100067882 Ga0075363_1000678824 148
251 3300006048 Ga0075363_100157185 Ga0075363_1001571852 148
252 3300006177 Ga0075362_10247858 Ga0075362_102478582 148
253 3300006178 Ga0075367_10019275 Ga0075367_100192755 148
254 3300006237 Ga0097621_100571068 Ga0097621_1005710682 148
255 3300006844 Ga0075428_100024710 Ga0075428_1000247104 148
256 3300006844 Ga0075428_100367988 Ga0075428_1003679882 148
257 3300006846 Ga0075430_100001163 Ga0075430_10000116311 148
258 3300006846 Ga0075430_101253535 Ga0075430_1012535351 148
259 3300006847 Ga0075431_100004149 Ga0075431_10000414913 148
260 3300006871 Ga0075434_100117690 Ga0075434_1001176902 148
261 3300006880 Ga0075429_100616507 Ga0075429_1006165072 148
262 3300006881 Ga0068865_100533756 Ga0068865_1005337562 148
263 3300006881 Ga0068865_101089724 Ga0068865_1010897242 148
264 3300007076 Ga0075435_100085430 Ga0075435_1000854302 148
265 3300007076 Ga0075435_100152992 Ga0075435_1001529922 148
266 3300009093 Ga0105240_11312118 Ga0105240_113121182 148
267 3300009094 Ga0111539_10001599 Ga0111539_1000159911 148
268 3300009147 Ga0114129_10006586 Ga0114129_100065866 148
269 3300009148 Ga0105243_10094623 Ga0105243_100946233 148
270 3300009174 Ga0105241_10003277 Ga0105241_100032772 148
271 3300009545 Ga0105237_10305257 Ga0105237_103052572 148
272 3300009551 Ga0105238_11484989 Ga0105238_114849892 148
273 3300010375 Ga0105239_10368277 Ga0105239_103682772 148
274 3300011119 Ga0105246_10227446 Ga0105246_102274462 148
275 3300013100 Ga0157373_10000370 Ga0157373_1000037020 148
276 3300013105 Ga0157369_10027879 Ga0157369_100278798 148
277 3300014325 Ga0163163_10144825 Ga0163163_101448252 148
278 3300014497 Ga0182008_10069601 Ga0182008_100696012 148
279 3300020081 Ga0206354_10361920 Ga0206354_103619202 148
280 3300025315 Ga0207697_10082813 Ga0207697_100828132 148
281 3300025885 Ga0207653_10007293 Ga0207653_100072932 148
282 3300025901 Ga0207688_10076957 Ga0207688_100769572 148
283 3300025907 Ga0207645_10000264 Ga0207645_1000026442 148
284 3300025908 Ga0207643_10000077 Ga0207643_1000007732 148
285 3300025910 Ga0207684_10006341 Ga0207684_100063419 148
286 3300025911 Ga0207654_10006156 Ga0207654_100061565 148
287 3300025912 Ga0207707_10000234 Ga0207707_1000023445 148
288 3300025914 Ga0207671_10209882 Ga0207671_102098822 148
289 3300025917 Ga0207660_10000890 Ga0207660_1000089012 148
290 3300025918 Ga0207662_10036728 Ga0207662_100367282 148
291 3300025919 Ga0207657_10000419 Ga0207657_1000041911 148
292 3300025920 Ga0207649_10024279 Ga0207649_100242794 148
293 3300025921 Ga0207652_10000306 Ga0207652_1000030621 148
294 3300025922 Ga0207646_10036211 Ga0207646_100362112 148
295 3300025923 Ga0207681_10007590 Ga0207681_100075905 148
296 3300025925 Ga0207650_10049884 Ga0207650_100498842 148
297 3300025931 Ga0207644_10753106 Ga0207644_107531061 148
298 3300025932 Ga0207690_10019619 Ga0207690_100196195 148
299 3300025933 Ga0207706_10011147 Ga0207706_100111476 148
300 3300025935 Ga0207709_10097241 Ga0207709_100972412 148
301 3300025938 Ga0207704_10472651 Ga0207704_104726512 148
302 3300025942 Ga0207689_10000138 Ga0207689_1000013842 148
303 3300025945 Ga0207679_10006218 Ga0207679_100062182 148
304 3300025949 Ga0207667_10000287 Ga0207667_1000028763 148
305 3300025960 Ga0207651_10026375 Ga0207651_100263752 148
306 3300025981 Ga0207640_10060659 Ga0207640_100606592 148
307 3300025986 Ga0207658_11237712 Ga0207658_112377122 148
308 3300026023 Ga0207677_10420184 Ga0207677_104201842 148
309 3300026035 Ga0207703_10175012 Ga0207703_101750122 148
310 3300026041 Ga0207639_10113786 Ga0207639_101137862 148
311 3300026067 Ga0207678_10002675 Ga0207678_1000267512 148
312 3300026078 Ga0207702_10031800 Ga0207702_100318005 148
313 3300026088 Ga0207641_10158689 Ga0207641_101586892 148
314 3300026089 Ga0207648_10001989 Ga0207648_1000198912 148
315 3300026116 Ga0207674_10000315 Ga0207674_1000031540 148
316 3300026118 Ga0207675_100015103 Ga0207675_1000151031 148
317 3300027907 Ga0207428_10082130 Ga0207428_100821302 148
318 3300031731 Ga0307405_10299151 Ga0307405_102991512 148
319 3300031852 Ga0307410_10378245 Ga0307410_103782452 148
320 3300031911 Ga0307412_10974720 Ga0307412_109747202 148
321 3300032126 Ga0307415_100224045 Ga0307415_1002240452 148
322 3300034817 Ga0373948_0050443 Ga0373948_0050443_288_737 148
323 3300034820 Ga0373959_0076006 Ga0373959_0076006_99_548 148
324 3300035088 Ga0373940_0009299 Ga0373940_0009299_702_1151 148
325 3300035092 Ga0373952_0058054 Ga0373952_0058054_313_762 148
326 3300035114 Ga0373939_0078390 Ga0373939_0078390_137_586 148
327 3300035241 Ga0373961_0176072 Ga0373961_0176072_92_544 148
328 3300042005 Ga0439448_0002151 Ga0439448_0002151_27_476 148
329 3300042157 Ga0439458_0003842 Ga0439458_0003842_1464_1913 148
330 3300042438 Ga0439459_0001033 Ga0439459_0001033_1947_2396 148
331 3300042461 Ga0439460_0027409 Ga0439460_0027409_99_548 148
332 3300042876 Ga0451577_0016612 Ga0451577_0016612_477_926 148
333 3300044712 Ga0453684_0033681 Ga0453684_0033681_967_1416 148
334 3300045051 Ga0451576_0174876 Ga0451576_0174876_843_1292 148
335 3300048905 Ga0496102_0070421 Ga0496102_0070421_921_1370 148
336 3300048906 Ga0496103_0186006 Ga0496103_0186006_701_1150 148
337 3300049583 Ga0501067_0033966 Ga0501067_0033966_1927_2376 148
338 3300050489 nmdc:mga03683_11102_c1 nmdc:mga03683_11102_c1_1972_2418 148
339 3300050492 nmdc:mga0yw44_202668_c1 nmdc:mga0yw44_202668_c1_816_1262 148
340 3300050493 nmdc:mga0k408_77410_c1 nmdc:mga0k408_77410_c1_1099_1545 148
341 3300050495 nmdc:mga04h51_70816_c1 nmdc:mga04h51_70816_c1_65_511 148
342 3300050496 nmdc:mga07m45_78297_c1 nmdc:mga07m45_78297_c1_910_1356 148
343 3300050509 nmdc:mga0qj67_720_c1 nmdc:mga0qj67_720_c1_8850_9296 148
344 3300050510 nmdc:mga06r32_4338_c1 nmdc:mga06r32_4338_c1_4858_5304 148
345 3300050511 nmdc:mga08y16_1975_c1 nmdc:mga08y16_1975_c1_15845_16294 148
346 3300050512 nmdc:mga0n895_38035_c1 nmdc:mga0n895_38035_c1_2218_2667 148
347 3300050513 nmdc:mga0rr50_296605_c1 nmdc:mga0rr50_296605_c1_131_580 148
348 3300050515 nmdc:mga0a205_53004_c1 nmdc:mga0a205_53004_c1_2497_2949 148
349 3300053090 Ga0500646_0327196 Ga0500646_0327196_85_531 148
350 3300053096 Ga0500641_0000273 Ga0500641_0000273_16493_16939 148
351 3300053155 Ga0500620_060967 Ga0500620_060967_234_680 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01796

OB_aCoA_assoc

DUF35 OB-fold domain, acyl-CoA-associated

66

133

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ofb-assembly1.cif.gz_A crystal structure of t. maritima reverse gyrase with a minimal latch, hexagonal form 0.8914 37 64
6htj-assembly1.cif.gz_B crystal structure of the translation recovery factor trf from sulfolobus solfataricus 0.8891 18 148
6htj-assembly1.cif.gz_B crystal structure of the translation recovery factor trf from sulfolobus solfataricus 0.8752 18 148
4ddx-assembly2.cif.gz_B thermotoga maritima reverse gyrase, primitive monoclinic form 0.8593 37 62
6ok1-assembly1.cif.gz_D ltp2-chsh2(duf35) aldolase 0.8592 14 147
ID Description Score Start End Superfamily
2ayjA00 Few Secondary Structures;Irregular;ZNF265 like; 0.7919 37 64 4.10.1060.50
3irbB01 Special;Helix non-globular;Lyase 2-enoyl-coa Hydratase; Chain; 0.782 22 67 6.10.30.10
6g5hc00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7705 69 125 2.40.50.140
af_A8DYY3_2_62_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7365 67 127 2.40.50.140
af_A0A1D6MEG7_37_119_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6745 70 115 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A328XIJ5-F1-model_v4 deleted 0.9772 5 148
AF-A0A2A2VAX7-F1-model_v4 DNA-binding protein 0.9757 6 148 GO:0003677
AF-A0A849N338-F1-model_v4 DNA-binding protein 0.9756 8 148 GO:0003677
AF-A0A6N9CPB7-F1-model_v4 deleted 0.9736 6 148
AF-A0A6I2WMU1-F1-model_v4 DNA-binding protein 0.9716 6 148 GO:0003677

Feature Viewer

pLDDT pTM Quality
90.8 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map