F418644

General Info

Members Datasets Scaffolds Average Seq Length
351 210 702 107

Family's Representative Sequence

Representative Sequence 3300015261|Ga0182006_1000002|Ga0182006_1000002785
Length 118
Sequence MAGTTLPPREKKMAWIILVLAGLLEIGWAIGLKYSAGFTRLVPSVLTAVSMLGSVVMLGLALRTLPLGTAYAIWTGIGTVGTAIFGIMVLGEPASAARIACIALIVSGILGLKLLSPQ

Samples

Sample ID Description Type Environment
1 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
47 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
81 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
84 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
85 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
88 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
91 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
92 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
93 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
94 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
101 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
102 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
103 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
108 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
109 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
110 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
111 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
112 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
119 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
120 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
121 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
125 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
126 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
130 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
131 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
132 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
133 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
134 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
158 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
159 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
169 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
170 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
171 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
174 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
178 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
185 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
186 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
187 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
188 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
189 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
190 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
191 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
192 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
193 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
196 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
197 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
198 2643221638 Duganella sp. Root336D2 Isolate Unclassified
199 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
200 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
201 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
202 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
203 2857558681 Duganella sp. R-74565 Isolate Unclassified
204 2857564685 Duganella sp. R-74599 Isolate Unclassified
205 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
206 2919476304 Duganella sp. 3397 Isolate Unclassified
207 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
208 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
209 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
210 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.16
Metatranscriptomes 0.57
Isolates 4.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.37
Nodule 0.28
Rhizoplane 4.27
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 3.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182006_1000002 3300015261 Bacteria 887990
2 JGI25150J39212_1000571 3300002774 Bacteria 14701
3 JGI25159J45721_1004574 3300002987 Unclassified 4551
4 JGI25153J46596_10005856 3300003215 Bacteria 6369
5 JGI25161J50226_1000182 3300003374 Bacteria 42010
6 Ga0055529_1000068 3300003763 Bacteria 163911
7 Ga0055526_1000013 3300003771 Bacteria 233580
8 Ga0055526_1000934 3300003771 Bacteria 21684
9 Ga0055526_1005682 3300003771 Bacteria 7080
10 Ga0055537_1000039 3300003773 Bacteria 92151
11 Ga0055537_1002487 3300003773 Bacteria 6146
12 Ga0055524_1004427 3300003775 Bacteria 6483
13 Ga0055524_1007872 3300003775 Unclassified 4480
14 Ga0055534_1000174 3300003784 Bacteria 47983
15 Ga0055534_1001797 3300003784 Bacteria 8068
16 Ga0055528_1000066 3300003790 Bacteria 84724
17 Ga0055530_10010604 3300003791 Unclassified 3386
18 Ga0055530_10024830 3300003791 Unclassified 1688
19 Ga0055530_10024978 3300003791 Unclassified 1679
20 Ga0055531_10005354 3300003794 Bacteria 7522
21 Ga0055543_1000112 3300004625 Bacteria 69589
22 Ga0055543_1020853 3300004625 Bacteria 1199
23 Ga0055543_1020856 3300004625 Bacteria 1199
24 Ga0065165_1001216 3300005262 Bacteria 29672
25 Ga0065165_1047977 3300005262 Bacteria 1229
26 Ga0065712_10335750 3300005290 Bacteria 807
27 Ga0070683_100145245 3300005329 Bacteria 2248
28 Ga0070666_10762858 3300005335 Unclassified 711
29 Ga0070671_100578118 3300005355 Unclassified 970
30 Ga0070673_100181644 3300005364 Bacteria 1801
31 Ga0070667_100099977 3300005367 Unclassified 2504
32 Ga0070663_101799628 3300005455 Bacteria 549
33 Ga0070681_10199112 3300005458 Bacteria 1921
34 Ga0070681_10952578 3300005458 Bacteria 777
35 Ga0070681_11595831 3300005458 Bacteria 578
36 Ga0068867_100135593 3300005459 Bacteria 1918
37 Ga0070685_10287057 3300005466 Bacteria 1104
38 Ga0070685_10597479 3300005466 Bacteria 794
39 Ga0070684_100201566 3300005535 Bacteria 1812
40 Ga0070672_100467949 3300005543 Bacteria 1087
41 Ga0070672_101463825 3300005543 Bacteria 612
42 Ga0070702_100146066 3300005615 Bacteria 1512
43 Ga0068860_102517373 3300005843 Unclassified 534
44 Ga0081455_10281150 3300005937 Bacteria 1202
45 Ga0070717_10025687 3300006028 Bacteria 4689
46 Ga0075363_100034283 3300006048 Bacteria 2649
47 Ga0075362_10126751 3300006177 Bacteria 1212
48 Ga0075367_10311787 3300006178 Bacteria 991
49 Ga0075366_10083307 3300006195 Bacteria 1911
50 Ga0075370_10014834 3300006353 Bacteria 4162
51 Ga0075370_10635959 3300006353 Bacteria 647
52 Ga0075428_100460398 3300006844 Bacteria 1362
53 Ga0105244_10002659 3300009036 Bacteria 13391
54 Ga0157370_10559386 3300013104 Bacteria 1048
55 Ga0182008_10004711 3300014497 Bacteria 7910
56 Ga0182008_10223553 3300014497 Bacteria 964
57 Ga0182007_10000997 3300015262 Bacteria 15535
58 Ga0182005_1000002 3300015265 Bacteria 908499
59 Ga0163161_10088590 3300017792 Bacteria 2288
60 Ga0163161_10436269 3300017792 Bacteria 1056
61 Ga0209436_100484 3300025208 Bacteria 17563
62 Ga0209436_113303 3300025208 Bacteria 1351
63 Ga0209436_113304 3300025208 Bacteria 1351
64 Ga0207425_1000001 3300025245 Bacteria 2525432
65 Ga0207425_1000130 3300025245 Bacteria 70791
66 Ga0209129_1000003 3300025258 Bacteria 903689
67 Ga0209565_1000003 3300025263 Bacteria 1099648
68 Ga0209565_1012852 3300025263 Bacteria 1982
69 Ga0209455_1000026 3300025272 Bacteria 653778
70 Ga0209673_1000003 3300025273 Bacteria 980859
71 Ga0209130_1000237 3300025284 Bacteria 70739
72 Ga0209130_1021306 3300025284 Bacteria 1465
73 Ga0209130_1021309 3300025284 Bacteria 1465
74 Ga0209675_1000003 3300025291 Bacteria 1003982
75 Ga0209675_1006952 3300025291 Bacteria 4438
76 Ga0209564_1000002 3300025295 Bacteria 1636803
77 Ga0209564_1000012 3300025295 Bacteria 792078
78 Ga0209564_1000311 3300025295 Bacteria 95587
79 Ga0209564_1007930 3300025295 Bacteria 5355
80 Ga0209758_1000041 3300025297 Bacteria 410328
81 Ga0209050_1000011 3300025298 Bacteria 914037
82 Ga0209050_1000164 3300025298 Bacteria 154628
83 Ga0209050_1000664 3300025298 Bacteria 52795
84 Ga0209256_1000068 3300025299 Bacteria 246064
85 Ga0209256_1000395 3300025299 Bacteria 69343
86 Ga0209256_1000952 3300025299 Bacteria 35118
87 Ga0207426_1011742 3300025302 Bacteria 3318
88 Ga0207426_1052226 3300025302 Bacteria 1211
89 Ga0209257_1000003 3300025304 Bacteria 1702593
90 Ga0207655_1004019 3300025728 Bacteria 10620
91 Ga0207680_10721131 3300025903 Unclassified 715
92 Ga0207707_10234438 3300025912 Bacteria 1597
93 Ga0207644_10733054 3300025931 Unclassified 825
94 Ga0207670_10082466 3300025936 Bacteria 2254
95 Ga0207691_10247611 3300025940 Bacteria 1539
96 Ga0207711_11158629 3300025941 Bacteria 714
97 Ga0207661_10184642 3300025944 Bacteria 1824
98 Ga0207658_10093881 3300025986 Unclassified 2334
99 Ga0207678_10188256 3300026067 Bacteria 1763
100 Ga0207648_10358875 3300026089 Bacteria 1315
101 Ga0207683_10587393 3300026121 Bacteria 1030
102 Ga0307515_10090578 3300028794 Bacteria 3834
103 Ga0316181_1031340 3300030744 Bacteria 1631
104 Ga0307408_100001185 3300031548 Bacteria 19736
105 Ga0307408_100184087 3300031548 Bacteria 1677
106 Ga0307408_100261349 3300031548 Bacteria 1433
107 Ga0307516_10135284 3300031730 Bacteria 2240
108 Ga0307409_101900596 3300031995 Bacteria 625
109 Ga0307414_10003286 3300032004 Bacteria 8617
110 Ga0307414_12221909 3300032004 Bacteria 512
111 Ga0307415_102188441 3300032126 Bacteria 541
112 Ga0373931_0704864 3300035691 Bacteria 667
113 Ga0395900_0475656 3300037418 Bacteria 1202
114 Ga0395905_0265352 3300037471 Bacteria 1602
115 Ga0395905_1309508 3300037471 Bacteria 628
116 Ga0451847_0669870 3300041503 Bacteria 1046
117 Ga0439446_0331958 3300042156 Bacteria 539
118 Ga0451577_0057226 3300042876 Bacteria 3476
119 Ga0466971_0059650 3300044719 Bacteria 1724
120 Ga0495617_000042 3300046452 Bacteria 122225
121 Ga0495627_017646 3300046453 Bacteria 2421
122 Ga0495627_232972 3300046453 Bacteria 505
123 Ga0495603_0038096 3300046455 Bacteria 2884
124 Ga0495590_0000010 3300046457 Bacteria 317890
125 Ga0495638_0000027 3300046460 Bacteria 337569
126 Ga0495638_0056006 3300046460 Bacteria 2447
127 Ga0495638_0088249 3300046460 Bacteria 1872
128 Ga0495638_0140383 3300046460 Bacteria 1411
129 Ga0495638_0297117 3300046460 Bacteria 871
130 Ga0495653_0000010 3300046463 Bacteria 274131
131 Ga0495653_0266060 3300046463 Bacteria 1131
132 Ga0495650_0000044 3300046471 Bacteria 355139
133 Ga0495650_0001268 3300046471 Bacteria 26031
134 Ga0495650_0003132 3300046471 Bacteria 12383
135 Ga0495650_0041517 3300046471 Bacteria 1966
136 Ga0495605_0051362 3300046474 Bacteria 2008
137 Ga0495605_0075369 3300046474 Bacteria 1586
138 Ga0495605_0146986 3300046474 Bacteria 1054
139 Ga0495639_0013547 3300046475 Bacteria 3524
140 Ga0495584_0010996 3300046491 Bacteria 4642
141 Ga0495585_0000385 3300046492 Bacteria 42521
142 Ga0495585_0002878 3300046492 Bacteria 11968
143 Ga0495585_0031031 3300046492 Bacteria 3037
144 Ga0495594_0043228 3300046499 Bacteria 2469
145 Ga0495594_0047585 3300046499 Bacteria 2355
146 Ga0495596_0011429 3300046500 Bacteria 3832
147 Ga0495607_0005509 3300046501 Bacteria 9041
148 Ga0495607_0381892 3300046501 Bacteria 644
149 Ga0495583_0000006 3300046506 Bacteria 436893
150 Ga0495583_0005813 3300046506 Bacteria 8238
151 Ga0495606_0000015 3300046507 Bacteria 288808
152 Ga0495606_0000128 3300046507 Bacteria 128179
153 Ga0495606_0000557 3300046507 Bacteria 59505
154 Ga0495606_0004948 3300046507 Bacteria 13007
155 Ga0495606_0005861 3300046507 Bacteria 11582
156 Ga0495610_0000008 3300046512 Bacteria 622732
157 Ga0495610_0002638 3300046512 Bacteria 14832
158 Ga0495610_0005058 3300046512 Bacteria 9508
159 Ga0495610_0009097 3300046512 Bacteria 6328
160 Ga0495610_0017960 3300046512 Bacteria 4012
161 Ga0495610_0028272 3300046512 Bacteria 2967
162 Ga0495616_0000075 3300046513 Bacteria 84686
163 Ga0495616_0140510 3300046513 Bacteria 1099
164 Ga0495620_0283655 3300046515 Bacteria 630
165 Ga0495631_0007084 3300046518 Bacteria 5733
166 Ga0495632_0000091 3300046519 Bacteria 93600
167 Ga0495632_0000358 3300046519 Bacteria 43419
168 Ga0495632_0018197 3300046519 Bacteria 3860
169 Ga0495637_0058931 3300046520 Bacteria 1581
170 Ga0495643_0000022 3300046522 Bacteria 289691
171 Ga0495643_0000326 3300046522 Bacteria 65454
172 Ga0495643_0041640 3300046522 Bacteria 2504
173 Ga0495643_0202819 3300046522 Bacteria 951
174 Ga0495644_0015893 3300046523 Bacteria 2884
175 Ga0495648_0000078 3300046524 Bacteria 127397
176 Ga0495648_0002119 3300046524 Bacteria 18687
177 Ga0495648_0021870 3300046524 Bacteria 4417
178 Ga0495648_0063607 3300046524 Bacteria 2177
179 Ga0495648_0147118 3300046524 Bacteria 1233
180 Ga0495642_0000326 3300046528 Bacteria 26021
181 Ga0495642_0000919 3300046528 Bacteria 13828
182 Ga0495642_0051200 3300046528 Bacteria 1698
183 Ga0495642_0213901 3300046528 Bacteria 841
184 Ga0495654_0008449 3300046530 Bacteria 5686
185 Ga0495654_0032205 3300046530 Bacteria 2658
186 Ga0495654_0152652 3300046530 Bacteria 1020
187 Ga0495654_0164293 3300046530 Bacteria 972
188 Ga0495609_0005651 3300046538 Bacteria 6517
189 Ga0495609_0055969 3300046538 Bacteria 1748
190 Ga0495609_0078055 3300046538 Bacteria 1449
191 Ga0495609_0097344 3300046538 Bacteria 1276
192 Ga0495609_0161904 3300046538 Bacteria 948
193 Ga0495609_0167411 3300046538 Bacteria 929
194 Ga0495609_0433476 3300046538 Bacteria 523
195 Ga0495597_0000107 3300046542 Bacteria 73749
196 Ga0495597_0003370 3300046542 Bacteria 9381
197 Ga0495622_0000009 3300046557 Bacteria 224622
198 Ga0495622_0000043 3300046557 Bacteria 115796
199 Ga0495633_0000381 3300046558 Bacteria 47007
200 Ga0495633_0001071 3300046558 Bacteria 22118
201 Ga0495633_0006010 3300046558 Bacteria 7293
202 Ga0495633_0502939 3300046558 Bacteria 546
203 Ga0495668_0000006 3300046616 Bacteria 553404
204 Ga0495668_0000096 3300046616 Bacteria 139693
205 Ga0495668_0000180 3300046616 Bacteria 94157
206 Ga0495668_0008581 3300046616 Bacteria 6359
207 Ga0495611_0006210 3300046648 Bacteria 5099
208 Ga0495625_0000053 3300046660 Bacteria 190575
209 Ga0495625_0054292 3300046660 Bacteria 2862
210 Ga0495625_0155583 3300046660 Bacteria 1534
211 Ga0495625_0170284 3300046660 Bacteria 1454
212 Ga0495625_0206796 3300046660 Bacteria 1292
213 Ga0495625_0504487 3300046660 Bacteria 739
214 Ga0495659_0042167 3300046664 Bacteria 1633
215 Ga0495661_0002718 3300046665 Bacteria 13479
216 Ga0495661_0008008 3300046665 Bacteria 7338
217 Ga0495661_0022504 3300046665 Bacteria 4100
218 Ga0495661_0065431 3300046665 Bacteria 2142
219 Ga0495661_0158628 3300046665 Bacteria 1216
220 Ga0495661_0549881 3300046665 Bacteria 546
221 Ga0495588_0073443 3300046674 Bacteria 1781
222 Ga0495588_0136377 3300046674 Bacteria 1295
223 Ga0495669_0001637 3300046684 Bacteria 9209
224 Ga0495669_0005964 3300046684 Bacteria 5081
225 Ga0495670_0019226 3300046691 Bacteria 3366
226 Ga0495670_0036802 3300046691 Bacteria 2439
227 Ga0495671_0000002 3300046692 Bacteria 1136189
228 Ga0495671_0002321 3300046692 Bacteria 12087
229 Ga0495671_0355952 3300046692 Bacteria 702
230 Ga0495649_0002789 3300046694 Bacteria 12166
231 Ga0495649_0052270 3300046694 Bacteria 2214
232 Ga0495589_0007782 3300046794 Bacteria 5609
233 Ga0495589_0315466 3300046794 Bacteria 723
234 Ga0495660_0006110 3300046810 Bacteria 7148
235 Ga0495660_0018729 3300046810 Bacteria 3976
236 Ga0495660_0025019 3300046810 Bacteria 3393
237 Ga0495660_0032576 3300046810 Bacteria 2926
238 Ga0495636_0159253 3300047318 Bacteria 1016
239 Ga0495672_0000022 3300047320 Bacteria 420632
240 Ga0495672_0000095 3300047320 Bacteria 143883
241 Ga0495672_0025362 3300047320 Bacteria 3796
242 Ga0495683_0184962 3300047323 Bacteria 949
243 Ga0495683_0253959 3300047323 Bacteria 770
244 Ga0495687_001158 3300047443 Bacteria 25533
245 Ga0495677_0011748 3300047445 Bacteria 3201
246 Ga0495679_006944 3300047446 Bacteria 4797
247 Ga0495679_009799 3300047446 Bacteria 3806
248 Ga0495673_0000059 3300047469 Bacteria 233234
249 Ga0495681_0041047 3300047470 Bacteria 2249
250 Ga0495686_0000135 3300047472 Bacteria 148920
251 Ga0495686_0049058 3300047472 Bacteria 2658
252 Ga0495686_0403477 3300047472 Bacteria 733
253 Ga0495602_0157786 3300048088 Bacteria 1775
254 Ga0495626_0019889 3300048091 Bacteria 3350
255 Ga0495626_0041310 3300048091 Bacteria 2173
256 Ga0496100_0053112 3300048903 Bacteria 2638
257 Ga0496100_0648137 3300048903 Bacteria 822
258 Ga0496101_0511366 3300048904 Bacteria 949
259 Ga0496102_0000151 3300048905 Bacteria 94403
260 Ga0496102_0152690 3300048905 Bacteria 2170
261 Ga0496102_0825528 3300048905 Bacteria 849
262 Ga0496103_0137005 3300048906 Bacteria 1564
263 Ga0496105_0789407 3300048908 Bacteria 723
264 Ga0496106_0522057 3300048909 Bacteria 954
265 Ga0496107_0991640 3300048910 Bacteria 610
266 Ga0496107_1376649 3300048910 Bacteria 503
267 Ga0496111_0154702 3300048914 Bacteria 1701
268 Ga0496114_0112409 3300048917 Bacteria 2334
269 Ga0496116_0015645 3300048919 Bacteria 5989
270 Ga0496117_0000001 3300048920 Bacteria 2526244
271 Ga0496118_0000002 3300048921 Bacteria 1690764
272 Ga0496121_0007795 3300048924 Bacteria 12820
273 Ga0496121_0011077 3300048924 Bacteria 10062
274 Ga0496121_0281271 3300048924 Bacteria 1138
275 Ga0496121_0335220 3300048924 Bacteria 1013
276 Ga0496122_0013372 3300048925 Bacteria 8035
277 Ga0496123_0065455 3300048926 Bacteria 2310
278 Ga0496124_0065386 3300048927 Bacteria 3033
279 Ga0496124_0117641 3300048927 Bacteria 2129
280 Ga0496124_0376507 3300048927 Bacteria 994
281 Ga0496125_0034021 3300048928 Bacteria 4498
282 Ga0496126_0030419 3300048929 Bacteria 5115
283 Ga0496126_0561794 3300048929 Bacteria 904
284 Ga0501310_032708 3300049130 Bacteria 697
285 Ga0495678_000588 3300049459 Bacteria 34196
286 Ga0495678_008805 3300049459 Bacteria 5052
287 Ga0495678_026830 3300049459 Bacteria 2451
288 Ga0495678_089842 3300049459 Bacteria 1084
289 Ga0495682_0002199 3300049460 Bacteria 9440
290 Ga0495682_0012517 3300049460 Bacteria 3250
291 Ga0501315_047297 3300049531 Bacteria 667
292 Ga0501034_0115057 3300049571 Bacteria 2678
293 Ga0501034_0905848 3300049571 Bacteria 769
294 Ga0501043_0392976 3300049579 Bacteria 1049
295 Ga0501047_0237709 3300049581 Bacteria 1673
296 Ga0501047_1442756 3300049581 Bacteria 504
297 Ga0501069_0006611 3300049585 Bacteria 6065
298 Ga0501069_0081182 3300049585 Bacteria 1826
299 Ga0501070_0066972 3300049586 Bacteria 2974
300 Ga0501070_0305092 3300049586 Bacteria 1296
301 Ga0501072_0105600 3300049588 Bacteria 2240
302 Ga0501072_0738360 3300049588 Bacteria 773
303 Ga0501073_0026046 3300049589 Bacteria 4191
304 Ga0501073_0243295 3300049589 Bacteria 1242
305 Ga0501074_0137688 3300049590 Bacteria 1747
306 Ga0501227_002037 3300049665 Bacteria 4484
307 Ga0501227_126637 3300049665 Bacteria 693
308 Ga0501238_058149 3300049671 Bacteria 587
309 Ga0501249_001440 3300049679 Bacteria 4903
310 Ga0501253_154028 3300049683 Bacteria 581
311 Ga0501080_0312477 3300049742 Bacteria 1424
312 Ga0501269_000423 3300049766 Bacteria 9533
313 Ga0501279_003529 3300049775 Bacteria 2040
314 Ga0501044_0233672 3300049823 Bacteria 1785
315 Ga0501044_0314871 3300049823 Bacteria 1491
316 Ga0501045_0146284 3300049824 Bacteria 1758
317 nmdc:mga03683_423843_c1 3300050489 Bacteria 638
318 nmdc:mga03n38_26634_c1 3300050490 Bacteria 2389
319 nmdc:mga03n38_43881_c1 3300050490 Bacteria 1961
320 nmdc:mga00v17_201919_c1 3300050491 Bacteria 1285
321 nmdc:mga0k408_154479_c1 3300050493 Bacteria 1367
322 nmdc:mga06z11_263359_c1 3300050494 Bacteria 1018
323 nmdc:mga07m45_44851_c1 3300050496 Bacteria 2482
324 nmdc:mga06r32_1074360_c1 3300050510 Bacteria 755
325 nmdc:mga0sz30_385713_c1 3300050516 Bacteria 627
326 Ga0500635_0000574 3300053080 Bacteria 9762
327 Ga0500651_0000088 3300053093 Bacteria 59179
328 Ga0500641_0441621 3300053096 Bacteria 503
329 Ga0500608_000123 3300053122 Bacteria 32276
330 Ga0500618_009677 3300053125 Bacteria 2622
331 Ga0500577_0146858 3300053142 Bacteria 998
332 Ga0500586_000227 3300053145 Bacteria 11155
333 Ga0500622_0092247 3300053156 Bacteria 1501
334 Ga0590071_049280 3300059421 Bacteria 1020
335 Ga0590077_123153 3300059426 Bacteria 614
336 Ga0466962_0032130 3300061719 Bacteria 2513
337 2599333494 2599185156 Bacteria 5403036
338 2601667868 2600255292 Bacteria 6300551
339 2644212110 2643221638 Bacteria 6579467
340 2688067810 2687453257 Bacteria 6784659
341 2842340832 2842333319 Bacteria 8899485
342 2842925098 2842922631 Bacteria 5824079
343 2857550099 2857547612 Bacteria 6179999
344 2857564516 2857558681 Bacteria 6617694
345 2857568747 2857564685 Bacteria 6290584
346 2885084753 2885080285 Bacteria 6355622
347 2919480200 2919476304 Bacteria 5888696
348 2932411484 2932410948 Bacteria 6312192
349 2932418949 2932416698 Bacteria 6315112
350 2937846774 2937843397 Bacteria 5256375
351 3000137330 3000135777 Bacteria 6891109
352 Ga0182006_1000002
353 JGI25150J39212_1000571
354 JGI25159J45721_1004574
355 JGI25153J46596_10005856
356 JGI25161J50226_1000182
357 Ga0055529_1000068
358 Ga0055526_1000013
359 Ga0055526_1000934
360 Ga0055526_1005682
361 Ga0055537_1000039
362 Ga0055537_1002487
363 Ga0055524_1004427
364 Ga0055524_1007872
365 Ga0055534_1000174
366 Ga0055534_1001797
367 Ga0055528_1000066
368 Ga0055530_10010604
369 Ga0055530_10024830
370 Ga0055530_10024978
371 Ga0055531_10005354
372 Ga0055543_1000112
373 Ga0055543_1020853
374 Ga0055543_1020856
375 Ga0065165_1001216
376 Ga0065165_1047977
377 Ga0065712_10335750
378 Ga0070683_100145245
379 Ga0070666_10762858
380 Ga0070671_100578118
381 Ga0070673_100181644
382 Ga0070667_100099977
383 Ga0070663_101799628
384 Ga0070681_10199112
385 Ga0070681_10952578
386 Ga0070681_11595831
387 Ga0068867_100135593
388 Ga0070685_10287057
389 Ga0070685_10597479
390 Ga0070684_100201566
391 Ga0070672_100467949
392 Ga0070672_101463825
393 Ga0070702_100146066
394 Ga0068860_102517373
395 Ga0081455_10281150
396 Ga0070717_10025687
397 Ga0075363_100034283
398 Ga0075362_10126751
399 Ga0075367_10311787
400 Ga0075366_10083307
401 Ga0075370_10014834
402 Ga0075370_10635959
403 Ga0075428_100460398
404 Ga0105244_10002659
405 Ga0157370_10559386
406 Ga0182008_10004711
407 Ga0182008_10223553
408 Ga0182007_10000997
409 Ga0182005_1000002
410 Ga0163161_10088590
411 Ga0163161_10436269
412 Ga0209436_100484
413 Ga0209436_113303
414 Ga0209436_113304
415 Ga0207425_1000001
416 Ga0207425_1000130
417 Ga0209129_1000003
418 Ga0209565_1000003
419 Ga0209565_1012852
420 Ga0209455_1000026
421 Ga0209673_1000003
422 Ga0209130_1000237
423 Ga0209130_1021306
424 Ga0209130_1021309
425 Ga0209675_1000003
426 Ga0209675_1006952
427 Ga0209564_1000002
428 Ga0209564_1000012
429 Ga0209564_1000311
430 Ga0209564_1007930
431 Ga0209758_1000041
432 Ga0209050_1000011
433 Ga0209050_1000164
434 Ga0209050_1000664
435 Ga0209256_1000068
436 Ga0209256_1000395
437 Ga0209256_1000952
438 Ga0207426_1011742
439 Ga0207426_1052226
440 Ga0209257_1000003
441 Ga0207655_1004019
442 Ga0207680_10721131
443 Ga0207707_10234438
444 Ga0207644_10733054
445 Ga0207670_10082466
446 Ga0207691_10247611
447 Ga0207711_11158629
448 Ga0207661_10184642
449 Ga0207658_10093881
450 Ga0207678_10188256
451 Ga0207648_10358875
452 Ga0207683_10587393
453 Ga0307515_10090578
454 Ga0316181_1031340
455 Ga0307408_100001185
456 Ga0307408_100184087
457 Ga0307408_100261349
458 Ga0307516_10135284
459 Ga0307409_101900596
460 Ga0307414_10003286
461 Ga0307414_12221909
462 Ga0307415_102188441
463 Ga0373931_0704864
464 Ga0395900_0475656
465 Ga0395905_0265352
466 Ga0395905_1309508
467 Ga0451847_0669870
468 Ga0439446_0331958
469 Ga0451577_0057226
470 Ga0466971_0059650
471 Ga0495617_000042
472 Ga0495627_017646
473 Ga0495627_232972
474 Ga0495603_0038096
475 Ga0495590_0000010
476 Ga0495638_0000027
477 Ga0495638_0056006
478 Ga0495638_0088249
479 Ga0495638_0140383
480 Ga0495638_0297117
481 Ga0495653_0000010
482 Ga0495653_0266060
483 Ga0495650_0000044
484 Ga0495650_0001268
485 Ga0495650_0003132
486 Ga0495650_0041517
487 Ga0495605_0051362
488 Ga0495605_0075369
489 Ga0495605_0146986
490 Ga0495639_0013547
491 Ga0495584_0010996
492 Ga0495585_0000385
493 Ga0495585_0002878
494 Ga0495585_0031031
495 Ga0495594_0043228
496 Ga0495594_0047585
497 Ga0495596_0011429
498 Ga0495607_0005509
499 Ga0495607_0381892
500 Ga0495583_0000006
501 Ga0495583_0005813
502 Ga0495606_0000015
503 Ga0495606_0000128
504 Ga0495606_0000557
505 Ga0495606_0004948
506 Ga0495606_0005861
507 Ga0495610_0000008
508 Ga0495610_0002638
509 Ga0495610_0005058
510 Ga0495610_0009097
511 Ga0495610_0017960
512 Ga0495610_0028272
513 Ga0495616_0000075
514 Ga0495616_0140510
515 Ga0495620_0283655
516 Ga0495631_0007084
517 Ga0495632_0000091
518 Ga0495632_0000358
519 Ga0495632_0018197
520 Ga0495637_0058931
521 Ga0495643_0000022
522 Ga0495643_0000326
523 Ga0495643_0041640
524 Ga0495643_0202819
525 Ga0495644_0015893
526 Ga0495648_0000078
527 Ga0495648_0002119
528 Ga0495648_0021870
529 Ga0495648_0063607
530 Ga0495648_0147118
531 Ga0495642_0000326
532 Ga0495642_0000919
533 Ga0495642_0051200
534 Ga0495642_0213901
535 Ga0495654_0008449
536 Ga0495654_0032205
537 Ga0495654_0152652
538 Ga0495654_0164293
539 Ga0495609_0005651
540 Ga0495609_0055969
541 Ga0495609_0078055
542 Ga0495609_0097344
543 Ga0495609_0161904
544 Ga0495609_0167411
545 Ga0495609_0433476
546 Ga0495597_0000107
547 Ga0495597_0003370
548 Ga0495622_0000009
549 Ga0495622_0000043
550 Ga0495633_0000381
551 Ga0495633_0001071
552 Ga0495633_0006010
553 Ga0495633_0502939
554 Ga0495668_0000006
555 Ga0495668_0000096
556 Ga0495668_0000180
557 Ga0495668_0008581
558 Ga0495611_0006210
559 Ga0495625_0000053
560 Ga0495625_0054292
561 Ga0495625_0155583
562 Ga0495625_0170284
563 Ga0495625_0206796
564 Ga0495625_0504487
565 Ga0495659_0042167
566 Ga0495661_0002718
567 Ga0495661_0008008
568 Ga0495661_0022504
569 Ga0495661_0065431
570 Ga0495661_0158628
571 Ga0495661_0549881
572 Ga0495588_0073443
573 Ga0495588_0136377
574 Ga0495669_0001637
575 Ga0495669_0005964
576 Ga0495670_0019226
577 Ga0495670_0036802
578 Ga0495671_0000002
579 Ga0495671_0002321
580 Ga0495671_0355952
581 Ga0495649_0002789
582 Ga0495649_0052270
583 Ga0495589_0007782
584 Ga0495589_0315466
585 Ga0495660_0006110
586 Ga0495660_0018729
587 Ga0495660_0025019
588 Ga0495660_0032576
589 Ga0495636_0159253
590 Ga0495672_0000022
591 Ga0495672_0000095
592 Ga0495672_0025362
593 Ga0495683_0184962
594 Ga0495683_0253959
595 Ga0495687_001158
596 Ga0495677_0011748
597 Ga0495679_006944
598 Ga0495679_009799
599 Ga0495673_0000059
600 Ga0495681_0041047
601 Ga0495686_0000135
602 Ga0495686_0049058
603 Ga0495686_0403477
604 Ga0495602_0157786
605 Ga0495626_0019889
606 Ga0495626_0041310
607 Ga0496100_0053112
608 Ga0496100_0648137
609 Ga0496101_0511366
610 Ga0496102_0000151
611 Ga0496102_0152690
612 Ga0496102_0825528
613 Ga0496103_0137005
614 Ga0496105_0789407
615 Ga0496106_0522057
616 Ga0496107_0991640
617 Ga0496107_1376649
618 Ga0496111_0154702
619 Ga0496114_0112409
620 Ga0496116_0015645
621 Ga0496117_0000001
622 Ga0496118_0000002
623 Ga0496121_0007795
624 Ga0496121_0011077
625 Ga0496121_0281271
626 Ga0496121_0335220
627 Ga0496122_0013372
628 Ga0496123_0065455
629 Ga0496124_0065386
630 Ga0496124_0117641
631 Ga0496124_0376507
632 Ga0496125_0034021
633 Ga0496126_0030419
634 Ga0496126_0561794
635 Ga0501310_032708
636 Ga0495678_000588
637 Ga0495678_008805
638 Ga0495678_026830
639 Ga0495678_089842
640 Ga0495682_0002199
641 Ga0495682_0012517
642 Ga0501315_047297
643 Ga0501034_0115057
644 Ga0501034_0905848
645 Ga0501043_0392976
646 Ga0501047_0237709
647 Ga0501047_1442756
648 Ga0501069_0006611
649 Ga0501069_0081182
650 Ga0501070_0066972
651 Ga0501070_0305092
652 Ga0501072_0105600
653 Ga0501072_0738360
654 Ga0501073_0026046
655 Ga0501073_0243295
656 Ga0501074_0137688
657 Ga0501227_002037
658 Ga0501227_126637
659 Ga0501238_058149
660 Ga0501249_001440
661 Ga0501253_154028
662 Ga0501080_0312477
663 Ga0501269_000423
664 Ga0501279_003529
665 Ga0501044_0233672
666 Ga0501044_0314871
667 Ga0501045_0146284
668 nmdc:mga03683_423843_c1
669 nmdc:mga03n38_26634_c1
670 nmdc:mga03n38_43881_c1
671 nmdc:mga00v17_201919_c1
672 nmdc:mga0k408_154479_c1
673 nmdc:mga06z11_263359_c1
674 nmdc:mga07m45_44851_c1
675 nmdc:mga06r32_1074360_c1
676 nmdc:mga0sz30_385713_c1
677 Ga0500635_0000574
678 Ga0500651_0000088
679 Ga0500641_0441621
680 Ga0500608_000123
681 Ga0500618_009677
682 Ga0500577_0146858
683 Ga0500586_000227
684 Ga0500622_0092247
685 Ga0590071_049280
686 Ga0590077_123153
687 Ga0466962_0032130
688 2599333494
689 2601667868
690 2644212110
691 2688067810
692 2842340832
693 2842925098
694 2857550099
695 2857564516
696 2857568747
697 2885084753
698 2919480200
699 2932411484
700 2932418949
701 2937846774
702 3000137330

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00893

Multi_Drug_Res

Small Multidrug Resistance protein

13

105

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.8932 8 110
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.8771 8 110
7ssu-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.8557 8 101
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.8312 8 104
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.8287 8 110
ID Description Score Start End Superfamily
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9794 9 108 1.10.3730.20
af_P69210_8_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9564 11 108 1.10.3730.20
af_P23895_1_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9416 8 112 1.10.3730.20
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.937 8 112 1.10.3730.20
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9249 9 108 1.10.3730.20
ID Description Score Start End GO Terms
AF-W6RB08-F1-model_v4 Guanidinium exporter 0.9908 4 107 GO:0005886
GO:0022857
AF-A0A1H8E1J1-F1-model_v4 Guanidinium exporter 0.9905 8 108 GO:0005886
GO:0022857
AF-A0A1Z8M630-F1-model_v4 QacE family quaternary ammonium compound efflux SMR transporter 0.9886 8 111 GO:0005886
GO:0022857
AF-A0A7S6MCV9-F1-model_v4 Multidrug efflux SMR transporter 0.9882 8 112 GO:0005886
GO:0022857
AF-A0A1H3KKG8-F1-model_v4 Guanidinium exporter 0.988 4 108 GO:0005886
GO:0022857

Map