F418637

General Info

Members Datasets Scaffolds Average Seq Length
351 118 351 282

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10011433|Ga0157372_100114333
Length 328
Sequence VTAIVRFGHLQTWPPDAVLAARVSRFGAASRFPRKENDMNRFQFKSRIFAQTPLARLWLAIAVCAFTSFAAANASAQLADNQTEGFGNNRLVTFTYLQNFDCVDQPLMDLDFNNKLAQSDPNEMQTPICQPVTEPTQDPAGANIKHTAHLYVFVPMFSVDNDQNPNDAMACPNGGRPGELCGPALGAALIKLFGFVPEAWKTHPAVSTQCPDPNNPVPGTCTMHASSVDLSVTLNALGKTGPPTMPVFVPTPNHDHVVDNSRVNTTPIWWEVRPVLIMDQSDWPAADGSSGITSSKAMDDAESAGRAIEVGSNFFLFFSSQMSSHGSH

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
66 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
117 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
118 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.92
Metatranscriptomes 21.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.85
Rhizosphere 98.86
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10281574 3300003323 Unclassified 2181
2 Ga0058863_11265434 3300004799 Bacteria 1955
3 Ga0058863_11800759 3300004799 Bacteria 1054
4 Ga0058863_11801824 3300004799 Unclassified 1147
5 Ga0058863_11852757 3300004799 Bacteria 1474
6 Ga0058863_11923438 3300004799 Bacteria 2492
7 Ga0058861_10132900 3300004800 Unclassified 1971
8 Ga0058861_10567780 3300004800 Unclassified 1360
9 Ga0058861_11388766 3300004800 Unclassified 1151
10 Ga0058861_11567773 3300004800 Bacteria 1374
11 Ga0058861_11741686 3300004800 Bacteria 1679
12 Ga0058861_11801768 3300004800 Bacteria 973
13 Ga0058862_10027005 3300004803 Bacteria 1033
14 Ga0058862_10035513 3300004803 Unclassified 3048
15 Ga0058862_10037053 3300004803 Bacteria 2804
16 Ga0058862_10040528 3300004803 Unclassified 2830
17 Ga0058862_10238468 3300004803 Unclassified 1944
18 Ga0058862_12275231 3300004803 Bacteria 1901
19 Ga0058862_12291975 3300004803 Unclassified 1074
20 Ga0058862_12529459 3300004803 Unclassified 963
21 Ga0058862_12795798 3300004803 Bacteria 2739
22 Ga0058862_12805099 3300004803 Unclassified 1321
23 Ga0070658_10076838 3300005327 Bacteria 2739
24 Ga0070658_10137624 3300005327 Bacteria 2038
25 Ga0070683_100123448 3300005329 Bacteria 2447
26 Ga0070680_100083535 3300005336 Bacteria 2637
27 Ga0070680_100116464 3300005336 Bacteria 2228
28 Ga0070680_100203814 3300005336 Unclassified 1668
29 Ga0070680_100278980 3300005336 Bacteria 1416
30 Ga0070680_100344403 3300005336 Bacteria 1267
31 Ga0070660_100008645 3300005339 Bacteria 7131
32 Ga0070660_100028190 3300005339 Bacteria 4199
33 Ga0070660_100140580 3300005339 Unclassified 1937
34 Ga0070660_100258647 3300005339 Bacteria 1421
35 Ga0070691_10017299 3300005341 Bacteria 3317
36 Ga0070661_100043778 3300005344 Bacteria 3270
37 Ga0070659_100134061 3300005366 Bacteria 2014
38 Ga0070709_10104866 3300005434 Bacteria 1890
39 Ga0070714_100004455 3300005435 Bacteria 10549
40 Ga0070714_100016121 3300005435 Bacteria 6026
41 Ga0070714_100024671 3300005435 Bacteria 4955
42 Ga0070714_100028970 3300005435 Bacteria 4599
43 Ga0070714_100034222 3300005435 Bacteria 4254
44 Ga0070714_100042548 3300005435 Unclassified 3838
45 Ga0070714_100069792 3300005435 Bacteria 3036
46 Ga0070713_100003340 3300005436 Bacteria 10588
47 Ga0070713_100098320 3300005436 Bacteria 2531
48 Ga0070713_100176009 3300005436 Bacteria 1920
49 Ga0070713_100250822 3300005436 Unclassified 1614
50 Ga0070711_100032463 3300005439 Bacteria 3471
51 Ga0070711_100098912 3300005439 Unclassified 2119
52 Ga0070708_100043552 3300005445 Bacteria 3944
53 Ga0070708_100057906 3300005445 Bacteria 3452
54 Ga0070681_10000034 3300005458 Bacteria 98600
55 Ga0070681_10012953 3300005458 Bacteria 8281
56 Ga0070681_10121939 3300005458 Bacteria 2541
57 Ga0070681_10133113 3300005458 Unclassified 2418
58 Ga0070681_10198161 3300005458 Unclassified 1926
59 Ga0070681_10241691 3300005458 Bacteria 1719
60 Ga0070706_100010419 3300005467 Bacteria 8631
61 Ga0070706_100023125 3300005467 Bacteria 5723
62 Ga0070706_100063911 3300005467 Unclassified 3401
63 Ga0070706_100093158 3300005467 Bacteria 2795
64 Ga0070706_100165779 3300005467 Bacteria 2063
65 Ga0070706_100266751 3300005467 Unclassified 1598
66 Ga0070707_100010060 3300005468 Bacteria 8806
67 Ga0070707_100073813 3300005468 Bacteria 3289
68 Ga0070707_100373272 3300005468 Bacteria 1386
69 Ga0070707_100385498 3300005468 Unclassified 1361
70 Ga0070698_100030332 3300005471 Bacteria 5607
71 Ga0070698_100202220 3300005471 Bacteria 1922
72 Ga0070699_100024967 3300005518 Bacteria 5152
73 Ga0070699_100051933 3300005518 Bacteria 3549
74 Ga0070699_100081869 3300005518 Bacteria 2814
75 Ga0070679_100011342 3300005530 Bacteria 8493
76 Ga0070679_100062417 3300005530 Bacteria 3715
77 Ga0070679_100151331 3300005530 Bacteria 2297
78 Ga0070684_100189321 3300005535 Bacteria 1872
79 Ga0070684_100523547 3300005535 Bacteria 1099
80 Ga0070697_100010361 3300005536 Bacteria 7271
81 Ga0068853_100005955 3300005539 Bacteria 9633
82 Ga0068853_100008385 3300005539 Bacteria 8301
83 Ga0068853_100161448 3300005539 Bacteria 2023
84 Ga0068853_100312156 3300005539 Unclassified 1456
85 Ga0070696_100000163 3300005546 Bacteria 37742
86 Ga0070693_100061080 3300005547 Unclassified 2190
87 Ga0070665_100001969 3300005548 Bacteria 23093
88 Ga0068855_100000345 3300005563 Bacteria 57734
89 Ga0068855_100020157 3300005563 Bacteria 8007
90 Ga0068855_100052338 3300005563 Bacteria 4808
91 Ga0068855_100085422 3300005563 Bacteria 3651
92 Ga0068855_100249231 3300005563 Bacteria 1981
93 Ga0068855_100349079 3300005563 Bacteria 1630
94 Ga0068855_100400935 3300005563 Unclassified 1503
95 Ga0068855_100407302 3300005563 Bacteria 1489
96 Ga0068855_100811977 3300005563 Unclassified 993
97 Ga0070664_100037754 3300005564 Bacteria 4062
98 Ga0070664_100121661 3300005564 Unclassified 2286
99 Ga0068857_100003493 3300005577 Bacteria 13119
100 Ga0068857_100011482 3300005577 Bacteria 7704
101 Ga0068857_100063309 3300005577 Bacteria 3288
102 Ga0068857_100680769 3300005577 Bacteria 976
103 Ga0068854_100079621 3300005578 Bacteria 2416
104 Ga0068854_100094846 3300005578 Bacteria 2226
105 Ga0068856_100000578 3300005614 Bacteria 40018
106 Ga0068856_100005898 3300005614 Bacteria 12068
107 Ga0068856_100014125 3300005614 Bacteria 7722
108 Ga0068856_100055227 3300005614 Bacteria 3919
109 Ga0068856_100113332 3300005614 Unclassified 2710
110 Ga0068856_100191751 3300005614 Bacteria 2057
111 Ga0068856_100372095 3300005614 Bacteria 1448
112 Ga0068856_100532315 3300005614 Bacteria 1196
113 Ga0068856_100798077 3300005614 Unclassified 964
114 Ga0068852_100049137 3300005616 Bacteria 3607
115 Ga0068852_100187771 3300005616 Unclassified 1948
116 Ga0068851_10038071 3300005834 Bacteria 2412
117 Ga0068851_10100537 3300005834 Bacteria 1534
118 Ga0068858_100015697 3300005842 Bacteria 7125
119 Ga0070717_10000295 3300006028 Bacteria 33556
120 Ga0070717_10043822 3300006028 Bacteria 3653
121 Ga0070717_10063057 3300006028 Bacteria 3075
122 Ga0070717_10097070 3300006028 Bacteria 2496
123 Ga0097621_100000014 3300006237 Bacteria 100839
124 Ga0068871_100000552 3300006358 Bacteria 25519
125 Ga0075433_10001254 3300006852 Bacteria 18518
126 Ga0075434_100000921 3300006871 Bacteria 23590
127 Ga0075436_100245440 3300006914 Bacteria 1274
128 Ga0075435_100002754 3300007076 Bacteria 11737
129 Ga0105240_10001575 3300009093 Bacteria 38691
130 Ga0105240_10004465 3300009093 Bacteria 21309
131 Ga0105240_10006372 3300009093 Bacteria 17376
132 Ga0105240_10015178 3300009093 Bacteria 10485
133 Ga0105240_10037822 3300009093 Bacteria 6197
134 Ga0105240_10076582 3300009093 Bacteria 4123
135 Ga0105240_10101582 3300009093 Bacteria 3497
136 Ga0105240_10186006 3300009093 Unclassified 2447
137 Ga0105240_10242038 3300009093 Bacteria 2091
138 Ga0114129_10003272 3300009147 Bacteria 22737
139 Ga0105241_10027210 3300009174 Bacteria 4257
140 Ga0105237_10003456 3300009545 Bacteria 18756
141 Ga0105237_10107505 3300009545 Bacteria 2781
142 Ga0105237_10206173 3300009545 Unclassified 1966
143 Ga0105237_10225534 3300009545 Bacteria 1874
144 Ga0105238_10000099 3300009551 Bacteria 97818
145 Ga0105238_10003508 3300009551 Bacteria 15620
146 Ga0105238_10059339 3300009551 Bacteria 3833
147 Ga0105238_10079727 3300009551 Bacteria 3264
148 Ga0105238_10304881 3300009551 Bacteria 1577
149 Ga0105238_10305519 3300009551 Bacteria 1575
150 Ga0105238_10324556 3300009551 Unclassified 1526
151 Ga0105239_10047418 3300010375 Unclassified 4708
152 Ga0105239_10108376 3300010375 Bacteria 3078
153 Ga0154012_176890 3300013059 Bacteria 2029
154 Ga0157371_10023693 3300013102 Bacteria 4488
155 Ga0157371_10067328 3300013102 Bacteria 2535
156 Ga0157371_10134869 3300013102 Bacteria 1758
157 Ga0157370_10014397 3300013104 Bacteria 8086
158 Ga0157370_10031626 3300013104 Bacteria 5175
159 Ga0157370_10041466 3300013104 Bacteria 4440
160 Ga0157370_10131732 3300013104 Unclassified 2332
161 Ga0157369_10000042 3300013105 Bacteria 181784
162 Ga0157369_10007294 3300013105 Bacteria 12725
163 Ga0157369_10012472 3300013105 Bacteria 9644
164 Ga0157369_10014662 3300013105 Bacteria 8843
165 Ga0157369_10024906 3300013105 Bacteria 6649
166 Ga0157369_10083592 3300013105 Bacteria 3414
167 Ga0157369_10251356 3300013105 Bacteria 1845
168 Ga0157369_10312309 3300013105 Bacteria 1634
169 Ga0157374_10002804 3300013296 Bacteria 14633
170 Ga0157374_10028106 3300013296 Bacteria 5080
171 Ga0157378_10003318 3300013297 Bacteria 14315
172 Ga0157372_10000452 3300013307 Bacteria 45098
173 Ga0157372_10002149 3300013307 Bacteria 21435
174 Ga0157372_10003818 3300013307 Bacteria 16188
175 Ga0157372_10011433 3300013307 Bacteria 9438
176 Ga0157372_10012299 3300013307 Bacteria 9120
177 Ga0157372_10042801 3300013307 Bacteria 5011
178 Ga0157372_10081973 3300013307 Bacteria 3652
179 Ga0157372_10110848 3300013307 Unclassified 3143
180 Ga0157372_10120658 3300013307 Unclassified 3011
181 Ga0157372_10141596 3300013307 Bacteria 2771
182 Ga0157372_10333726 3300013307 Bacteria 1766
183 Ga0157372_10403959 3300013307 Unclassified 1592
184 Ga0157372_10480042 3300013307 Unclassified 1449
185 Ga0163163_10484243 3300014325 Bacteria 1298
186 Ga0182008_10015099 3300014497 Unclassified 4037
187 Ga0182008_10061515 3300014497 Bacteria 1851
188 Ga0157376_10022500 3300014969 Unclassified 4917
189 Ga0182006_1039456 3300015261 Unclassified 1863
190 Ga0182007_10052352 3300015262 Unclassified 1345
191 Ga0197907_10352007 3300020069 Unclassified 2873
192 Ga0197907_10605526 3300020069 Archaea 1308
193 Ga0197907_10880853 3300020069 Bacteria 3494
194 Ga0197907_10931017 3300020069 Bacteria 1334
195 Ga0197907_10992046 3300020069 Bacteria 2665
196 Ga0197907_11270220 3300020069 Bacteria 1935
197 Ga0206356_10068678 3300020070 Unclassified 1006
198 Ga0206356_10169795 3300020070 Unclassified 1578
199 Ga0206356_10460491 3300020070 Bacteria 1130
200 Ga0206356_10492650 3300020070 Bacteria 1161
201 Ga0206356_10644080 3300020070 Bacteria 1138
202 Ga0206356_10691941 3300020070 Unclassified 1368
203 Ga0206356_10783463 3300020070 Unclassified 1514
204 Ga0206356_10993072 3300020070 Bacteria 1918
205 Ga0206356_11224990 3300020070 Bacteria 1449
206 Ga0206356_11230954 3300020070 Bacteria 1353
207 Ga0206356_11895060 3300020070 Unclassified 2522
208 Ga0206349_1038407 3300020075 Unclassified 1247
209 Ga0206349_1040746 3300020075 Bacteria 2935
210 Ga0206349_1849033 3300020075 Bacteria 1209
211 Ga0206355_1491969 3300020076 Bacteria 1266
212 Ga0206351_10028168 3300020077 Bacteria 1147
213 Ga0206351_10114049 3300020077 Bacteria 2375
214 Ga0206352_10214493 3300020078 Bacteria 4774
215 Ga0206352_10471738 3300020078 Unclassified 1878
216 Ga0206352_10679449 3300020078 Bacteria 1441
217 Ga0206352_10744286 3300020078 Bacteria 1974
218 Ga0206352_10914886 3300020078 Bacteria 945
219 Ga0206352_10988006 3300020078 Bacteria 1473
220 Ga0206352_11146833 3300020078 Unclassified 1523
221 Ga0206350_10145040 3300020080 Bacteria 2118
222 Ga0206350_10351149 3300020080 Bacteria 2646
223 Ga0206350_10384443 3300020080 Bacteria 1205
224 Ga0206350_10566642 3300020080 Bacteria 1507
225 Ga0206350_10731429 3300020080 Bacteria 996
226 Ga0206354_10294005 3300020081 Bacteria 2367
227 Ga0206354_10426872 3300020081 Bacteria 1359
228 Ga0206354_10934306 3300020081 Unclassified 1357
229 Ga0206354_11598845 3300020081 Bacteria 1181
230 Ga0206354_11601141 3300020081 Unclassified 899
231 Ga0206353_10502870 3300020082 Unclassified 1190
232 Ga0206353_11234468 3300020082 Bacteria 1116
233 Ga0206353_11467059 3300020082 Unclassified 1228
234 Ga0206353_11646503 3300020082 Unclassified 1064
235 Ga0154015_1311633 3300020610 Bacteria 2707
236 Ga0224712_10013805 3300022467 Unclassified 2584
237 Ga0224712_10069208 3300022467 Bacteria 1428
238 Ga0224712_10072786 3300022467 Bacteria 1400
239 Ga0224712_10091886 3300022467 Bacteria 1273
240 Ga0224712_10162729 3300022467 Bacteria 996
241 Ga0224712_10164374 3300022467 Unclassified 992
242 Ga0207656_10156255 3300025321 Unclassified 1083
243 Ga0207699_10180844 3300025906 Unclassified 1417
244 Ga0207699_10335578 3300025906 Unclassified 1064
245 Ga0207705_10046176 3300025909 Bacteria 3129
246 Ga0207684_10000773 3300025910 Bacteria 37123
247 Ga0207684_10005652 3300025910 Bacteria 11487
248 Ga0207684_10076266 3300025910 Bacteria 2849
249 Ga0207684_10128472 3300025910 Bacteria 2175
250 Ga0207684_10141952 3300025910 Bacteria 2065
251 Ga0207684_10259645 3300025910 Unclassified 1499
252 Ga0207654_10002214 3300025911 Bacteria 9974
253 Ga0207654_10152557 3300025911 Unclassified 1484
254 Ga0207707_10000155 3300025912 Bacteria 71477
255 Ga0207707_10052734 3300025912 Bacteria 3540
256 Ga0207707_10132938 3300025912 Unclassified 2176
257 Ga0207707_10138325 3300025912 Bacteria 2129
258 Ga0207707_10239577 3300025912 Unclassified 1577
259 Ga0207695_10000832 3300025913 Bacteria 57182
260 Ga0207695_10000958 3300025913 Bacteria 51395
261 Ga0207695_10007335 3300025913 Bacteria 14078
262 Ga0207695_10019475 3300025913 Bacteria 7815
263 Ga0207695_10129172 3300025913 Bacteria 2486
264 Ga0207695_10138125 3300025913 Bacteria 2389
265 Ga0207695_10159057 3300025913 Bacteria 2192
266 Ga0207671_10029690 3300025914 Unclassified 4081
267 Ga0207671_10142401 3300025914 Bacteria 1848
268 Ga0207663_10096071 3300025916 Unclassified 1978
269 Ga0207663_10148665 3300025916 Bacteria 1641
270 Ga0207660_10141741 3300025917 Bacteria 1838
271 Ga0207657_10011237 3300025919 Bacteria 8897
272 Ga0207657_10020112 3300025919 Bacteria 6317
273 Ga0207657_10062743 3300025919 Bacteria 3180
274 Ga0207649_10051175 3300025920 Bacteria 2557
275 Ga0207652_10081439 3300025921 Bacteria 2832
276 Ga0207646_10004106 3300025922 Bacteria 16042
277 Ga0207646_10016355 3300025922 Bacteria 6962
278 Ga0207646_10281123 3300025922 Bacteria 1504
279 Ga0207694_10002276 3300025924 Bacteria 15709
280 Ga0207694_10008786 3300025924 Bacteria 7621
281 Ga0207694_10105505 3300025924 Bacteria 2237
282 Ga0207694_10119776 3300025924 Unclassified 2100
283 Ga0207694_10326616 3300025924 Bacteria 1267
284 Ga0207700_10120098 3300025928 Unclassified 2130
285 Ga0207700_10141806 3300025928 Unclassified 1975
286 Ga0207700_10146068 3300025928 Bacteria 1949
287 Ga0207700_10244368 3300025928 Unclassified 1531
288 Ga0207664_10010770 3300025929 Bacteria 6467
289 Ga0207664_10025990 3300025929 Bacteria 4419
290 Ga0207664_10040308 3300025929 Bacteria 3631
291 Ga0207664_10042975 3300025929 Bacteria 3532
292 Ga0207664_10050013 3300025929 Bacteria 3294
293 Ga0207664_10106353 3300025929 Unclassified 2326
294 Ga0207664_10137967 3300025929 Bacteria 2060
295 Ga0207690_10181161 3300025932 Bacteria 1586
296 Ga0207661_10116319 3300025944 Bacteria 2270
297 Ga0207661_10154297 3300025944 Bacteria 1987
298 Ga0207661_10184264 3300025944 Unclassified 1826
299 Ga0207661_10305351 3300025944 Unclassified 1427
300 Ga0207667_10002055 3300025949 Bacteria 25228
301 Ga0207667_10030061 3300025949 Bacteria 5881
302 Ga0207667_10047575 3300025949 Bacteria 4540
303 Ga0207667_10072390 3300025949 Unclassified 3583
304 Ga0207667_10089779 3300025949 Bacteria 3175
305 Ga0207667_10135194 3300025949 Bacteria 2539
306 Ga0207667_10255754 3300025949 Unclassified 1791
307 Ga0207667_10283572 3300025949 Bacteria 1692
308 Ga0207640_10129412 3300025981 Unclassified 1822
309 Ga0207640_10203933 3300025981 Unclassified 1501
310 Ga0207703_10037704 3300026035 Unclassified 3852
311 Ga0207639_10005446 3300026041 Bacteria 8597
312 Ga0207639_10012051 3300026041 Bacteria 6015
313 Ga0207639_10078213 3300026041 Bacteria 2610
314 Ga0207639_10235362 3300026041 Unclassified 1590
315 Ga0207639_10421699 3300026041 Bacteria 1206
316 Ga0207639_10583736 3300026041 Unclassified 1029
317 Ga0207702_10000303 3300026078 Bacteria 56839
318 Ga0207702_10051936 3300026078 Unclassified 3467
319 Ga0207702_10057759 3300026078 Bacteria 3300
320 Ga0207702_10060700 3300026078 Bacteria 3223
321 Ga0207702_10159291 3300026078 Unclassified 2060
322 Ga0207702_10441309 3300026078 Unclassified 1261
323 Ga0207674_10003019 3300026116 Bacteria 20864
324 Ga0207674_10107284 3300026116 Bacteria 2770
325 Ga0207674_10116921 3300026116 Bacteria 2637
326 Ga0207698_10027286 3300026142 Bacteria 4052
327 Ga0207698_10127823 3300026142 Bacteria 2165
328 Ga0268266_10027617 3300028379 Bacteria 4824
329 Ga0373936_0095356 3300035113 Unclassified 1251
330 Ga0373954_0012776 3300035118 Bacteria 3739
331 Ga0373927_0025657 3300035695 Unclassified 3853
332 Ga0373933_0040201 3300035724 Bacteria 2754
333 Ga0373925_0007858 3300037068 Bacteria 7768
334 Ga0373925_0014252 3300037068 Bacteria 5751
335 Ga0395900_0186208 3300037418 Unclassified 2107
336 Ga0395900_0562663 3300037418 Unclassified 1084
337 Ga0395898_0037374 3300037466 Unclassified 4817
338 Ga0395898_0113230 3300037466 Unclassified 2600
339 Ga0395901_0352307 3300038443 Unclassified 1519
340 Ga0466963_0145894 3300044694 Bacteria 1642
341 Ga0466959_0176522 3300045049 Bacteria 1496
342 Ga0466967_0631223 3300045976 Bacteria 1059
343 Ga0495674_0032333 3300047319 Bacteria 4745
344 Ga0496109_0467401 3300048912 Unclassified 1191
345 Ga0496109_0726601 3300048912 Bacteria 931
346 Ga0496112_0010582 3300048915 Bacteria 8378
347 nmdc:mga05p37_3942_c1 3300050507 Bacteria 17384
348 nmdc:mga0n895_43801_c1 3300050512 Bacteria 4363
349 nmdc:mga0rr50_2415_c1 3300050513 Bacteria 10516
350 nmdc:mga08x19_228865_c1 3300050514 Bacteria 1279
351 Ga0587071_009869 3300060344 Unclassified 1581

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026078 Ga0207702_10057759 Ga0207702_100577593 238
2 3300005435 Ga0070714_100024671 Ga0070714_1000246714 251
3 3300005436 Ga0070713_100098320 Ga0070713_1000983201 251
4 3300013307 Ga0157372_10002149 Ga0157372_100021497 251
5 3300025913 Ga0207695_10159057 Ga0207695_101590572 251
6 3300025929 Ga0207664_10050013 Ga0207664_100500133 251
7 3300025913 Ga0207695_10129172 Ga0207695_101291721 252
8 3300026041 Ga0207639_10421699 Ga0207639_104216991 252
9 3300037466 Ga0395898_0113230 Ga0395898_0113230_1699_2484 252
10 3300005336 Ga0070680_100083535 Ga0070680_1000835352 253
11 3300005436 Ga0070713_100176009 Ga0070713_1001760092 253
12 3300005467 Ga0070706_100010419 Ga0070706_1000104197 253
13 3300005468 Ga0070707_100385498 Ga0070707_1003854981 253
14 3300025910 Ga0207684_10076266 Ga0207684_100762661 253
15 3300025919 Ga0207657_10020112 Ga0207657_100201125 253
16 3300025981 Ga0207640_10203933 Ga0207640_102039332 253
17 3300005614 Ga0068856_100014125 Ga0068856_1000141255 254
18 3300009093 Ga0105240_10037822 Ga0105240_100378222 254
19 3300013307 Ga0157372_10110848 Ga0157372_101108483 254
20 3300005445 Ga0070708_100057906 Ga0070708_1000579062 255
21 3300005467 Ga0070706_100023125 Ga0070706_1000231256 255
22 3300005468 Ga0070707_100010060 Ga0070707_1000100604 255
23 3300005471 Ga0070698_100030332 Ga0070698_1000303326 255
24 3300005518 Ga0070699_100024967 Ga0070699_1000249672 255
25 3300005536 Ga0070697_100010361 Ga0070697_1000103617 255
26 3300005614 Ga0068856_100191751 Ga0068856_1001917511 255
27 3300006028 Ga0070717_10097070 Ga0070717_100970702 255
28 3300025910 Ga0207684_10005652 Ga0207684_100056529 255
29 3300025911 Ga0207654_10002214 Ga0207654_1000221410 255
30 3300025922 Ga0207646_10016355 Ga0207646_100163553 255
31 3300025924 Ga0207694_10008786 Ga0207694_100087868 255
32 3300025949 Ga0207667_10135194 Ga0207667_101351943 255
33 3300026078 Ga0207702_10060700 Ga0207702_100607001 255
34 3300004800 Ga0058861_10567780 Ga0058861_105677801 258
35 3300005341 Ga0070691_10017299 Ga0070691_100172993 258
36 3300005435 Ga0070714_100069792 Ga0070714_1000697922 258
37 3300005436 Ga0070713_100250822 Ga0070713_1002508222 258
38 3300005458 Ga0070681_10000034 Ga0070681_1000003475 258
39 3300005539 Ga0068853_100005955 Ga0068853_1000059553 258
40 3300005563 Ga0068855_100000345 Ga0068855_10000034512 258
41 3300005564 Ga0070664_100121661 Ga0070664_1001216612 258
42 3300005577 Ga0068857_100003493 Ga0068857_1000034935 258
43 3300005614 Ga0068856_100000578 Ga0068856_10000057822 258
44 3300005842 Ga0068858_100015697 Ga0068858_1000156974 258
45 3300006237 Ga0097621_100000014 Ga0097621_10000001461 258
46 3300006358 Ga0068871_100000552 Ga0068871_1000005529 258
47 3300009093 Ga0105240_10001575 Ga0105240_1000157536 258
48 3300009174 Ga0105241_10027210 Ga0105241_100272101 258
49 3300009551 Ga0105238_10000099 Ga0105238_1000009957 258
50 3300010375 Ga0105239_10047418 Ga0105239_100474185 258
51 3300013105 Ga0157369_10000042 Ga0157369_1000004225 258
52 3300013296 Ga0157374_10002804 Ga0157374_100028044 258
53 3300013297 Ga0157378_10003318 Ga0157378_100033185 258
54 3300013307 Ga0157372_10000452 Ga0157372_1000045226 258
55 3300014969 Ga0157376_10022500 Ga0157376_100225002 258
56 3300020080 Ga0206350_10351149 Ga0206350_103511492 258
57 3300025911 Ga0207654_10152557 Ga0207654_101525572 258
58 3300025912 Ga0207707_10000155 Ga0207707_1000015512 258
59 3300025924 Ga0207694_10002276 Ga0207694_100022768 258
60 3300025928 Ga0207700_10120098 Ga0207700_101200981 258
61 3300025944 Ga0207661_10184264 Ga0207661_101842641 258
62 3300025949 Ga0207667_10002055 Ga0207667_100020551 258
63 3300026035 Ga0207703_10037704 Ga0207703_100377042 258
64 3300026041 Ga0207639_10005446 Ga0207639_100054464 258
65 3300026078 Ga0207702_10000303 Ga0207702_1000030325 258
66 3300048912 Ga0496109_0467401 Ga0496109_0467401_184_1017 258
67 3300048915 Ga0496112_0010582 Ga0496112_0010582_2029_2862 258
68 3300050514 nmdc:mga08x19_228865_c1 nmdc:mga08x19_228865_c1_278_1072 258
69 3300005327 Ga0070658_10076838 Ga0070658_100768382 259
70 3300005329 Ga0070683_100123448 Ga0070683_1001234483 259
71 3300005339 Ga0070660_100140580 Ga0070660_1001405802 259
72 3300005344 Ga0070661_100043778 Ga0070661_1000437783 259
73 3300005366 Ga0070659_100134061 Ga0070659_1001340612 259
74 3300005458 Ga0070681_10121939 Ga0070681_101219392 259
75 3300005467 Ga0070706_100093158 Ga0070706_1000931582 259
76 3300005518 Ga0070699_100051933 Ga0070699_1000519333 259
77 3300005518 Ga0070699_100081869 Ga0070699_1000818692 259
78 3300005530 Ga0070679_100151331 Ga0070679_1001513312 259
79 3300005563 Ga0068855_100020157 Ga0068855_1000201578 259
80 3300005564 Ga0070664_100037754 Ga0070664_1000377543 259
81 3300005577 Ga0068857_100011482 Ga0068857_1000114823 259
82 3300005578 Ga0068854_100094846 Ga0068854_1000948462 259
83 3300005616 Ga0068852_100187771 Ga0068852_1001877712 259
84 3300005834 Ga0068851_10038071 Ga0068851_100380712 259
85 3300009093 Ga0105240_10015178 Ga0105240_100151788 259
86 3300009545 Ga0105237_10107505 Ga0105237_101075052 259
87 3300013102 Ga0157371_10023693 Ga0157371_100236934 259
88 3300013104 Ga0157370_10031626 Ga0157370_100316265 259
89 3300013307 Ga0157372_10120658 Ga0157372_101206584 259
90 3300013307 Ga0157372_10480042 Ga0157372_104800421 259
91 3300014497 Ga0182008_10061515 Ga0182008_100615152 259
92 3300020070 Ga0206356_10691941 Ga0206356_106919412 259
93 3300025910 Ga0207684_10128472 Ga0207684_101284722 259
94 3300025919 Ga0207657_10062743 Ga0207657_100627432 259
95 3300025928 Ga0207700_10244368 Ga0207700_102443681 259
96 3300025932 Ga0207690_10181161 Ga0207690_101811612 259
97 3300025944 Ga0207661_10116319 Ga0207661_101163191 259
98 3300025981 Ga0207640_10129412 Ga0207640_101294122 259
99 3300026116 Ga0207674_10003019 Ga0207674_100030192 259
100 3300026142 Ga0207698_10127823 Ga0207698_101278232 259
101 3300005436 Ga0070713_100003340 Ga0070713_1000033404 260
102 3300006028 Ga0070717_10000295 Ga0070717_100002953 260
103 3300025929 Ga0207664_10137967 Ga0207664_101379672 260
104 3300035118 Ga0373954_0012776 Ga0373954_0012776_1957_2829 260
105 3300035695 Ga0373927_0025657 Ga0373927_0025657_439_1311 260
106 3300035724 Ga0373933_0040201 Ga0373933_0040201_1799_2671 260
107 3300037068 Ga0373925_0007858 Ga0373925_0007858_5599_6471 260
108 3300047319 Ga0495674_0032333 Ga0495674_0032333_573_1445 260
109 3300004799 Ga0058863_11801824 Ga0058863_118018242 261
110 3300004803 Ga0058862_12529459 Ga0058862_125294591 261
111 3300005458 Ga0070681_10012953 Ga0070681_100129537 261
112 3300020082 Ga0206353_10502870 Ga0206353_105028701 261
113 3300025912 Ga0207707_10239577 Ga0207707_102395771 261
114 3300045049 Ga0466959_0176522 Ga0466959_0176522_628_1434 261
115 3300045976 Ga0466967_0631223 Ga0466967_0631223_97_903 261
116 3300004800 Ga0058861_11567773 Ga0058861_115677731 263
117 3300005614 Ga0068856_100372095 Ga0068856_1003720952 263
118 3300020070 Ga0206356_10783463 Ga0206356_107834631 263
119 3300020080 Ga0206350_10145040 Ga0206350_101450401 263
120 3300022467 Ga0224712_10162729 Ga0224712_101627291 263
121 3300004800 Ga0058861_11388766 Ga0058861_113887662 264
122 3300004803 Ga0058862_12805099 Ga0058862_128050991 264
123 3300005563 Ga0068855_100085422 Ga0068855_1000854223 264
124 3300013105 Ga0157369_10012472 Ga0157369_100124727 264
125 3300020069 Ga0197907_10931017 Ga0197907_109310171 264
126 3300020070 Ga0206356_10492650 Ga0206356_104926502 264
127 3300020078 Ga0206352_10744286 Ga0206352_107442862 264
128 3300020082 Ga0206353_11234468 Ga0206353_112344681 264
129 3300022467 Ga0224712_10069208 Ga0224712_100692081 264
130 3300025949 Ga0207667_10089779 Ga0207667_100897792 264
131 3300037068 Ga0373925_0014252 Ga0373925_0014252_1122_1928 264
132 3300006852 Ga0075433_10001254 Ga0075433_100012546 266
133 3300006871 Ga0075434_100000921 Ga0075434_1000009219 266
134 3300007076 Ga0075435_100002754 Ga0075435_1000027546 266
135 3300009093 Ga0105240_10006372 Ga0105240_1000637211 266
136 3300009147 Ga0114129_10003272 Ga0114129_1000327212 266
137 3300009545 Ga0105237_10003456 Ga0105237_100034566 266
138 3300014325 Ga0163163_10484243 Ga0163163_104842432 266
139 3300020070 Ga0206356_10644080 Ga0206356_106440801 266
140 3300025910 Ga0207684_10000773 Ga0207684_1000077344 266
141 3300035113 Ga0373936_0095356 Ga0373936_0095356_217_1101 266
142 3300050507 nmdc:mga05p37_3942_c1 nmdc:mga05p37_3942_c1_3815_4693 266
143 3300050512 nmdc:mga0n895_43801_c1 nmdc:mga0n895_43801_c1_2002_2880 266
144 3300050513 nmdc:mga0rr50_2415_c1 nmdc:mga0rr50_2415_c1_3357_4235 266
145 3300004799 Ga0058863_11800759 Ga0058863_118007591 267
146 3300004800 Ga0058861_11801768 Ga0058861_118017681 267
147 3300004803 Ga0058862_10027005 Ga0058862_100270051 267
148 3300020070 Ga0206356_10068678 Ga0206356_100686781 267
149 3300025912 Ga0207707_10052734 Ga0207707_100527342 267
150 3300005471 Ga0070698_100202220 Ga0070698_1002022202 268
151 3300025906 Ga0207699_10180844 Ga0207699_101808442 268
152 3300004799 Ga0058863_11265434 Ga0058863_112654342 269
153 3300004803 Ga0058862_10037053 Ga0058862_100370532 269
154 3300005339 Ga0070660_100008645 Ga0070660_1000086454 269
155 3300005434 Ga0070709_10104866 Ga0070709_101048662 269
156 3300005435 Ga0070714_100004455 Ga0070714_1000044552 269
157 3300005439 Ga0070711_100098912 Ga0070711_1000989121 269
158 3300005535 Ga0070684_100189321 Ga0070684_1001893212 269
159 3300005614 Ga0068856_100113332 Ga0068856_1001133323 269
160 3300006028 Ga0070717_10063057 Ga0070717_100630572 269
161 3300009093 Ga0105240_10186006 Ga0105240_101860062 269
162 3300009551 Ga0105238_10059339 Ga0105238_100593396 269
163 3300013296 Ga0157374_10028106 Ga0157374_100281063 269
164 3300025906 Ga0207699_10335578 Ga0207699_103355781 269
165 3300025912 Ga0207707_10132938 Ga0207707_101329383 269
166 3300025916 Ga0207663_10096071 Ga0207663_100960712 269
167 3300025924 Ga0207694_10119776 Ga0207694_101197763 269
168 3300025928 Ga0207700_10141806 Ga0207700_101418062 269
169 3300025929 Ga0207664_10010770 Ga0207664_100107703 269
170 3300025944 Ga0207661_10305351 Ga0207661_103053512 269
171 3300026078 Ga0207702_10159291 Ga0207702_101592912 269
172 3300004799 Ga0058863_11852757 Ga0058863_118527571 270
173 3300004800 Ga0058861_10132900 Ga0058861_101329001 270
174 3300004800 Ga0058861_11741686 Ga0058861_117416861 270
175 3300004803 Ga0058862_10238468 Ga0058862_102384681 270
176 3300004803 Ga0058862_12275231 Ga0058862_122752311 270
177 3300004803 Ga0058862_12291975 Ga0058862_122919751 270
178 3300005327 Ga0070658_10137624 Ga0070658_101376242 270
179 3300005336 Ga0070680_100203814 Ga0070680_1002038143 270
180 3300005336 Ga0070680_100344403 Ga0070680_1003444032 270
181 3300005339 Ga0070660_100258647 Ga0070660_1002586472 270
182 3300005435 Ga0070714_100016121 Ga0070714_1000161213 270
183 3300005435 Ga0070714_100028970 Ga0070714_1000289702 270
184 3300005435 Ga0070714_100034222 Ga0070714_1000342221 270
185 3300005435 Ga0070714_100042548 Ga0070714_1000425482 270
186 3300005439 Ga0070711_100032463 Ga0070711_1000324633 270
187 3300005445 Ga0070708_100043552 Ga0070708_1000435523 270
188 3300005458 Ga0070681_10198161 Ga0070681_101981613 270
189 3300005458 Ga0070681_10241691 Ga0070681_102416911 270
190 3300005467 Ga0070706_100063911 Ga0070706_1000639112 270
191 3300005467 Ga0070706_100266751 Ga0070706_1002667512 270
192 3300005468 Ga0070707_100073813 Ga0070707_1000738132 270
193 3300005468 Ga0070707_100373272 Ga0070707_1003732721 270
194 3300005530 Ga0070679_100062417 Ga0070679_1000624172 270
195 3300005539 Ga0068853_100161448 Ga0068853_1001614482 270
196 3300005546 Ga0070696_100000163 Ga0070696_10000016335 270
197 3300005547 Ga0070693_100061080 Ga0070693_1000610801 270
198 3300005563 Ga0068855_100349079 Ga0068855_1003490791 270
199 3300005563 Ga0068855_100811977 Ga0068855_1008119771 270
200 3300005614 Ga0068856_100532315 Ga0068856_1005323151 270
201 3300006028 Ga0070717_10043822 Ga0070717_100438222 270
202 3300009093 Ga0105240_10004465 Ga0105240_100044657 270
203 3300009545 Ga0105237_10206173 Ga0105237_102061732 270
204 3300009551 Ga0105238_10304881 Ga0105238_103048812 270
205 3300013059 Ga0154012_176890 Ga0154012_1768902 270
206 3300013102 Ga0157371_10134869 Ga0157371_101348692 270
207 3300013105 Ga0157369_10024906 Ga0157369_100249066 270
208 3300013105 Ga0157369_10251356 Ga0157369_102513562 270
209 3300013307 Ga0157372_10011433 Ga0157372_100114333 270
210 3300013307 Ga0157372_10042801 Ga0157372_100428014 270
211 3300013307 Ga0157372_10141596 Ga0157372_101415962 270
212 3300013307 Ga0157372_10403959 Ga0157372_104039592 270
213 3300020070 Ga0206356_10460491 Ga0206356_104604911 270
214 3300020075 Ga0206349_1040746 Ga0206349_10407461 270
215 3300020077 Ga0206351_10028168 Ga0206351_100281682 270
216 3300020077 Ga0206351_10114049 Ga0206351_101140491 270
217 3300020080 Ga0206350_10384443 Ga0206350_103844432 270
218 3300020081 Ga0206354_11598845 Ga0206354_115988451 270
219 3300020082 Ga0206353_11467059 Ga0206353_114670592 270
220 3300022467 Ga0224712_10091886 Ga0224712_100918862 270
221 3300025909 Ga0207705_10046176 Ga0207705_100461762 270
222 3300025910 Ga0207684_10259645 Ga0207684_102596452 270
223 3300025912 Ga0207707_10138325 Ga0207707_101383252 270
224 3300025913 Ga0207695_10007335 Ga0207695_100073355 270
225 3300025916 Ga0207663_10148665 Ga0207663_101486651 270
226 3300025917 Ga0207660_10141741 Ga0207660_101417412 270
227 3300025920 Ga0207649_10051175 Ga0207649_100511752 270
228 3300025922 Ga0207646_10004106 Ga0207646_1000410612 270
229 3300025922 Ga0207646_10281123 Ga0207646_102811233 270
230 3300025928 Ga0207700_10146068 Ga0207700_101460681 270
231 3300025929 Ga0207664_10025990 Ga0207664_100259904 270
232 3300025929 Ga0207664_10040308 Ga0207664_100403083 270
233 3300025929 Ga0207664_10042975 Ga0207664_100429753 270
234 3300025929 Ga0207664_10106353 Ga0207664_101063532 270
235 3300026041 Ga0207639_10078213 Ga0207639_100782132 270
236 3300026078 Ga0207702_10441309 Ga0207702_104413091 270
237 3300037418 Ga0395900_0186208 Ga0395900_0186208_993_1820 270
238 3300037466 Ga0395898_0037374 Ga0395898_0037374_844_1671 270
239 3300038443 Ga0395901_0352307 Ga0395901_0352307_608_1435 270
240 3300044694 Ga0466963_0145894 Ga0466963_0145894_25_885 270
241 3300048912 Ga0496109_0726601 Ga0496109_0726601_73_912 270
242 3300004799 Ga0058863_11923438 Ga0058863_119234382 271
243 3300004803 Ga0058862_10035513 Ga0058862_100355132 271
244 3300004803 Ga0058862_10040528 Ga0058862_100405281 271
245 3300004803 Ga0058862_12795798 Ga0058862_127957983 271
246 3300005336 Ga0070680_100116464 Ga0070680_1001164642 271
247 3300005336 Ga0070680_100278980 Ga0070680_1002789802 271
248 3300005339 Ga0070660_100028190 Ga0070660_1000281902 271
249 3300005458 Ga0070681_10133113 Ga0070681_101331132 271
250 3300005467 Ga0070706_100165779 Ga0070706_1001657792 271
251 3300005530 Ga0070679_100011342 Ga0070679_1000113422 271
252 3300005535 Ga0070684_100523547 Ga0070684_1005235471 271
253 3300005539 Ga0068853_100008385 Ga0068853_1000083858 271
254 3300005539 Ga0068853_100312156 Ga0068853_1003121561 271
255 3300005563 Ga0068855_100052338 Ga0068855_1000523383 271
256 3300005563 Ga0068855_100249231 Ga0068855_1002492312 271
257 3300005563 Ga0068855_100400935 Ga0068855_1004009351 271
258 3300005563 Ga0068855_100407302 Ga0068855_1004073022 271
259 3300005577 Ga0068857_100063309 Ga0068857_1000633092 271
260 3300005577 Ga0068857_100680769 Ga0068857_1006807691 271
261 3300005578 Ga0068854_100079621 Ga0068854_1000796212 271
262 3300005614 Ga0068856_100005898 Ga0068856_10000589812 271
263 3300005614 Ga0068856_100055227 Ga0068856_1000552272 271
264 3300005614 Ga0068856_100798077 Ga0068856_1007980771 271
265 3300005616 Ga0068852_100049137 Ga0068852_1000491372 271
266 3300005834 Ga0068851_10100537 Ga0068851_101005372 271
267 3300006914 Ga0075436_100245440 Ga0075436_1002454401 271
268 3300009093 Ga0105240_10076582 Ga0105240_100765823 271
269 3300009093 Ga0105240_10101582 Ga0105240_101015823 271
270 3300009093 Ga0105240_10242038 Ga0105240_102420381 271
271 3300009545 Ga0105237_10225534 Ga0105237_102255342 271
272 3300009551 Ga0105238_10003508 Ga0105238_100035089 271
273 3300009551 Ga0105238_10079727 Ga0105238_100797272 271
274 3300009551 Ga0105238_10305519 Ga0105238_103055193 271
275 3300009551 Ga0105238_10324556 Ga0105238_103245562 271
276 3300010375 Ga0105239_10108376 Ga0105239_101083764 271
277 3300013102 Ga0157371_10067328 Ga0157371_100673282 271
278 3300013104 Ga0157370_10014397 Ga0157370_100143972 271
279 3300013104 Ga0157370_10041466 Ga0157370_100414662 271
280 3300013104 Ga0157370_10131732 Ga0157370_101317322 271
281 3300013105 Ga0157369_10007294 Ga0157369_100072943 271
282 3300013105 Ga0157369_10014662 Ga0157369_100146622 271
283 3300013105 Ga0157369_10083592 Ga0157369_100835922 271
284 3300013105 Ga0157369_10312309 Ga0157369_103123092 271
285 3300013307 Ga0157372_10003818 Ga0157372_100038189 271
286 3300013307 Ga0157372_10012299 Ga0157372_100122991 271
287 3300013307 Ga0157372_10081973 Ga0157372_100819733 271
288 3300013307 Ga0157372_10333726 Ga0157372_103337263 271
289 3300014497 Ga0182008_10015099 Ga0182008_100150994 271
290 3300015261 Ga0182006_1039456 Ga0182006_10394562 271
291 3300015262 Ga0182007_10052352 Ga0182007_100523522 271
292 3300020069 Ga0197907_10352007 Ga0197907_103520071 271
293 3300020069 Ga0197907_10880853 Ga0197907_108808532 271
294 3300020069 Ga0197907_10992046 Ga0197907_109920464 271
295 3300020069 Ga0197907_11270220 Ga0197907_112702202 271
296 3300020070 Ga0206356_10169795 Ga0206356_101697952 271
297 3300020070 Ga0206356_10993072 Ga0206356_109930721 271
298 3300020070 Ga0206356_11224990 Ga0206356_112249902 271
299 3300020070 Ga0206356_11230954 Ga0206356_112309541 271
300 3300020070 Ga0206356_11895060 Ga0206356_118950601 271
301 3300020075 Ga0206349_1849033 Ga0206349_18490332 271
302 3300020076 Ga0206355_1491969 Ga0206355_14919692 271
303 3300020078 Ga0206352_10214493 Ga0206352_102144932 271
304 3300020078 Ga0206352_10471738 Ga0206352_104717381 271
305 3300020078 Ga0206352_10679449 Ga0206352_106794492 271
306 3300020078 Ga0206352_10914886 Ga0206352_109148861 271
307 3300020078 Ga0206352_10988006 Ga0206352_109880061 271
308 3300020078 Ga0206352_11146833 Ga0206352_111468331 271
309 3300020080 Ga0206350_10566642 Ga0206350_105666422 271
310 3300020080 Ga0206350_10731429 Ga0206350_107314291 271
311 3300020081 Ga0206354_10294005 Ga0206354_102940052 271
312 3300020081 Ga0206354_10426872 Ga0206354_104268722 271
313 3300020081 Ga0206354_10934306 Ga0206354_109343062 271
314 3300020081 Ga0206354_11601141 Ga0206354_116011411 271
315 3300020082 Ga0206353_11646503 Ga0206353_116465031 271
316 3300020610 Ga0154015_1311633 Ga0154015_13116331 271
317 3300022467 Ga0224712_10072786 Ga0224712_100727862 271
318 3300022467 Ga0224712_10164374 Ga0224712_101643741 271
319 3300025321 Ga0207656_10156255 Ga0207656_101562551 271
320 3300025910 Ga0207684_10141952 Ga0207684_101419522 271
321 3300025913 Ga0207695_10000832 Ga0207695_1000083211 271
322 3300025913 Ga0207695_10000958 Ga0207695_1000095816 271
323 3300025913 Ga0207695_10019475 Ga0207695_100194756 271
324 3300025913 Ga0207695_10138125 Ga0207695_101381252 271
325 3300025914 Ga0207671_10029690 Ga0207671_100296904 271
326 3300025914 Ga0207671_10142401 Ga0207671_101424012 271
327 3300025919 Ga0207657_10011237 Ga0207657_100112378 271
328 3300025921 Ga0207652_10081439 Ga0207652_100814392 271
329 3300025924 Ga0207694_10105505 Ga0207694_101055052 271
330 3300025924 Ga0207694_10326616 Ga0207694_103266162 271
331 3300025944 Ga0207661_10154297 Ga0207661_101542972 271
332 3300025949 Ga0207667_10030061 Ga0207667_100300612 271
333 3300025949 Ga0207667_10047575 Ga0207667_100475753 271
334 3300025949 Ga0207667_10072390 Ga0207667_100723902 271
335 3300025949 Ga0207667_10255754 Ga0207667_102557542 271
336 3300025949 Ga0207667_10283572 Ga0207667_102835721 271
337 3300026041 Ga0207639_10012051 Ga0207639_100120517 271
338 3300026041 Ga0207639_10235362 Ga0207639_102353622 271
339 3300026041 Ga0207639_10583736 Ga0207639_105837361 271
340 3300026078 Ga0207702_10051936 Ga0207702_100519365 271
341 3300026116 Ga0207674_10107284 Ga0207674_101072844 271
342 3300026116 Ga0207674_10116921 Ga0207674_101169212 271
343 3300026142 Ga0207698_10027286 Ga0207698_100272862 271
344 3300037418 Ga0395900_0562663 Ga0395900_0562663_78_923 271
345 3300060344 Ga0587071_009869 Ga0587071_009869_391_1398 271
346 3300003323 rootH1_10281574 rootH1_102815742 272
347 3300005548 Ga0070665_100001969 Ga0070665_10000196922 272
348 3300020069 Ga0197907_10605526 Ga0197907_106055262 272
349 3300020075 Ga0206349_1038407 Ga0206349_10384071 272
350 3300022467 Ga0224712_10013805 Ga0224712_100138052 272
351 3300028379 Ga0268266_10027617 Ga0268266_100276175 272

Structural Annotation

Top 5 Hits

ID Description Score Start End
3akj-assembly1.cif.gz_A crystal structure of a helicobacter pylori proinflammatory kinase ctka 0.5052 23 54
6ewv-assembly1.cif.gz_A solution structure of docking domain complex of rxp nrps: kj12c ndd - kj12b cdd 0.4659 28 45
1eue-assembly2.cif.gz_B rat outer mitochondrial membrane cytochrome b5 0.4203 18 39
6gjh-assembly1.cif.gz_A human hsp27 (hspb1) alpha-crystallin domain in complex with a peptide mimic of its phosphorylatable n-terminal region 0.3825 21 49
7o3h-assembly1.cif.gz_P murine ciii2 focus-refined from supercomplex ciciii2 0.3781 2 53
ID Description Score Start End Superfamily
af_Q9LU90_53_414_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.6354 27 45 2.120.10.30
af_A0A1D6HCR7_100_169_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.6027 25 55 3.30.200.20
af_Q54GE1_34_326_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.5742 25 41 3.20.20.80
af_O62280_7_321_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5712 28 41 1.20.1070.10
af_Q1L8U8_722_786_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.5351 24 45 2.30.30.140
ID Description Score Start End GO Terms
AF-A0A2V8VVU7-F1-model_v4 Uncharacterized protein 0.8598 78 272
AF-A0A2V8X4Y4-F1-model_v4 Uncharacterized protein 0.8595 78 272
AF-A0A2V9BRS2-F1-model_v4 Uncharacterized protein 0.8139 20 272
AF-A0A522RZR6-F1-model_v4 Uncharacterized protein 0.8072 24 272
AF-A0A368KGB1-F1-model_v4 Uncharacterized protein 0.7997 24 272

Feature Viewer

pLDDT pTM Quality
74.14 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map