F418637
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 351 | 118 | 351 | 282 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10011433|Ga0157372_100114333 |
| Length | 328 |
| Sequence | VTAIVRFGHLQTWPPDAVLAARVSRFGAASRFPRKENDMNRFQFKSRIFAQTPLARLWLAIAVCAFTSFAAANASAQLADNQTEGFGNNRLVTFTYLQNFDCVDQPLMDLDFNNKLAQSDPNEMQTPICQPVTEPTQDPAGANIKHTAHLYVFVPMFSVDNDQNPNDAMACPNGGRPGELCGPALGAALIKLFGFVPEAWKTHPAVSTQCPDPNNPVPGTCTMHASSVDLSVTLNALGKTGPPTMPVFVPTPNHDHVVDNSRVNTTPIWWEVRPVLIMDQSDWPAADGSSGITSSKAMDDAESAGRAIEVGSNFFLFFSSQMSSHGSH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 41 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 42 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 43 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 59 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 62 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 66 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 72 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 101 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 102 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 103 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 104 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 105 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 106 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 107 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 108 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 109 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 110 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 111 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 113 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 114 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 115 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 116 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 117 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 118 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.92 |
| Metatranscriptomes | 21.08 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.85 |
| Rhizosphere | 98.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10281574 | 3300003323 | Unclassified | 2181 |
| 2 | Ga0058863_11265434 | 3300004799 | Bacteria | 1955 |
| 3 | Ga0058863_11800759 | 3300004799 | Bacteria | 1054 |
| 4 | Ga0058863_11801824 | 3300004799 | Unclassified | 1147 |
| 5 | Ga0058863_11852757 | 3300004799 | Bacteria | 1474 |
| 6 | Ga0058863_11923438 | 3300004799 | Bacteria | 2492 |
| 7 | Ga0058861_10132900 | 3300004800 | Unclassified | 1971 |
| 8 | Ga0058861_10567780 | 3300004800 | Unclassified | 1360 |
| 9 | Ga0058861_11388766 | 3300004800 | Unclassified | 1151 |
| 10 | Ga0058861_11567773 | 3300004800 | Bacteria | 1374 |
| 11 | Ga0058861_11741686 | 3300004800 | Bacteria | 1679 |
| 12 | Ga0058861_11801768 | 3300004800 | Bacteria | 973 |
| 13 | Ga0058862_10027005 | 3300004803 | Bacteria | 1033 |
| 14 | Ga0058862_10035513 | 3300004803 | Unclassified | 3048 |
| 15 | Ga0058862_10037053 | 3300004803 | Bacteria | 2804 |
| 16 | Ga0058862_10040528 | 3300004803 | Unclassified | 2830 |
| 17 | Ga0058862_10238468 | 3300004803 | Unclassified | 1944 |
| 18 | Ga0058862_12275231 | 3300004803 | Bacteria | 1901 |
| 19 | Ga0058862_12291975 | 3300004803 | Unclassified | 1074 |
| 20 | Ga0058862_12529459 | 3300004803 | Unclassified | 963 |
| 21 | Ga0058862_12795798 | 3300004803 | Bacteria | 2739 |
| 22 | Ga0058862_12805099 | 3300004803 | Unclassified | 1321 |
| 23 | Ga0070658_10076838 | 3300005327 | Bacteria | 2739 |
| 24 | Ga0070658_10137624 | 3300005327 | Bacteria | 2038 |
| 25 | Ga0070683_100123448 | 3300005329 | Bacteria | 2447 |
| 26 | Ga0070680_100083535 | 3300005336 | Bacteria | 2637 |
| 27 | Ga0070680_100116464 | 3300005336 | Bacteria | 2228 |
| 28 | Ga0070680_100203814 | 3300005336 | Unclassified | 1668 |
| 29 | Ga0070680_100278980 | 3300005336 | Bacteria | 1416 |
| 30 | Ga0070680_100344403 | 3300005336 | Bacteria | 1267 |
| 31 | Ga0070660_100008645 | 3300005339 | Bacteria | 7131 |
| 32 | Ga0070660_100028190 | 3300005339 | Bacteria | 4199 |
| 33 | Ga0070660_100140580 | 3300005339 | Unclassified | 1937 |
| 34 | Ga0070660_100258647 | 3300005339 | Bacteria | 1421 |
| 35 | Ga0070691_10017299 | 3300005341 | Bacteria | 3317 |
| 36 | Ga0070661_100043778 | 3300005344 | Bacteria | 3270 |
| 37 | Ga0070659_100134061 | 3300005366 | Bacteria | 2014 |
| 38 | Ga0070709_10104866 | 3300005434 | Bacteria | 1890 |
| 39 | Ga0070714_100004455 | 3300005435 | Bacteria | 10549 |
| 40 | Ga0070714_100016121 | 3300005435 | Bacteria | 6026 |
| 41 | Ga0070714_100024671 | 3300005435 | Bacteria | 4955 |
| 42 | Ga0070714_100028970 | 3300005435 | Bacteria | 4599 |
| 43 | Ga0070714_100034222 | 3300005435 | Bacteria | 4254 |
| 44 | Ga0070714_100042548 | 3300005435 | Unclassified | 3838 |
| 45 | Ga0070714_100069792 | 3300005435 | Bacteria | 3036 |
| 46 | Ga0070713_100003340 | 3300005436 | Bacteria | 10588 |
| 47 | Ga0070713_100098320 | 3300005436 | Bacteria | 2531 |
| 48 | Ga0070713_100176009 | 3300005436 | Bacteria | 1920 |
| 49 | Ga0070713_100250822 | 3300005436 | Unclassified | 1614 |
| 50 | Ga0070711_100032463 | 3300005439 | Bacteria | 3471 |
| 51 | Ga0070711_100098912 | 3300005439 | Unclassified | 2119 |
| 52 | Ga0070708_100043552 | 3300005445 | Bacteria | 3944 |
| 53 | Ga0070708_100057906 | 3300005445 | Bacteria | 3452 |
| 54 | Ga0070681_10000034 | 3300005458 | Bacteria | 98600 |
| 55 | Ga0070681_10012953 | 3300005458 | Bacteria | 8281 |
| 56 | Ga0070681_10121939 | 3300005458 | Bacteria | 2541 |
| 57 | Ga0070681_10133113 | 3300005458 | Unclassified | 2418 |
| 58 | Ga0070681_10198161 | 3300005458 | Unclassified | 1926 |
| 59 | Ga0070681_10241691 | 3300005458 | Bacteria | 1719 |
| 60 | Ga0070706_100010419 | 3300005467 | Bacteria | 8631 |
| 61 | Ga0070706_100023125 | 3300005467 | Bacteria | 5723 |
| 62 | Ga0070706_100063911 | 3300005467 | Unclassified | 3401 |
| 63 | Ga0070706_100093158 | 3300005467 | Bacteria | 2795 |
| 64 | Ga0070706_100165779 | 3300005467 | Bacteria | 2063 |
| 65 | Ga0070706_100266751 | 3300005467 | Unclassified | 1598 |
| 66 | Ga0070707_100010060 | 3300005468 | Bacteria | 8806 |
| 67 | Ga0070707_100073813 | 3300005468 | Bacteria | 3289 |
| 68 | Ga0070707_100373272 | 3300005468 | Bacteria | 1386 |
| 69 | Ga0070707_100385498 | 3300005468 | Unclassified | 1361 |
| 70 | Ga0070698_100030332 | 3300005471 | Bacteria | 5607 |
| 71 | Ga0070698_100202220 | 3300005471 | Bacteria | 1922 |
| 72 | Ga0070699_100024967 | 3300005518 | Bacteria | 5152 |
| 73 | Ga0070699_100051933 | 3300005518 | Bacteria | 3549 |
| 74 | Ga0070699_100081869 | 3300005518 | Bacteria | 2814 |
| 75 | Ga0070679_100011342 | 3300005530 | Bacteria | 8493 |
| 76 | Ga0070679_100062417 | 3300005530 | Bacteria | 3715 |
| 77 | Ga0070679_100151331 | 3300005530 | Bacteria | 2297 |
| 78 | Ga0070684_100189321 | 3300005535 | Bacteria | 1872 |
| 79 | Ga0070684_100523547 | 3300005535 | Bacteria | 1099 |
| 80 | Ga0070697_100010361 | 3300005536 | Bacteria | 7271 |
| 81 | Ga0068853_100005955 | 3300005539 | Bacteria | 9633 |
| 82 | Ga0068853_100008385 | 3300005539 | Bacteria | 8301 |
| 83 | Ga0068853_100161448 | 3300005539 | Bacteria | 2023 |
| 84 | Ga0068853_100312156 | 3300005539 | Unclassified | 1456 |
| 85 | Ga0070696_100000163 | 3300005546 | Bacteria | 37742 |
| 86 | Ga0070693_100061080 | 3300005547 | Unclassified | 2190 |
| 87 | Ga0070665_100001969 | 3300005548 | Bacteria | 23093 |
| 88 | Ga0068855_100000345 | 3300005563 | Bacteria | 57734 |
| 89 | Ga0068855_100020157 | 3300005563 | Bacteria | 8007 |
| 90 | Ga0068855_100052338 | 3300005563 | Bacteria | 4808 |
| 91 | Ga0068855_100085422 | 3300005563 | Bacteria | 3651 |
| 92 | Ga0068855_100249231 | 3300005563 | Bacteria | 1981 |
| 93 | Ga0068855_100349079 | 3300005563 | Bacteria | 1630 |
| 94 | Ga0068855_100400935 | 3300005563 | Unclassified | 1503 |
| 95 | Ga0068855_100407302 | 3300005563 | Bacteria | 1489 |
| 96 | Ga0068855_100811977 | 3300005563 | Unclassified | 993 |
| 97 | Ga0070664_100037754 | 3300005564 | Bacteria | 4062 |
| 98 | Ga0070664_100121661 | 3300005564 | Unclassified | 2286 |
| 99 | Ga0068857_100003493 | 3300005577 | Bacteria | 13119 |
| 100 | Ga0068857_100011482 | 3300005577 | Bacteria | 7704 |
| 101 | Ga0068857_100063309 | 3300005577 | Bacteria | 3288 |
| 102 | Ga0068857_100680769 | 3300005577 | Bacteria | 976 |
| 103 | Ga0068854_100079621 | 3300005578 | Bacteria | 2416 |
| 104 | Ga0068854_100094846 | 3300005578 | Bacteria | 2226 |
| 105 | Ga0068856_100000578 | 3300005614 | Bacteria | 40018 |
| 106 | Ga0068856_100005898 | 3300005614 | Bacteria | 12068 |
| 107 | Ga0068856_100014125 | 3300005614 | Bacteria | 7722 |
| 108 | Ga0068856_100055227 | 3300005614 | Bacteria | 3919 |
| 109 | Ga0068856_100113332 | 3300005614 | Unclassified | 2710 |
| 110 | Ga0068856_100191751 | 3300005614 | Bacteria | 2057 |
| 111 | Ga0068856_100372095 | 3300005614 | Bacteria | 1448 |
| 112 | Ga0068856_100532315 | 3300005614 | Bacteria | 1196 |
| 113 | Ga0068856_100798077 | 3300005614 | Unclassified | 964 |
| 114 | Ga0068852_100049137 | 3300005616 | Bacteria | 3607 |
| 115 | Ga0068852_100187771 | 3300005616 | Unclassified | 1948 |
| 116 | Ga0068851_10038071 | 3300005834 | Bacteria | 2412 |
| 117 | Ga0068851_10100537 | 3300005834 | Bacteria | 1534 |
| 118 | Ga0068858_100015697 | 3300005842 | Bacteria | 7125 |
| 119 | Ga0070717_10000295 | 3300006028 | Bacteria | 33556 |
| 120 | Ga0070717_10043822 | 3300006028 | Bacteria | 3653 |
| 121 | Ga0070717_10063057 | 3300006028 | Bacteria | 3075 |
| 122 | Ga0070717_10097070 | 3300006028 | Bacteria | 2496 |
| 123 | Ga0097621_100000014 | 3300006237 | Bacteria | 100839 |
| 124 | Ga0068871_100000552 | 3300006358 | Bacteria | 25519 |
| 125 | Ga0075433_10001254 | 3300006852 | Bacteria | 18518 |
| 126 | Ga0075434_100000921 | 3300006871 | Bacteria | 23590 |
| 127 | Ga0075436_100245440 | 3300006914 | Bacteria | 1274 |
| 128 | Ga0075435_100002754 | 3300007076 | Bacteria | 11737 |
| 129 | Ga0105240_10001575 | 3300009093 | Bacteria | 38691 |
| 130 | Ga0105240_10004465 | 3300009093 | Bacteria | 21309 |
| 131 | Ga0105240_10006372 | 3300009093 | Bacteria | 17376 |
| 132 | Ga0105240_10015178 | 3300009093 | Bacteria | 10485 |
| 133 | Ga0105240_10037822 | 3300009093 | Bacteria | 6197 |
| 134 | Ga0105240_10076582 | 3300009093 | Bacteria | 4123 |
| 135 | Ga0105240_10101582 | 3300009093 | Bacteria | 3497 |
| 136 | Ga0105240_10186006 | 3300009093 | Unclassified | 2447 |
| 137 | Ga0105240_10242038 | 3300009093 | Bacteria | 2091 |
| 138 | Ga0114129_10003272 | 3300009147 | Bacteria | 22737 |
| 139 | Ga0105241_10027210 | 3300009174 | Bacteria | 4257 |
| 140 | Ga0105237_10003456 | 3300009545 | Bacteria | 18756 |
| 141 | Ga0105237_10107505 | 3300009545 | Bacteria | 2781 |
| 142 | Ga0105237_10206173 | 3300009545 | Unclassified | 1966 |
| 143 | Ga0105237_10225534 | 3300009545 | Bacteria | 1874 |
| 144 | Ga0105238_10000099 | 3300009551 | Bacteria | 97818 |
| 145 | Ga0105238_10003508 | 3300009551 | Bacteria | 15620 |
| 146 | Ga0105238_10059339 | 3300009551 | Bacteria | 3833 |
| 147 | Ga0105238_10079727 | 3300009551 | Bacteria | 3264 |
| 148 | Ga0105238_10304881 | 3300009551 | Bacteria | 1577 |
| 149 | Ga0105238_10305519 | 3300009551 | Bacteria | 1575 |
| 150 | Ga0105238_10324556 | 3300009551 | Unclassified | 1526 |
| 151 | Ga0105239_10047418 | 3300010375 | Unclassified | 4708 |
| 152 | Ga0105239_10108376 | 3300010375 | Bacteria | 3078 |
| 153 | Ga0154012_176890 | 3300013059 | Bacteria | 2029 |
| 154 | Ga0157371_10023693 | 3300013102 | Bacteria | 4488 |
| 155 | Ga0157371_10067328 | 3300013102 | Bacteria | 2535 |
| 156 | Ga0157371_10134869 | 3300013102 | Bacteria | 1758 |
| 157 | Ga0157370_10014397 | 3300013104 | Bacteria | 8086 |
| 158 | Ga0157370_10031626 | 3300013104 | Bacteria | 5175 |
| 159 | Ga0157370_10041466 | 3300013104 | Bacteria | 4440 |
| 160 | Ga0157370_10131732 | 3300013104 | Unclassified | 2332 |
| 161 | Ga0157369_10000042 | 3300013105 | Bacteria | 181784 |
| 162 | Ga0157369_10007294 | 3300013105 | Bacteria | 12725 |
| 163 | Ga0157369_10012472 | 3300013105 | Bacteria | 9644 |
| 164 | Ga0157369_10014662 | 3300013105 | Bacteria | 8843 |
| 165 | Ga0157369_10024906 | 3300013105 | Bacteria | 6649 |
| 166 | Ga0157369_10083592 | 3300013105 | Bacteria | 3414 |
| 167 | Ga0157369_10251356 | 3300013105 | Bacteria | 1845 |
| 168 | Ga0157369_10312309 | 3300013105 | Bacteria | 1634 |
| 169 | Ga0157374_10002804 | 3300013296 | Bacteria | 14633 |
| 170 | Ga0157374_10028106 | 3300013296 | Bacteria | 5080 |
| 171 | Ga0157378_10003318 | 3300013297 | Bacteria | 14315 |
| 172 | Ga0157372_10000452 | 3300013307 | Bacteria | 45098 |
| 173 | Ga0157372_10002149 | 3300013307 | Bacteria | 21435 |
| 174 | Ga0157372_10003818 | 3300013307 | Bacteria | 16188 |
| 175 | Ga0157372_10011433 | 3300013307 | Bacteria | 9438 |
| 176 | Ga0157372_10012299 | 3300013307 | Bacteria | 9120 |
| 177 | Ga0157372_10042801 | 3300013307 | Bacteria | 5011 |
| 178 | Ga0157372_10081973 | 3300013307 | Bacteria | 3652 |
| 179 | Ga0157372_10110848 | 3300013307 | Unclassified | 3143 |
| 180 | Ga0157372_10120658 | 3300013307 | Unclassified | 3011 |
| 181 | Ga0157372_10141596 | 3300013307 | Bacteria | 2771 |
| 182 | Ga0157372_10333726 | 3300013307 | Bacteria | 1766 |
| 183 | Ga0157372_10403959 | 3300013307 | Unclassified | 1592 |
| 184 | Ga0157372_10480042 | 3300013307 | Unclassified | 1449 |
| 185 | Ga0163163_10484243 | 3300014325 | Bacteria | 1298 |
| 186 | Ga0182008_10015099 | 3300014497 | Unclassified | 4037 |
| 187 | Ga0182008_10061515 | 3300014497 | Bacteria | 1851 |
| 188 | Ga0157376_10022500 | 3300014969 | Unclassified | 4917 |
| 189 | Ga0182006_1039456 | 3300015261 | Unclassified | 1863 |
| 190 | Ga0182007_10052352 | 3300015262 | Unclassified | 1345 |
| 191 | Ga0197907_10352007 | 3300020069 | Unclassified | 2873 |
| 192 | Ga0197907_10605526 | 3300020069 | Archaea | 1308 |
| 193 | Ga0197907_10880853 | 3300020069 | Bacteria | 3494 |
| 194 | Ga0197907_10931017 | 3300020069 | Bacteria | 1334 |
| 195 | Ga0197907_10992046 | 3300020069 | Bacteria | 2665 |
| 196 | Ga0197907_11270220 | 3300020069 | Bacteria | 1935 |
| 197 | Ga0206356_10068678 | 3300020070 | Unclassified | 1006 |
| 198 | Ga0206356_10169795 | 3300020070 | Unclassified | 1578 |
| 199 | Ga0206356_10460491 | 3300020070 | Bacteria | 1130 |
| 200 | Ga0206356_10492650 | 3300020070 | Bacteria | 1161 |
| 201 | Ga0206356_10644080 | 3300020070 | Bacteria | 1138 |
| 202 | Ga0206356_10691941 | 3300020070 | Unclassified | 1368 |
| 203 | Ga0206356_10783463 | 3300020070 | Unclassified | 1514 |
| 204 | Ga0206356_10993072 | 3300020070 | Bacteria | 1918 |
| 205 | Ga0206356_11224990 | 3300020070 | Bacteria | 1449 |
| 206 | Ga0206356_11230954 | 3300020070 | Bacteria | 1353 |
| 207 | Ga0206356_11895060 | 3300020070 | Unclassified | 2522 |
| 208 | Ga0206349_1038407 | 3300020075 | Unclassified | 1247 |
| 209 | Ga0206349_1040746 | 3300020075 | Bacteria | 2935 |
| 210 | Ga0206349_1849033 | 3300020075 | Bacteria | 1209 |
| 211 | Ga0206355_1491969 | 3300020076 | Bacteria | 1266 |
| 212 | Ga0206351_10028168 | 3300020077 | Bacteria | 1147 |
| 213 | Ga0206351_10114049 | 3300020077 | Bacteria | 2375 |
| 214 | Ga0206352_10214493 | 3300020078 | Bacteria | 4774 |
| 215 | Ga0206352_10471738 | 3300020078 | Unclassified | 1878 |
| 216 | Ga0206352_10679449 | 3300020078 | Bacteria | 1441 |
| 217 | Ga0206352_10744286 | 3300020078 | Bacteria | 1974 |
| 218 | Ga0206352_10914886 | 3300020078 | Bacteria | 945 |
| 219 | Ga0206352_10988006 | 3300020078 | Bacteria | 1473 |
| 220 | Ga0206352_11146833 | 3300020078 | Unclassified | 1523 |
| 221 | Ga0206350_10145040 | 3300020080 | Bacteria | 2118 |
| 222 | Ga0206350_10351149 | 3300020080 | Bacteria | 2646 |
| 223 | Ga0206350_10384443 | 3300020080 | Bacteria | 1205 |
| 224 | Ga0206350_10566642 | 3300020080 | Bacteria | 1507 |
| 225 | Ga0206350_10731429 | 3300020080 | Bacteria | 996 |
| 226 | Ga0206354_10294005 | 3300020081 | Bacteria | 2367 |
| 227 | Ga0206354_10426872 | 3300020081 | Bacteria | 1359 |
| 228 | Ga0206354_10934306 | 3300020081 | Unclassified | 1357 |
| 229 | Ga0206354_11598845 | 3300020081 | Bacteria | 1181 |
| 230 | Ga0206354_11601141 | 3300020081 | Unclassified | 899 |
| 231 | Ga0206353_10502870 | 3300020082 | Unclassified | 1190 |
| 232 | Ga0206353_11234468 | 3300020082 | Bacteria | 1116 |
| 233 | Ga0206353_11467059 | 3300020082 | Unclassified | 1228 |
| 234 | Ga0206353_11646503 | 3300020082 | Unclassified | 1064 |
| 235 | Ga0154015_1311633 | 3300020610 | Bacteria | 2707 |
| 236 | Ga0224712_10013805 | 3300022467 | Unclassified | 2584 |
| 237 | Ga0224712_10069208 | 3300022467 | Bacteria | 1428 |
| 238 | Ga0224712_10072786 | 3300022467 | Bacteria | 1400 |
| 239 | Ga0224712_10091886 | 3300022467 | Bacteria | 1273 |
| 240 | Ga0224712_10162729 | 3300022467 | Bacteria | 996 |
| 241 | Ga0224712_10164374 | 3300022467 | Unclassified | 992 |
| 242 | Ga0207656_10156255 | 3300025321 | Unclassified | 1083 |
| 243 | Ga0207699_10180844 | 3300025906 | Unclassified | 1417 |
| 244 | Ga0207699_10335578 | 3300025906 | Unclassified | 1064 |
| 245 | Ga0207705_10046176 | 3300025909 | Bacteria | 3129 |
| 246 | Ga0207684_10000773 | 3300025910 | Bacteria | 37123 |
| 247 | Ga0207684_10005652 | 3300025910 | Bacteria | 11487 |
| 248 | Ga0207684_10076266 | 3300025910 | Bacteria | 2849 |
| 249 | Ga0207684_10128472 | 3300025910 | Bacteria | 2175 |
| 250 | Ga0207684_10141952 | 3300025910 | Bacteria | 2065 |
| 251 | Ga0207684_10259645 | 3300025910 | Unclassified | 1499 |
| 252 | Ga0207654_10002214 | 3300025911 | Bacteria | 9974 |
| 253 | Ga0207654_10152557 | 3300025911 | Unclassified | 1484 |
| 254 | Ga0207707_10000155 | 3300025912 | Bacteria | 71477 |
| 255 | Ga0207707_10052734 | 3300025912 | Bacteria | 3540 |
| 256 | Ga0207707_10132938 | 3300025912 | Unclassified | 2176 |
| 257 | Ga0207707_10138325 | 3300025912 | Bacteria | 2129 |
| 258 | Ga0207707_10239577 | 3300025912 | Unclassified | 1577 |
| 259 | Ga0207695_10000832 | 3300025913 | Bacteria | 57182 |
| 260 | Ga0207695_10000958 | 3300025913 | Bacteria | 51395 |
| 261 | Ga0207695_10007335 | 3300025913 | Bacteria | 14078 |
| 262 | Ga0207695_10019475 | 3300025913 | Bacteria | 7815 |
| 263 | Ga0207695_10129172 | 3300025913 | Bacteria | 2486 |
| 264 | Ga0207695_10138125 | 3300025913 | Bacteria | 2389 |
| 265 | Ga0207695_10159057 | 3300025913 | Bacteria | 2192 |
| 266 | Ga0207671_10029690 | 3300025914 | Unclassified | 4081 |
| 267 | Ga0207671_10142401 | 3300025914 | Bacteria | 1848 |
| 268 | Ga0207663_10096071 | 3300025916 | Unclassified | 1978 |
| 269 | Ga0207663_10148665 | 3300025916 | Bacteria | 1641 |
| 270 | Ga0207660_10141741 | 3300025917 | Bacteria | 1838 |
| 271 | Ga0207657_10011237 | 3300025919 | Bacteria | 8897 |
| 272 | Ga0207657_10020112 | 3300025919 | Bacteria | 6317 |
| 273 | Ga0207657_10062743 | 3300025919 | Bacteria | 3180 |
| 274 | Ga0207649_10051175 | 3300025920 | Bacteria | 2557 |
| 275 | Ga0207652_10081439 | 3300025921 | Bacteria | 2832 |
| 276 | Ga0207646_10004106 | 3300025922 | Bacteria | 16042 |
| 277 | Ga0207646_10016355 | 3300025922 | Bacteria | 6962 |
| 278 | Ga0207646_10281123 | 3300025922 | Bacteria | 1504 |
| 279 | Ga0207694_10002276 | 3300025924 | Bacteria | 15709 |
| 280 | Ga0207694_10008786 | 3300025924 | Bacteria | 7621 |
| 281 | Ga0207694_10105505 | 3300025924 | Bacteria | 2237 |
| 282 | Ga0207694_10119776 | 3300025924 | Unclassified | 2100 |
| 283 | Ga0207694_10326616 | 3300025924 | Bacteria | 1267 |
| 284 | Ga0207700_10120098 | 3300025928 | Unclassified | 2130 |
| 285 | Ga0207700_10141806 | 3300025928 | Unclassified | 1975 |
| 286 | Ga0207700_10146068 | 3300025928 | Bacteria | 1949 |
| 287 | Ga0207700_10244368 | 3300025928 | Unclassified | 1531 |
| 288 | Ga0207664_10010770 | 3300025929 | Bacteria | 6467 |
| 289 | Ga0207664_10025990 | 3300025929 | Bacteria | 4419 |
| 290 | Ga0207664_10040308 | 3300025929 | Bacteria | 3631 |
| 291 | Ga0207664_10042975 | 3300025929 | Bacteria | 3532 |
| 292 | Ga0207664_10050013 | 3300025929 | Bacteria | 3294 |
| 293 | Ga0207664_10106353 | 3300025929 | Unclassified | 2326 |
| 294 | Ga0207664_10137967 | 3300025929 | Bacteria | 2060 |
| 295 | Ga0207690_10181161 | 3300025932 | Bacteria | 1586 |
| 296 | Ga0207661_10116319 | 3300025944 | Bacteria | 2270 |
| 297 | Ga0207661_10154297 | 3300025944 | Bacteria | 1987 |
| 298 | Ga0207661_10184264 | 3300025944 | Unclassified | 1826 |
| 299 | Ga0207661_10305351 | 3300025944 | Unclassified | 1427 |
| 300 | Ga0207667_10002055 | 3300025949 | Bacteria | 25228 |
| 301 | Ga0207667_10030061 | 3300025949 | Bacteria | 5881 |
| 302 | Ga0207667_10047575 | 3300025949 | Bacteria | 4540 |
| 303 | Ga0207667_10072390 | 3300025949 | Unclassified | 3583 |
| 304 | Ga0207667_10089779 | 3300025949 | Bacteria | 3175 |
| 305 | Ga0207667_10135194 | 3300025949 | Bacteria | 2539 |
| 306 | Ga0207667_10255754 | 3300025949 | Unclassified | 1791 |
| 307 | Ga0207667_10283572 | 3300025949 | Bacteria | 1692 |
| 308 | Ga0207640_10129412 | 3300025981 | Unclassified | 1822 |
| 309 | Ga0207640_10203933 | 3300025981 | Unclassified | 1501 |
| 310 | Ga0207703_10037704 | 3300026035 | Unclassified | 3852 |
| 311 | Ga0207639_10005446 | 3300026041 | Bacteria | 8597 |
| 312 | Ga0207639_10012051 | 3300026041 | Bacteria | 6015 |
| 313 | Ga0207639_10078213 | 3300026041 | Bacteria | 2610 |
| 314 | Ga0207639_10235362 | 3300026041 | Unclassified | 1590 |
| 315 | Ga0207639_10421699 | 3300026041 | Bacteria | 1206 |
| 316 | Ga0207639_10583736 | 3300026041 | Unclassified | 1029 |
| 317 | Ga0207702_10000303 | 3300026078 | Bacteria | 56839 |
| 318 | Ga0207702_10051936 | 3300026078 | Unclassified | 3467 |
| 319 | Ga0207702_10057759 | 3300026078 | Bacteria | 3300 |
| 320 | Ga0207702_10060700 | 3300026078 | Bacteria | 3223 |
| 321 | Ga0207702_10159291 | 3300026078 | Unclassified | 2060 |
| 322 | Ga0207702_10441309 | 3300026078 | Unclassified | 1261 |
| 323 | Ga0207674_10003019 | 3300026116 | Bacteria | 20864 |
| 324 | Ga0207674_10107284 | 3300026116 | Bacteria | 2770 |
| 325 | Ga0207674_10116921 | 3300026116 | Bacteria | 2637 |
| 326 | Ga0207698_10027286 | 3300026142 | Bacteria | 4052 |
| 327 | Ga0207698_10127823 | 3300026142 | Bacteria | 2165 |
| 328 | Ga0268266_10027617 | 3300028379 | Bacteria | 4824 |
| 329 | Ga0373936_0095356 | 3300035113 | Unclassified | 1251 |
| 330 | Ga0373954_0012776 | 3300035118 | Bacteria | 3739 |
| 331 | Ga0373927_0025657 | 3300035695 | Unclassified | 3853 |
| 332 | Ga0373933_0040201 | 3300035724 | Bacteria | 2754 |
| 333 | Ga0373925_0007858 | 3300037068 | Bacteria | 7768 |
| 334 | Ga0373925_0014252 | 3300037068 | Bacteria | 5751 |
| 335 | Ga0395900_0186208 | 3300037418 | Unclassified | 2107 |
| 336 | Ga0395900_0562663 | 3300037418 | Unclassified | 1084 |
| 337 | Ga0395898_0037374 | 3300037466 | Unclassified | 4817 |
| 338 | Ga0395898_0113230 | 3300037466 | Unclassified | 2600 |
| 339 | Ga0395901_0352307 | 3300038443 | Unclassified | 1519 |
| 340 | Ga0466963_0145894 | 3300044694 | Bacteria | 1642 |
| 341 | Ga0466959_0176522 | 3300045049 | Bacteria | 1496 |
| 342 | Ga0466967_0631223 | 3300045976 | Bacteria | 1059 |
| 343 | Ga0495674_0032333 | 3300047319 | Bacteria | 4745 |
| 344 | Ga0496109_0467401 | 3300048912 | Unclassified | 1191 |
| 345 | Ga0496109_0726601 | 3300048912 | Bacteria | 931 |
| 346 | Ga0496112_0010582 | 3300048915 | Bacteria | 8378 |
| 347 | nmdc:mga05p37_3942_c1 | 3300050507 | Bacteria | 17384 |
| 348 | nmdc:mga0n895_43801_c1 | 3300050512 | Bacteria | 4363 |
| 349 | nmdc:mga0rr50_2415_c1 | 3300050513 | Bacteria | 10516 |
| 350 | nmdc:mga08x19_228865_c1 | 3300050514 | Bacteria | 1279 |
| 351 | Ga0587071_009869 | 3300060344 | Unclassified | 1581 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026078 | Ga0207702_10057759 | Ga0207702_100577593 | 238 |
| 2 | 3300005435 | Ga0070714_100024671 | Ga0070714_1000246714 | 251 |
| 3 | 3300005436 | Ga0070713_100098320 | Ga0070713_1000983201 | 251 |
| 4 | 3300013307 | Ga0157372_10002149 | Ga0157372_100021497 | 251 |
| 5 | 3300025913 | Ga0207695_10159057 | Ga0207695_101590572 | 251 |
| 6 | 3300025929 | Ga0207664_10050013 | Ga0207664_100500133 | 251 |
| 7 | 3300025913 | Ga0207695_10129172 | Ga0207695_101291721 | 252 |
| 8 | 3300026041 | Ga0207639_10421699 | Ga0207639_104216991 | 252 |
| 9 | 3300037466 | Ga0395898_0113230 | Ga0395898_0113230_1699_2484 | 252 |
| 10 | 3300005336 | Ga0070680_100083535 | Ga0070680_1000835352 | 253 |
| 11 | 3300005436 | Ga0070713_100176009 | Ga0070713_1001760092 | 253 |
| 12 | 3300005467 | Ga0070706_100010419 | Ga0070706_1000104197 | 253 |
| 13 | 3300005468 | Ga0070707_100385498 | Ga0070707_1003854981 | 253 |
| 14 | 3300025910 | Ga0207684_10076266 | Ga0207684_100762661 | 253 |
| 15 | 3300025919 | Ga0207657_10020112 | Ga0207657_100201125 | 253 |
| 16 | 3300025981 | Ga0207640_10203933 | Ga0207640_102039332 | 253 |
| 17 | 3300005614 | Ga0068856_100014125 | Ga0068856_1000141255 | 254 |
| 18 | 3300009093 | Ga0105240_10037822 | Ga0105240_100378222 | 254 |
| 19 | 3300013307 | Ga0157372_10110848 | Ga0157372_101108483 | 254 |
| 20 | 3300005445 | Ga0070708_100057906 | Ga0070708_1000579062 | 255 |
| 21 | 3300005467 | Ga0070706_100023125 | Ga0070706_1000231256 | 255 |
| 22 | 3300005468 | Ga0070707_100010060 | Ga0070707_1000100604 | 255 |
| 23 | 3300005471 | Ga0070698_100030332 | Ga0070698_1000303326 | 255 |
| 24 | 3300005518 | Ga0070699_100024967 | Ga0070699_1000249672 | 255 |
| 25 | 3300005536 | Ga0070697_100010361 | Ga0070697_1000103617 | 255 |
| 26 | 3300005614 | Ga0068856_100191751 | Ga0068856_1001917511 | 255 |
| 27 | 3300006028 | Ga0070717_10097070 | Ga0070717_100970702 | 255 |
| 28 | 3300025910 | Ga0207684_10005652 | Ga0207684_100056529 | 255 |
| 29 | 3300025911 | Ga0207654_10002214 | Ga0207654_1000221410 | 255 |
| 30 | 3300025922 | Ga0207646_10016355 | Ga0207646_100163553 | 255 |
| 31 | 3300025924 | Ga0207694_10008786 | Ga0207694_100087868 | 255 |
| 32 | 3300025949 | Ga0207667_10135194 | Ga0207667_101351943 | 255 |
| 33 | 3300026078 | Ga0207702_10060700 | Ga0207702_100607001 | 255 |
| 34 | 3300004800 | Ga0058861_10567780 | Ga0058861_105677801 | 258 |
| 35 | 3300005341 | Ga0070691_10017299 | Ga0070691_100172993 | 258 |
| 36 | 3300005435 | Ga0070714_100069792 | Ga0070714_1000697922 | 258 |
| 37 | 3300005436 | Ga0070713_100250822 | Ga0070713_1002508222 | 258 |
| 38 | 3300005458 | Ga0070681_10000034 | Ga0070681_1000003475 | 258 |
| 39 | 3300005539 | Ga0068853_100005955 | Ga0068853_1000059553 | 258 |
| 40 | 3300005563 | Ga0068855_100000345 | Ga0068855_10000034512 | 258 |
| 41 | 3300005564 | Ga0070664_100121661 | Ga0070664_1001216612 | 258 |
| 42 | 3300005577 | Ga0068857_100003493 | Ga0068857_1000034935 | 258 |
| 43 | 3300005614 | Ga0068856_100000578 | Ga0068856_10000057822 | 258 |
| 44 | 3300005842 | Ga0068858_100015697 | Ga0068858_1000156974 | 258 |
| 45 | 3300006237 | Ga0097621_100000014 | Ga0097621_10000001461 | 258 |
| 46 | 3300006358 | Ga0068871_100000552 | Ga0068871_1000005529 | 258 |
| 47 | 3300009093 | Ga0105240_10001575 | Ga0105240_1000157536 | 258 |
| 48 | 3300009174 | Ga0105241_10027210 | Ga0105241_100272101 | 258 |
| 49 | 3300009551 | Ga0105238_10000099 | Ga0105238_1000009957 | 258 |
| 50 | 3300010375 | Ga0105239_10047418 | Ga0105239_100474185 | 258 |
| 51 | 3300013105 | Ga0157369_10000042 | Ga0157369_1000004225 | 258 |
| 52 | 3300013296 | Ga0157374_10002804 | Ga0157374_100028044 | 258 |
| 53 | 3300013297 | Ga0157378_10003318 | Ga0157378_100033185 | 258 |
| 54 | 3300013307 | Ga0157372_10000452 | Ga0157372_1000045226 | 258 |
| 55 | 3300014969 | Ga0157376_10022500 | Ga0157376_100225002 | 258 |
| 56 | 3300020080 | Ga0206350_10351149 | Ga0206350_103511492 | 258 |
| 57 | 3300025911 | Ga0207654_10152557 | Ga0207654_101525572 | 258 |
| 58 | 3300025912 | Ga0207707_10000155 | Ga0207707_1000015512 | 258 |
| 59 | 3300025924 | Ga0207694_10002276 | Ga0207694_100022768 | 258 |
| 60 | 3300025928 | Ga0207700_10120098 | Ga0207700_101200981 | 258 |
| 61 | 3300025944 | Ga0207661_10184264 | Ga0207661_101842641 | 258 |
| 62 | 3300025949 | Ga0207667_10002055 | Ga0207667_100020551 | 258 |
| 63 | 3300026035 | Ga0207703_10037704 | Ga0207703_100377042 | 258 |
| 64 | 3300026041 | Ga0207639_10005446 | Ga0207639_100054464 | 258 |
| 65 | 3300026078 | Ga0207702_10000303 | Ga0207702_1000030325 | 258 |
| 66 | 3300048912 | Ga0496109_0467401 | Ga0496109_0467401_184_1017 | 258 |
| 67 | 3300048915 | Ga0496112_0010582 | Ga0496112_0010582_2029_2862 | 258 |
| 68 | 3300050514 | nmdc:mga08x19_228865_c1 | nmdc:mga08x19_228865_c1_278_1072 | 258 |
| 69 | 3300005327 | Ga0070658_10076838 | Ga0070658_100768382 | 259 |
| 70 | 3300005329 | Ga0070683_100123448 | Ga0070683_1001234483 | 259 |
| 71 | 3300005339 | Ga0070660_100140580 | Ga0070660_1001405802 | 259 |
| 72 | 3300005344 | Ga0070661_100043778 | Ga0070661_1000437783 | 259 |
| 73 | 3300005366 | Ga0070659_100134061 | Ga0070659_1001340612 | 259 |
| 74 | 3300005458 | Ga0070681_10121939 | Ga0070681_101219392 | 259 |
| 75 | 3300005467 | Ga0070706_100093158 | Ga0070706_1000931582 | 259 |
| 76 | 3300005518 | Ga0070699_100051933 | Ga0070699_1000519333 | 259 |
| 77 | 3300005518 | Ga0070699_100081869 | Ga0070699_1000818692 | 259 |
| 78 | 3300005530 | Ga0070679_100151331 | Ga0070679_1001513312 | 259 |
| 79 | 3300005563 | Ga0068855_100020157 | Ga0068855_1000201578 | 259 |
| 80 | 3300005564 | Ga0070664_100037754 | Ga0070664_1000377543 | 259 |
| 81 | 3300005577 | Ga0068857_100011482 | Ga0068857_1000114823 | 259 |
| 82 | 3300005578 | Ga0068854_100094846 | Ga0068854_1000948462 | 259 |
| 83 | 3300005616 | Ga0068852_100187771 | Ga0068852_1001877712 | 259 |
| 84 | 3300005834 | Ga0068851_10038071 | Ga0068851_100380712 | 259 |
| 85 | 3300009093 | Ga0105240_10015178 | Ga0105240_100151788 | 259 |
| 86 | 3300009545 | Ga0105237_10107505 | Ga0105237_101075052 | 259 |
| 87 | 3300013102 | Ga0157371_10023693 | Ga0157371_100236934 | 259 |
| 88 | 3300013104 | Ga0157370_10031626 | Ga0157370_100316265 | 259 |
| 89 | 3300013307 | Ga0157372_10120658 | Ga0157372_101206584 | 259 |
| 90 | 3300013307 | Ga0157372_10480042 | Ga0157372_104800421 | 259 |
| 91 | 3300014497 | Ga0182008_10061515 | Ga0182008_100615152 | 259 |
| 92 | 3300020070 | Ga0206356_10691941 | Ga0206356_106919412 | 259 |
| 93 | 3300025910 | Ga0207684_10128472 | Ga0207684_101284722 | 259 |
| 94 | 3300025919 | Ga0207657_10062743 | Ga0207657_100627432 | 259 |
| 95 | 3300025928 | Ga0207700_10244368 | Ga0207700_102443681 | 259 |
| 96 | 3300025932 | Ga0207690_10181161 | Ga0207690_101811612 | 259 |
| 97 | 3300025944 | Ga0207661_10116319 | Ga0207661_101163191 | 259 |
| 98 | 3300025981 | Ga0207640_10129412 | Ga0207640_101294122 | 259 |
| 99 | 3300026116 | Ga0207674_10003019 | Ga0207674_100030192 | 259 |
| 100 | 3300026142 | Ga0207698_10127823 | Ga0207698_101278232 | 259 |
| 101 | 3300005436 | Ga0070713_100003340 | Ga0070713_1000033404 | 260 |
| 102 | 3300006028 | Ga0070717_10000295 | Ga0070717_100002953 | 260 |
| 103 | 3300025929 | Ga0207664_10137967 | Ga0207664_101379672 | 260 |
| 104 | 3300035118 | Ga0373954_0012776 | Ga0373954_0012776_1957_2829 | 260 |
| 105 | 3300035695 | Ga0373927_0025657 | Ga0373927_0025657_439_1311 | 260 |
| 106 | 3300035724 | Ga0373933_0040201 | Ga0373933_0040201_1799_2671 | 260 |
| 107 | 3300037068 | Ga0373925_0007858 | Ga0373925_0007858_5599_6471 | 260 |
| 108 | 3300047319 | Ga0495674_0032333 | Ga0495674_0032333_573_1445 | 260 |
| 109 | 3300004799 | Ga0058863_11801824 | Ga0058863_118018242 | 261 |
| 110 | 3300004803 | Ga0058862_12529459 | Ga0058862_125294591 | 261 |
| 111 | 3300005458 | Ga0070681_10012953 | Ga0070681_100129537 | 261 |
| 112 | 3300020082 | Ga0206353_10502870 | Ga0206353_105028701 | 261 |
| 113 | 3300025912 | Ga0207707_10239577 | Ga0207707_102395771 | 261 |
| 114 | 3300045049 | Ga0466959_0176522 | Ga0466959_0176522_628_1434 | 261 |
| 115 | 3300045976 | Ga0466967_0631223 | Ga0466967_0631223_97_903 | 261 |
| 116 | 3300004800 | Ga0058861_11567773 | Ga0058861_115677731 | 263 |
| 117 | 3300005614 | Ga0068856_100372095 | Ga0068856_1003720952 | 263 |
| 118 | 3300020070 | Ga0206356_10783463 | Ga0206356_107834631 | 263 |
| 119 | 3300020080 | Ga0206350_10145040 | Ga0206350_101450401 | 263 |
| 120 | 3300022467 | Ga0224712_10162729 | Ga0224712_101627291 | 263 |
| 121 | 3300004800 | Ga0058861_11388766 | Ga0058861_113887662 | 264 |
| 122 | 3300004803 | Ga0058862_12805099 | Ga0058862_128050991 | 264 |
| 123 | 3300005563 | Ga0068855_100085422 | Ga0068855_1000854223 | 264 |
| 124 | 3300013105 | Ga0157369_10012472 | Ga0157369_100124727 | 264 |
| 125 | 3300020069 | Ga0197907_10931017 | Ga0197907_109310171 | 264 |
| 126 | 3300020070 | Ga0206356_10492650 | Ga0206356_104926502 | 264 |
| 127 | 3300020078 | Ga0206352_10744286 | Ga0206352_107442862 | 264 |
| 128 | 3300020082 | Ga0206353_11234468 | Ga0206353_112344681 | 264 |
| 129 | 3300022467 | Ga0224712_10069208 | Ga0224712_100692081 | 264 |
| 130 | 3300025949 | Ga0207667_10089779 | Ga0207667_100897792 | 264 |
| 131 | 3300037068 | Ga0373925_0014252 | Ga0373925_0014252_1122_1928 | 264 |
| 132 | 3300006852 | Ga0075433_10001254 | Ga0075433_100012546 | 266 |
| 133 | 3300006871 | Ga0075434_100000921 | Ga0075434_1000009219 | 266 |
| 134 | 3300007076 | Ga0075435_100002754 | Ga0075435_1000027546 | 266 |
| 135 | 3300009093 | Ga0105240_10006372 | Ga0105240_1000637211 | 266 |
| 136 | 3300009147 | Ga0114129_10003272 | Ga0114129_1000327212 | 266 |
| 137 | 3300009545 | Ga0105237_10003456 | Ga0105237_100034566 | 266 |
| 138 | 3300014325 | Ga0163163_10484243 | Ga0163163_104842432 | 266 |
| 139 | 3300020070 | Ga0206356_10644080 | Ga0206356_106440801 | 266 |
| 140 | 3300025910 | Ga0207684_10000773 | Ga0207684_1000077344 | 266 |
| 141 | 3300035113 | Ga0373936_0095356 | Ga0373936_0095356_217_1101 | 266 |
| 142 | 3300050507 | nmdc:mga05p37_3942_c1 | nmdc:mga05p37_3942_c1_3815_4693 | 266 |
| 143 | 3300050512 | nmdc:mga0n895_43801_c1 | nmdc:mga0n895_43801_c1_2002_2880 | 266 |
| 144 | 3300050513 | nmdc:mga0rr50_2415_c1 | nmdc:mga0rr50_2415_c1_3357_4235 | 266 |
| 145 | 3300004799 | Ga0058863_11800759 | Ga0058863_118007591 | 267 |
| 146 | 3300004800 | Ga0058861_11801768 | Ga0058861_118017681 | 267 |
| 147 | 3300004803 | Ga0058862_10027005 | Ga0058862_100270051 | 267 |
| 148 | 3300020070 | Ga0206356_10068678 | Ga0206356_100686781 | 267 |
| 149 | 3300025912 | Ga0207707_10052734 | Ga0207707_100527342 | 267 |
| 150 | 3300005471 | Ga0070698_100202220 | Ga0070698_1002022202 | 268 |
| 151 | 3300025906 | Ga0207699_10180844 | Ga0207699_101808442 | 268 |
| 152 | 3300004799 | Ga0058863_11265434 | Ga0058863_112654342 | 269 |
| 153 | 3300004803 | Ga0058862_10037053 | Ga0058862_100370532 | 269 |
| 154 | 3300005339 | Ga0070660_100008645 | Ga0070660_1000086454 | 269 |
| 155 | 3300005434 | Ga0070709_10104866 | Ga0070709_101048662 | 269 |
| 156 | 3300005435 | Ga0070714_100004455 | Ga0070714_1000044552 | 269 |
| 157 | 3300005439 | Ga0070711_100098912 | Ga0070711_1000989121 | 269 |
| 158 | 3300005535 | Ga0070684_100189321 | Ga0070684_1001893212 | 269 |
| 159 | 3300005614 | Ga0068856_100113332 | Ga0068856_1001133323 | 269 |
| 160 | 3300006028 | Ga0070717_10063057 | Ga0070717_100630572 | 269 |
| 161 | 3300009093 | Ga0105240_10186006 | Ga0105240_101860062 | 269 |
| 162 | 3300009551 | Ga0105238_10059339 | Ga0105238_100593396 | 269 |
| 163 | 3300013296 | Ga0157374_10028106 | Ga0157374_100281063 | 269 |
| 164 | 3300025906 | Ga0207699_10335578 | Ga0207699_103355781 | 269 |
| 165 | 3300025912 | Ga0207707_10132938 | Ga0207707_101329383 | 269 |
| 166 | 3300025916 | Ga0207663_10096071 | Ga0207663_100960712 | 269 |
| 167 | 3300025924 | Ga0207694_10119776 | Ga0207694_101197763 | 269 |
| 168 | 3300025928 | Ga0207700_10141806 | Ga0207700_101418062 | 269 |
| 169 | 3300025929 | Ga0207664_10010770 | Ga0207664_100107703 | 269 |
| 170 | 3300025944 | Ga0207661_10305351 | Ga0207661_103053512 | 269 |
| 171 | 3300026078 | Ga0207702_10159291 | Ga0207702_101592912 | 269 |
| 172 | 3300004799 | Ga0058863_11852757 | Ga0058863_118527571 | 270 |
| 173 | 3300004800 | Ga0058861_10132900 | Ga0058861_101329001 | 270 |
| 174 | 3300004800 | Ga0058861_11741686 | Ga0058861_117416861 | 270 |
| 175 | 3300004803 | Ga0058862_10238468 | Ga0058862_102384681 | 270 |
| 176 | 3300004803 | Ga0058862_12275231 | Ga0058862_122752311 | 270 |
| 177 | 3300004803 | Ga0058862_12291975 | Ga0058862_122919751 | 270 |
| 178 | 3300005327 | Ga0070658_10137624 | Ga0070658_101376242 | 270 |
| 179 | 3300005336 | Ga0070680_100203814 | Ga0070680_1002038143 | 270 |
| 180 | 3300005336 | Ga0070680_100344403 | Ga0070680_1003444032 | 270 |
| 181 | 3300005339 | Ga0070660_100258647 | Ga0070660_1002586472 | 270 |
| 182 | 3300005435 | Ga0070714_100016121 | Ga0070714_1000161213 | 270 |
| 183 | 3300005435 | Ga0070714_100028970 | Ga0070714_1000289702 | 270 |
| 184 | 3300005435 | Ga0070714_100034222 | Ga0070714_1000342221 | 270 |
| 185 | 3300005435 | Ga0070714_100042548 | Ga0070714_1000425482 | 270 |
| 186 | 3300005439 | Ga0070711_100032463 | Ga0070711_1000324633 | 270 |
| 187 | 3300005445 | Ga0070708_100043552 | Ga0070708_1000435523 | 270 |
| 188 | 3300005458 | Ga0070681_10198161 | Ga0070681_101981613 | 270 |
| 189 | 3300005458 | Ga0070681_10241691 | Ga0070681_102416911 | 270 |
| 190 | 3300005467 | Ga0070706_100063911 | Ga0070706_1000639112 | 270 |
| 191 | 3300005467 | Ga0070706_100266751 | Ga0070706_1002667512 | 270 |
| 192 | 3300005468 | Ga0070707_100073813 | Ga0070707_1000738132 | 270 |
| 193 | 3300005468 | Ga0070707_100373272 | Ga0070707_1003732721 | 270 |
| 194 | 3300005530 | Ga0070679_100062417 | Ga0070679_1000624172 | 270 |
| 195 | 3300005539 | Ga0068853_100161448 | Ga0068853_1001614482 | 270 |
| 196 | 3300005546 | Ga0070696_100000163 | Ga0070696_10000016335 | 270 |
| 197 | 3300005547 | Ga0070693_100061080 | Ga0070693_1000610801 | 270 |
| 198 | 3300005563 | Ga0068855_100349079 | Ga0068855_1003490791 | 270 |
| 199 | 3300005563 | Ga0068855_100811977 | Ga0068855_1008119771 | 270 |
| 200 | 3300005614 | Ga0068856_100532315 | Ga0068856_1005323151 | 270 |
| 201 | 3300006028 | Ga0070717_10043822 | Ga0070717_100438222 | 270 |
| 202 | 3300009093 | Ga0105240_10004465 | Ga0105240_100044657 | 270 |
| 203 | 3300009545 | Ga0105237_10206173 | Ga0105237_102061732 | 270 |
| 204 | 3300009551 | Ga0105238_10304881 | Ga0105238_103048812 | 270 |
| 205 | 3300013059 | Ga0154012_176890 | Ga0154012_1768902 | 270 |
| 206 | 3300013102 | Ga0157371_10134869 | Ga0157371_101348692 | 270 |
| 207 | 3300013105 | Ga0157369_10024906 | Ga0157369_100249066 | 270 |
| 208 | 3300013105 | Ga0157369_10251356 | Ga0157369_102513562 | 270 |
| 209 | 3300013307 | Ga0157372_10011433 | Ga0157372_100114333 | 270 |
| 210 | 3300013307 | Ga0157372_10042801 | Ga0157372_100428014 | 270 |
| 211 | 3300013307 | Ga0157372_10141596 | Ga0157372_101415962 | 270 |
| 212 | 3300013307 | Ga0157372_10403959 | Ga0157372_104039592 | 270 |
| 213 | 3300020070 | Ga0206356_10460491 | Ga0206356_104604911 | 270 |
| 214 | 3300020075 | Ga0206349_1040746 | Ga0206349_10407461 | 270 |
| 215 | 3300020077 | Ga0206351_10028168 | Ga0206351_100281682 | 270 |
| 216 | 3300020077 | Ga0206351_10114049 | Ga0206351_101140491 | 270 |
| 217 | 3300020080 | Ga0206350_10384443 | Ga0206350_103844432 | 270 |
| 218 | 3300020081 | Ga0206354_11598845 | Ga0206354_115988451 | 270 |
| 219 | 3300020082 | Ga0206353_11467059 | Ga0206353_114670592 | 270 |
| 220 | 3300022467 | Ga0224712_10091886 | Ga0224712_100918862 | 270 |
| 221 | 3300025909 | Ga0207705_10046176 | Ga0207705_100461762 | 270 |
| 222 | 3300025910 | Ga0207684_10259645 | Ga0207684_102596452 | 270 |
| 223 | 3300025912 | Ga0207707_10138325 | Ga0207707_101383252 | 270 |
| 224 | 3300025913 | Ga0207695_10007335 | Ga0207695_100073355 | 270 |
| 225 | 3300025916 | Ga0207663_10148665 | Ga0207663_101486651 | 270 |
| 226 | 3300025917 | Ga0207660_10141741 | Ga0207660_101417412 | 270 |
| 227 | 3300025920 | Ga0207649_10051175 | Ga0207649_100511752 | 270 |
| 228 | 3300025922 | Ga0207646_10004106 | Ga0207646_1000410612 | 270 |
| 229 | 3300025922 | Ga0207646_10281123 | Ga0207646_102811233 | 270 |
| 230 | 3300025928 | Ga0207700_10146068 | Ga0207700_101460681 | 270 |
| 231 | 3300025929 | Ga0207664_10025990 | Ga0207664_100259904 | 270 |
| 232 | 3300025929 | Ga0207664_10040308 | Ga0207664_100403083 | 270 |
| 233 | 3300025929 | Ga0207664_10042975 | Ga0207664_100429753 | 270 |
| 234 | 3300025929 | Ga0207664_10106353 | Ga0207664_101063532 | 270 |
| 235 | 3300026041 | Ga0207639_10078213 | Ga0207639_100782132 | 270 |
| 236 | 3300026078 | Ga0207702_10441309 | Ga0207702_104413091 | 270 |
| 237 | 3300037418 | Ga0395900_0186208 | Ga0395900_0186208_993_1820 | 270 |
| 238 | 3300037466 | Ga0395898_0037374 | Ga0395898_0037374_844_1671 | 270 |
| 239 | 3300038443 | Ga0395901_0352307 | Ga0395901_0352307_608_1435 | 270 |
| 240 | 3300044694 | Ga0466963_0145894 | Ga0466963_0145894_25_885 | 270 |
| 241 | 3300048912 | Ga0496109_0726601 | Ga0496109_0726601_73_912 | 270 |
| 242 | 3300004799 | Ga0058863_11923438 | Ga0058863_119234382 | 271 |
| 243 | 3300004803 | Ga0058862_10035513 | Ga0058862_100355132 | 271 |
| 244 | 3300004803 | Ga0058862_10040528 | Ga0058862_100405281 | 271 |
| 245 | 3300004803 | Ga0058862_12795798 | Ga0058862_127957983 | 271 |
| 246 | 3300005336 | Ga0070680_100116464 | Ga0070680_1001164642 | 271 |
| 247 | 3300005336 | Ga0070680_100278980 | Ga0070680_1002789802 | 271 |
| 248 | 3300005339 | Ga0070660_100028190 | Ga0070660_1000281902 | 271 |
| 249 | 3300005458 | Ga0070681_10133113 | Ga0070681_101331132 | 271 |
| 250 | 3300005467 | Ga0070706_100165779 | Ga0070706_1001657792 | 271 |
| 251 | 3300005530 | Ga0070679_100011342 | Ga0070679_1000113422 | 271 |
| 252 | 3300005535 | Ga0070684_100523547 | Ga0070684_1005235471 | 271 |
| 253 | 3300005539 | Ga0068853_100008385 | Ga0068853_1000083858 | 271 |
| 254 | 3300005539 | Ga0068853_100312156 | Ga0068853_1003121561 | 271 |
| 255 | 3300005563 | Ga0068855_100052338 | Ga0068855_1000523383 | 271 |
| 256 | 3300005563 | Ga0068855_100249231 | Ga0068855_1002492312 | 271 |
| 257 | 3300005563 | Ga0068855_100400935 | Ga0068855_1004009351 | 271 |
| 258 | 3300005563 | Ga0068855_100407302 | Ga0068855_1004073022 | 271 |
| 259 | 3300005577 | Ga0068857_100063309 | Ga0068857_1000633092 | 271 |
| 260 | 3300005577 | Ga0068857_100680769 | Ga0068857_1006807691 | 271 |
| 261 | 3300005578 | Ga0068854_100079621 | Ga0068854_1000796212 | 271 |
| 262 | 3300005614 | Ga0068856_100005898 | Ga0068856_10000589812 | 271 |
| 263 | 3300005614 | Ga0068856_100055227 | Ga0068856_1000552272 | 271 |
| 264 | 3300005614 | Ga0068856_100798077 | Ga0068856_1007980771 | 271 |
| 265 | 3300005616 | Ga0068852_100049137 | Ga0068852_1000491372 | 271 |
| 266 | 3300005834 | Ga0068851_10100537 | Ga0068851_101005372 | 271 |
| 267 | 3300006914 | Ga0075436_100245440 | Ga0075436_1002454401 | 271 |
| 268 | 3300009093 | Ga0105240_10076582 | Ga0105240_100765823 | 271 |
| 269 | 3300009093 | Ga0105240_10101582 | Ga0105240_101015823 | 271 |
| 270 | 3300009093 | Ga0105240_10242038 | Ga0105240_102420381 | 271 |
| 271 | 3300009545 | Ga0105237_10225534 | Ga0105237_102255342 | 271 |
| 272 | 3300009551 | Ga0105238_10003508 | Ga0105238_100035089 | 271 |
| 273 | 3300009551 | Ga0105238_10079727 | Ga0105238_100797272 | 271 |
| 274 | 3300009551 | Ga0105238_10305519 | Ga0105238_103055193 | 271 |
| 275 | 3300009551 | Ga0105238_10324556 | Ga0105238_103245562 | 271 |
| 276 | 3300010375 | Ga0105239_10108376 | Ga0105239_101083764 | 271 |
| 277 | 3300013102 | Ga0157371_10067328 | Ga0157371_100673282 | 271 |
| 278 | 3300013104 | Ga0157370_10014397 | Ga0157370_100143972 | 271 |
| 279 | 3300013104 | Ga0157370_10041466 | Ga0157370_100414662 | 271 |
| 280 | 3300013104 | Ga0157370_10131732 | Ga0157370_101317322 | 271 |
| 281 | 3300013105 | Ga0157369_10007294 | Ga0157369_100072943 | 271 |
| 282 | 3300013105 | Ga0157369_10014662 | Ga0157369_100146622 | 271 |
| 283 | 3300013105 | Ga0157369_10083592 | Ga0157369_100835922 | 271 |
| 284 | 3300013105 | Ga0157369_10312309 | Ga0157369_103123092 | 271 |
| 285 | 3300013307 | Ga0157372_10003818 | Ga0157372_100038189 | 271 |
| 286 | 3300013307 | Ga0157372_10012299 | Ga0157372_100122991 | 271 |
| 287 | 3300013307 | Ga0157372_10081973 | Ga0157372_100819733 | 271 |
| 288 | 3300013307 | Ga0157372_10333726 | Ga0157372_103337263 | 271 |
| 289 | 3300014497 | Ga0182008_10015099 | Ga0182008_100150994 | 271 |
| 290 | 3300015261 | Ga0182006_1039456 | Ga0182006_10394562 | 271 |
| 291 | 3300015262 | Ga0182007_10052352 | Ga0182007_100523522 | 271 |
| 292 | 3300020069 | Ga0197907_10352007 | Ga0197907_103520071 | 271 |
| 293 | 3300020069 | Ga0197907_10880853 | Ga0197907_108808532 | 271 |
| 294 | 3300020069 | Ga0197907_10992046 | Ga0197907_109920464 | 271 |
| 295 | 3300020069 | Ga0197907_11270220 | Ga0197907_112702202 | 271 |
| 296 | 3300020070 | Ga0206356_10169795 | Ga0206356_101697952 | 271 |
| 297 | 3300020070 | Ga0206356_10993072 | Ga0206356_109930721 | 271 |
| 298 | 3300020070 | Ga0206356_11224990 | Ga0206356_112249902 | 271 |
| 299 | 3300020070 | Ga0206356_11230954 | Ga0206356_112309541 | 271 |
| 300 | 3300020070 | Ga0206356_11895060 | Ga0206356_118950601 | 271 |
| 301 | 3300020075 | Ga0206349_1849033 | Ga0206349_18490332 | 271 |
| 302 | 3300020076 | Ga0206355_1491969 | Ga0206355_14919692 | 271 |
| 303 | 3300020078 | Ga0206352_10214493 | Ga0206352_102144932 | 271 |
| 304 | 3300020078 | Ga0206352_10471738 | Ga0206352_104717381 | 271 |
| 305 | 3300020078 | Ga0206352_10679449 | Ga0206352_106794492 | 271 |
| 306 | 3300020078 | Ga0206352_10914886 | Ga0206352_109148861 | 271 |
| 307 | 3300020078 | Ga0206352_10988006 | Ga0206352_109880061 | 271 |
| 308 | 3300020078 | Ga0206352_11146833 | Ga0206352_111468331 | 271 |
| 309 | 3300020080 | Ga0206350_10566642 | Ga0206350_105666422 | 271 |
| 310 | 3300020080 | Ga0206350_10731429 | Ga0206350_107314291 | 271 |
| 311 | 3300020081 | Ga0206354_10294005 | Ga0206354_102940052 | 271 |
| 312 | 3300020081 | Ga0206354_10426872 | Ga0206354_104268722 | 271 |
| 313 | 3300020081 | Ga0206354_10934306 | Ga0206354_109343062 | 271 |
| 314 | 3300020081 | Ga0206354_11601141 | Ga0206354_116011411 | 271 |
| 315 | 3300020082 | Ga0206353_11646503 | Ga0206353_116465031 | 271 |
| 316 | 3300020610 | Ga0154015_1311633 | Ga0154015_13116331 | 271 |
| 317 | 3300022467 | Ga0224712_10072786 | Ga0224712_100727862 | 271 |
| 318 | 3300022467 | Ga0224712_10164374 | Ga0224712_101643741 | 271 |
| 319 | 3300025321 | Ga0207656_10156255 | Ga0207656_101562551 | 271 |
| 320 | 3300025910 | Ga0207684_10141952 | Ga0207684_101419522 | 271 |
| 321 | 3300025913 | Ga0207695_10000832 | Ga0207695_1000083211 | 271 |
| 322 | 3300025913 | Ga0207695_10000958 | Ga0207695_1000095816 | 271 |
| 323 | 3300025913 | Ga0207695_10019475 | Ga0207695_100194756 | 271 |
| 324 | 3300025913 | Ga0207695_10138125 | Ga0207695_101381252 | 271 |
| 325 | 3300025914 | Ga0207671_10029690 | Ga0207671_100296904 | 271 |
| 326 | 3300025914 | Ga0207671_10142401 | Ga0207671_101424012 | 271 |
| 327 | 3300025919 | Ga0207657_10011237 | Ga0207657_100112378 | 271 |
| 328 | 3300025921 | Ga0207652_10081439 | Ga0207652_100814392 | 271 |
| 329 | 3300025924 | Ga0207694_10105505 | Ga0207694_101055052 | 271 |
| 330 | 3300025924 | Ga0207694_10326616 | Ga0207694_103266162 | 271 |
| 331 | 3300025944 | Ga0207661_10154297 | Ga0207661_101542972 | 271 |
| 332 | 3300025949 | Ga0207667_10030061 | Ga0207667_100300612 | 271 |
| 333 | 3300025949 | Ga0207667_10047575 | Ga0207667_100475753 | 271 |
| 334 | 3300025949 | Ga0207667_10072390 | Ga0207667_100723902 | 271 |
| 335 | 3300025949 | Ga0207667_10255754 | Ga0207667_102557542 | 271 |
| 336 | 3300025949 | Ga0207667_10283572 | Ga0207667_102835721 | 271 |
| 337 | 3300026041 | Ga0207639_10012051 | Ga0207639_100120517 | 271 |
| 338 | 3300026041 | Ga0207639_10235362 | Ga0207639_102353622 | 271 |
| 339 | 3300026041 | Ga0207639_10583736 | Ga0207639_105837361 | 271 |
| 340 | 3300026078 | Ga0207702_10051936 | Ga0207702_100519365 | 271 |
| 341 | 3300026116 | Ga0207674_10107284 | Ga0207674_101072844 | 271 |
| 342 | 3300026116 | Ga0207674_10116921 | Ga0207674_101169212 | 271 |
| 343 | 3300026142 | Ga0207698_10027286 | Ga0207698_100272862 | 271 |
| 344 | 3300037418 | Ga0395900_0562663 | Ga0395900_0562663_78_923 | 271 |
| 345 | 3300060344 | Ga0587071_009869 | Ga0587071_009869_391_1398 | 271 |
| 346 | 3300003323 | rootH1_10281574 | rootH1_102815742 | 272 |
| 347 | 3300005548 | Ga0070665_100001969 | Ga0070665_10000196922 | 272 |
| 348 | 3300020069 | Ga0197907_10605526 | Ga0197907_106055262 | 272 |
| 349 | 3300020075 | Ga0206349_1038407 | Ga0206349_10384071 | 272 |
| 350 | 3300022467 | Ga0224712_10013805 | Ga0224712_100138052 | 272 |
| 351 | 3300028379 | Ga0268266_10027617 | Ga0268266_100276175 | 272 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3akj-assembly1.cif.gz_A | crystal structure of a helicobacter pylori proinflammatory kinase ctka | 0.5052 | 23 | 54 |
| 6ewv-assembly1.cif.gz_A | solution structure of docking domain complex of rxp nrps: kj12c ndd - kj12b cdd | 0.4659 | 28 | 45 |
| 1eue-assembly2.cif.gz_B | rat outer mitochondrial membrane cytochrome b5 | 0.4203 | 18 | 39 |
| 6gjh-assembly1.cif.gz_A | human hsp27 (hspb1) alpha-crystallin domain in complex with a peptide mimic of its phosphorylatable n-terminal region | 0.3825 | 21 | 49 |
| 7o3h-assembly1.cif.gz_P | murine ciii2 focus-refined from supercomplex ciciii2 | 0.3781 | 2 | 53 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9LU90_53_414_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.6354 | 27 | 45 | 2.120.10.30 |
| af_A0A1D6HCR7_100_169_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.6027 | 25 | 55 | 3.30.200.20 |
| af_Q54GE1_34_326_3.20.20.80 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.5742 | 25 | 41 | 3.20.20.80 |
| af_O62280_7_321_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.5712 | 28 | 41 | 1.20.1070.10 |
| af_Q1L8U8_722_786_2.30.30.140 | Mainly Beta;Roll;SH3 type barrels.; | 0.5351 | 24 | 45 | 2.30.30.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8VVU7-F1-model_v4 | Uncharacterized protein | 0.8598 | 78 | 272 |
|
| AF-A0A2V8X4Y4-F1-model_v4 | Uncharacterized protein | 0.8595 | 78 | 272 |
|
| AF-A0A2V9BRS2-F1-model_v4 | Uncharacterized protein | 0.8139 | 20 | 272 |
|
| AF-A0A522RZR6-F1-model_v4 | Uncharacterized protein | 0.8072 | 24 | 272 |
|
| AF-A0A368KGB1-F1-model_v4 | Uncharacterized protein | 0.7997 | 24 | 272 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar