F418689

General Info

Members Datasets Scaffolds Average Seq Length
351 244 702 255

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10006407|Ga0307516_100064075
Length 252
Sequence MDIDLNADLGEGYGPWRMGEDEAMLALISSANVACGFHAGDSSIMDRTARLALQHGVDVGAHVSFPDRQGFGRRAMQIDTAELATMVTYQLGAMAGIARAAGHRLTHMSFHGALGNLAAADASLAEPLLRAIAAFDPAIIAIEGVADRCGLRVATAFLADRAYTDDGLLVPRKLPDSVIKDEAAVLARVRRLLQDGTVLTYSGNAIAMPMRSILVHGDTPGAMALARAIRAEIEAGGGRIVPISAQMAAGAR

Samples

Sample ID Description Type Environment
1 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
93 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
97 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
104 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
114 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
115 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
116 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
117 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
118 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
119 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
120 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
121 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
122 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
123 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
124 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
125 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
126 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
127 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
128 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
165 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
166 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
172 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
197 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
203 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
209 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
210 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
211 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
212 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
213 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
214 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
215 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
216 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
217 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
218 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
219 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
220 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
221 2508501050 Microvirga lupini Lut6 Isolate Nodule
222 2511231007 Pseudomonas sp. GM18 Isolate Nodule
223 2511231022 Pseudomonas sp. GM79 Isolate Nodule
224 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
225 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
226 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
227 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
228 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
229 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
230 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
231 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
232 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
233 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
234 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
235 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
236 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
237 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
238 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
239 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
240 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
241 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
242 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
243 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
244 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.16
Metatranscriptomes 0
Isolates 6.84

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 13.11
Nodule 2.56
Rhizoplane 5.41
Rhizosphere 64.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307516_10006407 3300031730 Bacteria 13802
2 Ga0065714_10002413 3300005288 Bacteria 21651
3 Ga0065714_10003203 3300005288 Bacteria 10965
4 Ga0065714_10066746 3300005288 Bacteria 6373
5 Ga0065714_10105713 3300005288 Bacteria 1542
6 Ga0065714_10137058 3300005288 Bacteria 1201
7 Ga0065704_10011572 3300005289 Bacteria 2640
8 Ga0070670_100000242 3300005331 Bacteria 49330
9 Ga0068869_100158706 3300005334 Bacteria 1759
10 Ga0070666_10034028 3300005335 Bacteria 3377
11 Ga0068868_100035446 3300005338 Bacteria 3857
12 Ga0068868_100236945 3300005338 Bacteria 1532
13 Ga0070669_100344098 3300005353 Bacteria 1209
14 Ga0070675_100002236 3300005354 Bacteria 14369
15 Ga0070671_100043316 3300005355 Bacteria 3741
16 Ga0070671_100409828 3300005355 Bacteria 1160
17 Ga0070673_100014369 3300005364 Bacteria 5511
18 Ga0070659_100138987 3300005366 Bacteria 1977
19 Ga0070667_100052009 3300005367 Bacteria 3455
20 Ga0070708_100033157 3300005445 Bacteria 4486
21 Ga0070662_100548349 3300005457 Bacteria 969
22 Ga0068867_100008131 3300005459 Bacteria 7412
23 Ga0068867_100056478 3300005459 Bacteria 2905
24 Ga0070706_100002001 3300005467 Bacteria 20981
25 Ga0070698_100058198 3300005471 Bacteria 3908
26 Ga0068853_100048385 3300005539 Bacteria 3652
27 Ga0070672_100217145 3300005543 Bacteria 1603
28 Ga0070665_100102502 3300005548 Bacteria 2865
29 Ga0070665_100347631 3300005548 Bacteria 1488
30 Ga0068857_100010180 3300005577 Bacteria 8174
31 Ga0068854_100009921 3300005578 Bacteria 6161
32 Ga0068870_10074482 3300005840 Bacteria 1860
33 Ga0068860_100003437 3300005843 Bacteria 16288
34 Ga0068862_100013294 3300005844 Bacteria 6809
35 Ga0075368_10026505 3300006042 Bacteria 2230
36 Ga0075368_10029226 3300006042 Bacteria 2131
37 Ga0075363_100055667 3300006048 Bacteria 2119
38 Ga0075363_100101700 3300006048 Bacteria 1591
39 Ga0075363_100162150 3300006048 Bacteria 1266
40 Ga0075362_10012442 3300006177 Bacteria 3381
41 Ga0075362_10050368 3300006177 Bacteria 1862
42 Ga0075367_10008954 3300006178 Bacteria 5211
43 Ga0075367_10019927 3300006178 Bacteria 3727
44 Ga0075367_10056689 3300006178 Bacteria 2328
45 Ga0075367_10136415 3300006178 Bacteria 1518
46 Ga0075369_10000489 3300006186 Bacteria 12265
47 Ga0075366_10000903 3300006195 Bacteria 14366
48 Ga0075366_10006115 3300006195 Bacteria 6565
49 Ga0075366_10011740 3300006195 Bacteria 4952
50 Ga0075370_10003030 3300006353 Bacteria 7921
51 Ga0075370_10010939 3300006353 Bacteria 4757
52 Ga0075370_10023429 3300006353 Bacteria 3400
53 Ga0075429_100002217 3300006880 Bacteria 16266
54 Ga0068865_100408089 3300006881 Bacteria 1114
55 Ga0105251_10000098 3300009011 Bacteria 85363
56 Ga0105251_10004167 3300009011 Bacteria 10041
57 Ga0105240_10029724 3300009093 Bacteria 7111
58 Ga0105240_10403680 3300009093 Bacteria 1539
59 Ga0111539_10762123 3300009094 Bacteria 1126
60 Ga0105245_10033803 3300009098 Bacteria 4532
61 Ga0105247_10094002 3300009101 Bacteria 1907
62 Ga0114129_10013426 3300009147 Bacteria 11672
63 Ga0105243_10016506 3300009148 Bacteria 5582
64 Ga0105243_10062040 3300009148 Bacteria 2992
65 Ga0105241_10064261 3300009174 Bacteria 2833
66 Ga0105242_10113132 3300009176 Bacteria 2317
67 Ga0105242_10220929 3300009176 Bacteria 1693
68 Ga0105242_10405421 3300009176 Bacteria 1274
69 Ga0105248_10801005 3300009177 Bacteria 1063
70 Ga0105237_10037800 3300009545 Bacteria 4877
71 Ga0105237_10046055 3300009545 Bacteria 4388
72 Ga0105249_10244605 3300009553 Bacteria 1775
73 Ga0105239_10056124 3300010375 Bacteria 4320
74 Ga0105246_10000778 3300011119 Bacteria 18098
75 Ga0105246_10340878 3300011119 Bacteria 1225
76 Ga0171462_1015 3300013250 Bacteria 169578
77 Ga0157378_10234361 3300013297 Bacteria 1751
78 Ga0163162_10047061 3300013306 Bacteria 4323
79 Ga0163162_10057014 3300013306 Bacteria 3934
80 Ga0157375_10780369 3300013308 Bacteria 1105
81 Ga0157380_10219339 3300014326 Bacteria 1700
82 Ga0182008_10001373 3300014497 Bacteria 16474
83 Ga0157379_10130000 3300014968 Bacteria 2266
84 Ga0157376_10000620 3300014969 Bacteria 22978
85 Ga0157376_10959757 3300014969 Bacteria 876
86 Ga0182006_1026735 3300015261 Bacteria 2360
87 Ga0163161_10026650 3300017792 Bacteria 4095
88 Ga0163161_10034092 3300017792 Bacteria 3640
89 Ga0207655_1000449 3300025728 Bacteria 54265
90 Ga0207713_1000061 3300025735 Bacteria 209289
91 Ga0207713_1000330 3300025735 Bacteria 53243
92 Ga0207710_10083587 3300025900 Bacteria 1484
93 Ga0207688_10067800 3300025901 Bacteria 2019
94 Ga0207680_10193653 3300025903 Bacteria 1381
95 Ga0207643_10015768 3300025908 Bacteria 4116
96 Ga0207684_10019493 3300025910 Bacteria 5801
97 Ga0207695_10061893 3300025913 Bacteria 3867
98 Ga0207671_10041094 3300025914 Bacteria 3422
99 Ga0207671_10049088 3300025914 Bacteria 3124
100 Ga0207681_10446300 3300025923 Bacteria 1052
101 Ga0207650_10000259 3300025925 Bacteria 56695
102 Ga0207650_10283536 3300025925 Bacteria 1349
103 Ga0207659_10017903 3300025926 Bacteria 4635
104 Ga0207644_10247753 3300025931 Bacteria 1420
105 Ga0207644_10426519 3300025931 Bacteria 1087
106 Ga0207690_10567535 3300025932 Bacteria 924
107 Ga0207706_10035664 3300025933 Bacteria 4421
108 Ga0207706_10474453 3300025933 Bacteria 1081
109 Ga0207686_10068983 3300025934 Bacteria 2267
110 Ga0207691_10074907 3300025940 Bacteria 3052
111 Ga0207689_10128469 3300025942 Bacteria 2085
112 Ga0207689_10172787 3300025942 Bacteria 1782
113 Ga0207651_10154954 3300025960 Bacteria 1788
114 Ga0207640_10236737 3300025981 Bacteria 1408
115 Ga0207658_10073498 3300025986 Bacteria 2595
116 Ga0207658_10227647 3300025986 Bacteria 1572
117 Ga0207639_10024527 3300026041 Bacteria 4366
118 Ga0207648_10003368 3300026089 Bacteria 16788
119 Ga0207648_10016212 3300026089 Bacteria 6819
120 Ga0207676_10599384 3300026095 Bacteria 1058
121 Ga0207674_10008463 3300026116 Bacteria 11884
122 Ga0207683_10022444 3300026121 Bacteria 5418
123 Ga0209282_1000934 3300027666 Bacteria 15275
124 Ga0268266_10331358 3300028379 Bacteria 1427
125 Ga0268266_10433339 3300028379 Bacteria 1247
126 Ga0268265_10100744 3300028380 Bacteria 2332
127 Ga0268264_10000020 3300028381 Bacteria 483593
128 Ga0268264_10844915 3300028381 Bacteria 917
129 Ga0307517_10225559 3300028786 Bacteria 1132
130 Ga0307515_10000067 3300028794 Bacteria 242978
131 Ga0307515_10001836 3300028794 Bacteria 47333
132 Ga0307515_10220780 3300028794 Bacteria 1714
133 Ga0307515_10261414 3300028794 Bacteria 1466
134 Ga0307512_10066467 3300030522 Bacteria 2723
135 Ga0265327_10003656 3300031251 Bacteria 14447
136 Ga0307513_10022166 3300031456 Bacteria 7473
137 Ga0307513_10026537 3300031456 Bacteria 6677
138 Ga0307513_10030380 3300031456 Bacteria 6138
139 Ga0307513_10220898 3300031456 Bacteria 1716
140 Ga0307509_10004345 3300031507 Bacteria 20558
141 Ga0307509_10024197 3300031507 Bacteria 6804
142 Ga0307508_10008897 3300031616 Bacteria 9256
143 Ga0307508_10095077 3300031616 Bacteria 2570
144 Ga0307508_10147834 3300031616 Bacteria 1954
145 Ga0307508_10151777 3300031616 Bacteria 1921
146 Ga0307514_10005212 3300031649 Bacteria 11711
147 Ga0307514_10086443 3300031649 Bacteria 2301
148 Ga0307516_10001738 3300031730 Bacteria 29930
149 Ga0307516_10016230 3300031730 Bacteria 7796
150 Ga0307405_10014491 3300031731 Bacteria 4240
151 Ga0307405_10107625 3300031731 Bacteria 1882
152 Ga0307518_10166946 3300031838 Bacteria 1505
153 Ga0307412_10152788 3300031911 Bacteria 1705
154 Ga0307416_100102509 3300032002 Bacteria 2495
155 Ga0307411_10049974 3300032005 Bacteria 2721
156 Ga0307507_10082700 3300033179 Bacteria 2813
157 Ga0307507_10148710 3300033179 Bacteria 1770
158 Ga0307510_10137919 3300033180 Bacteria 2092
159 Ga0373925_0130904 3300037068 Bacteria 1956
160 Ga0395899_0002715 3300037312 Bacteria 14263
161 Ga0395900_0074588 3300037418 Bacteria 3487
162 Ga0395898_0185177 3300037466 Bacteria 1989
163 Ga0395905_0233895 3300037471 Bacteria 1718
164 Ga0395905_0390287 3300037471 Bacteria 1286
165 Ga0436364_0170508 3300037853 Bacteria 12504
166 Ga0436364_1292328 3300037853 Bacteria 1398
167 Ga0395901_0114716 3300038443 Bacteria 2829
168 Ga0395901_0432127 3300038443 Bacteria 1349
169 Ga0436361_0694654 3300039447 Bacteria 4208
170 Ga0439436_0012579 3300041404 Bacteria 2568
171 Ga0439438_023677 3300041405 Bacteria 1689
172 Ga0439439_0003236 3300041406 Bacteria 3574
173 Ga0439461_0035649 3300041410 Bacteria 1056
174 Ga0439431_0014516 3300041997 Bacteria 1827
175 Ga0439431_0031625 3300041997 Bacteria 1316
176 Ga0439433_0027512 3300041999 Bacteria 1290
177 Ga0439449_0001676 3300042007 Bacteria 8714
178 Ga0439462_0004772 3300042015 Bacteria 3323
179 Ga0450923_024437 3300042125 Bacteria 1198
180 Ga0450894_003606 3300042131 Bacteria 2024
181 Ga0450895_006236 3300042132 Bacteria 973
182 Ga0450906_018623 3300042145 Bacteria 1245
183 Ga0439446_0055217 3300042156 Bacteria 1192
184 Ga0450909_009617 3300042185 Bacteria 1411
185 Ga0439434_0106018 3300042435 Bacteria 908
186 Ga0450918_007733 3300042531 Bacteria 1896
187 Ga0466961_0091064 3300044693 Bacteria 1926
188 Ga0466957_0134619 3300044842 Bacteria 1587
189 Ga0451576_0107277 3300045051 Bacteria 2906
190 Ga0451576_0555746 3300045051 Bacteria 1206
191 Ga0495592_0000131 3300046454 Bacteria 66382
192 Ga0495590_0020645 3300046457 Bacteria 2339
193 Ga0495629_0072772 3300046459 Bacteria 2400
194 Ga0495651_0060248 3300046462 Bacteria 2908
195 Ga0495650_0008643 3300046471 Bacteria 5903
196 Ga0495580_0009254 3300046472 Bacteria 7757
197 Ga0495605_0000080 3300046474 Bacteria 125370
198 Ga0495605_0013849 3300046474 Bacteria 4431
199 Ga0495605_0026927 3300046474 Bacteria 2983
200 Ga0495605_0060408 3300046474 Bacteria 1817
201 Ga0495639_0000001 3300046475 Bacteria 204442
202 Ga0495639_0001601 3300046475 Bacteria 10073
203 Ga0495584_0001106 3300046491 Bacteria 16730
204 Ga0495585_0000072 3300046492 Bacteria 102939
205 Ga0495594_0024728 3300046499 Bacteria 3228
206 Ga0495610_0002534 3300046512 Bacteria 15238
207 Ga0495610_0022187 3300046512 Bacteria 3477
208 Ga0495610_0079526 3300046512 Bacteria 1509
209 Ga0495618_0418205 3300046514 Bacteria 818
210 Ga0495630_0173148 3300046517 Bacteria 1645
211 Ga0495631_0095372 3300046518 Bacteria 1281
212 Ga0495632_0000207 3300046519 Bacteria 59532
213 Ga0495632_0018371 3300046519 Bacteria 3838
214 Ga0495632_0125022 3300046519 Bacteria 1199
215 Ga0495637_0004267 3300046520 Bacteria 7424
216 Ga0495637_0014950 3300046520 Bacteria 3651
217 Ga0495637_0024262 3300046520 Bacteria 2744
218 Ga0495637_0047594 3300046520 Bacteria 1809
219 Ga0495643_0015434 3300046522 Bacteria 4513
220 Ga0495666_0109609 3300046526 Bacteria 1297
221 Ga0495642_0007002 3300046528 Bacteria 4327
222 Ga0495654_0000313 3300046530 Bacteria 42607
223 Ga0495654_0063027 3300046530 Bacteria 1776
224 Ga0495609_0000111 3300046538 Bacteria 94808
225 Ga0495621_0011816 3300046539 Bacteria 2712
226 Ga0495622_0000627 3300046557 Bacteria 20519
227 Ga0495622_0155157 3300046557 Bacteria 1034
228 Ga0495633_0186312 3300046558 Bacteria 955
229 Ga0495656_0000831 3300046615 Bacteria 9943
230 Ga0495668_0109106 3300046616 Bacteria 1514
231 Ga0495625_0033692 3300046660 Bacteria 3784
232 Ga0495625_0042094 3300046660 Bacteria 3321
233 Ga0495625_0051697 3300046660 Bacteria 2945
234 Ga0495661_0000009 3300046665 Bacteria 291327
235 Ga0495661_0000010 3300046665 Bacteria 284261
236 Ga0495661_0043408 3300046665 Bacteria 2764
237 Ga0495661_0213620 3300046665 Bacteria 1003
238 Ga0495588_0039985 3300046674 Bacteria 2390
239 Ga0495670_0128289 3300046691 Bacteria 1321
240 Ga0495649_0000091 3300046694 Bacteria 77817
241 Ga0495649_0025086 3300046694 Bacteria 3321
242 Ga0495589_0018803 3300046794 Bacteria 3542
243 Ga0495660_0000152 3300046810 Bacteria 74914
244 Ga0495660_0102376 3300046810 Bacteria 1472
245 Ga0495636_0000127 3300047318 Bacteria 31014
246 Ga0495672_0002879 3300047320 Bacteria 15242
247 Ga0495672_0012028 3300047320 Bacteria 6060
248 Ga0495680_0258935 3300047322 Bacteria 1231
249 Ga0495683_0000004 3300047323 Bacteria 321136
250 Ga0495687_001729 3300047443 Bacteria 19327
251 Ga0495687_013576 3300047443 Bacteria 4240
252 Ga0495687_036130 3300047443 Bacteria 2213
253 Ga0495679_003660 3300047446 Bacteria 7334
254 Ga0495679_009634 3300047446 Bacteria 3848
255 Ga0495673_0002876 3300047469 Bacteria 11710
256 Ga0495593_0001600 3300047673 Bacteria 13379
257 Ga0495602_0101764 3300048088 Bacteria 2356
258 Ga0495614_0261970 3300048089 Bacteria 793
259 Ga0495626_0001968 3300048091 Bacteria 15208
260 Ga0495626_0055323 3300048091 Bacteria 1819
261 Ga0495626_0093441 3300048091 Bacteria 1320
262 Ga0496100_0002213 3300048903 Bacteria 9823
263 Ga0496101_0001976 3300048904 Bacteria 12432
264 Ga0496102_0010008 3300048905 Bacteria 8153
265 Ga0496103_0032636 3300048906 Bacteria 3178
266 Ga0496104_0014876 3300048907 Bacteria 7033
267 Ga0496104_0393463 3300048907 Bacteria 1298
268 Ga0496105_0010935 3300048908 Bacteria 7149
269 Ga0496106_0007861 3300048909 Bacteria 7888
270 Ga0496108_0020410 3300048911 Bacteria 5447
271 Ga0496108_0150341 3300048911 Bacteria 2009
272 Ga0496109_0010940 3300048912 Bacteria 7774
273 Ga0496109_0214905 3300048912 Bacteria 1808
274 Ga0496110_0004472 3300048913 Bacteria 10838
275 Ga0496110_0015216 3300048913 Bacteria 6400
276 Ga0496110_0806070 3300048913 Bacteria 843
277 Ga0496111_0014555 3300048914 Bacteria 5378
278 Ga0496114_0036706 3300048917 Bacteria 4052
279 Ga0496117_0089900 3300048920 Bacteria 1981
280 Ga0496118_0044282 3300048921 Bacteria 3486
281 Ga0496118_0088638 3300048921 Bacteria 2139
282 Ga0496121_0054418 3300048924 Bacteria 3344
283 Ga0496121_0117080 3300048924 Bacteria 2019
284 Ga0496122_0018977 3300048925 Bacteria 6309
285 Ga0496124_0000035 3300048927 Bacteria 318099
286 Ga0496124_0005442 3300048927 Bacteria 14316
287 Ga0496125_0019664 3300048928 Bacteria 6360
288 Ga0496125_0078223 3300048928 Bacteria 2543
289 Ga0496126_0070076 3300048929 Bacteria 3125
290 Ga0496126_0259174 3300048929 Bacteria 1447
291 Ga0495678_000014 3300049459 Bacteria 313755
292 Ga0495678_001900 3300049459 Bacteria 15176
293 Ga0495678_020699 3300049459 Bacteria 2907
294 Ga0495678_038293 3300049459 Bacteria 1941
295 Ga0495682_0004501 3300049460 Bacteria 5946
296 Ga0501047_0030621 3300049581 Bacteria 5187
297 nmdc:mga03683_38277_c1 3300050489 Bacteria 1958
298 nmdc:mga03683_38278_c1 3300050489 Bacteria 1958
299 nmdc:mga03n38_45211_c1 3300050490 Bacteria 1938
300 nmdc:mga0k408_10609_c1 3300050493 Bacteria 4988
301 nmdc:mga0k408_15234_c2 3300050493 Bacteria 3856
302 nmdc:mga0k408_1592_c1 3300050493 Bacteria 12280
303 nmdc:mga0k408_2137_c1 3300050493 Bacteria 10590
304 nmdc:mga0k408_5814_c1 3300050493 Bacteria 6569
305 nmdc:mga06z11_277800_c1 3300050494 Bacteria 992
306 nmdc:mga06z11_36125_c1 3300050494 Bacteria 2437
307 nmdc:mga04h51_57392_c1 3300050495 Bacteria 1324
308 nmdc:mga07m45_10438_c1 3300050496 Bacteria 4852
309 nmdc:mga07m45_10689_c1 3300050496 Bacteria 4803
310 nmdc:mga07m45_51697_c1 3300050496 Bacteria 2318
311 nmdc:mga05p37_1040901_c1 3300050507 Bacteria 865
312 nmdc:mga09592_675_c1 3300050508 Bacteria 26098
313 nmdc:mga0qj67_11078_c1 3300050509 Bacteria 6751
314 nmdc:mga0sz30_11440_c1 3300050516 Bacteria 3426
315 Ga0500635_0019499 3300053080 Bacteria 2062
316 Ga0500583_0039511 3300053092 Bacteria 2132
317 Ga0500607_019622 3300053121 Bacteria 3823
318 Ga0500618_001292 3300053125 Bacteria 11489
319 Ga0500618_031130 3300053125 Bacteria 1252
320 Ga0500658_0022916 3300053134 Bacteria 2380
321 Ga0500590_110400 3300053148 Bacteria 1306
322 Ga0500603_021591 3300053150 Bacteria 1585
323 Ga0500619_016511 3300053154 Bacteria 2033
324 Ga0500634_0027921 3300053161 Bacteria 3073
325 Ga0500639_110136 3300053163 Bacteria 1341
326 Ga0500552_000792 3300053733 Bacteria 2969
327 Ga0500596_001832 3300053735 Bacteria 4271
328 2508730172 2508501050 Bacteria 9633614
329 2511270403 2511231007 Bacteria 6306603
330 2511364486 2511231022 Bacteria 6719296
331 2599328728 2599185155 Bacteria 5827168
332 2599878063 2599185288 Bacteria 6666191
333 2687579193 2687453129 Bacteria 4387428
334 2738809954 2738541294 Bacteria 6925949
335 2738897314 2738541309 Bacteria 6926455
336 2776266417 2775506901 Bacteria 9631051
337 2819562198 2818991439 Bacteria 6907412
338 2825656959 2825651385 Bacteria 6715909
339 2844322766 2844315083 Bacteria 8138177
340 2903734718 2903727486 Bacteria 8281579
341 2906604971 2906602504 Bacteria 8295279
342 2931400437 2931396565 Bacteria 7251677
343 2978974774 2978969890 Bacteria 5400756
344 2984606221 2984601300 Bacteria 5455244
345 3005602639 3005594810 Bacteria 8716512
346 3005716983 3005710791 Bacteria 7622528
347 3005726109 3005718088 Bacteria 8283608
348 8016590207 8016583857 Bacteria 10421953
349 8054285377 8054285046 Bacteria 6919322
350 8054507129 8054503363 Bacteria 6101651
351 8056976574 8056967851 Bacteria 9038162
352 Ga0307516_10006407
353 Ga0065714_10002413
354 Ga0065714_10003203
355 Ga0065714_10066746
356 Ga0065714_10105713
357 Ga0065714_10137058
358 Ga0065704_10011572
359 Ga0070670_100000242
360 Ga0068869_100158706
361 Ga0070666_10034028
362 Ga0068868_100035446
363 Ga0068868_100236945
364 Ga0070669_100344098
365 Ga0070675_100002236
366 Ga0070671_100043316
367 Ga0070671_100409828
368 Ga0070673_100014369
369 Ga0070659_100138987
370 Ga0070667_100052009
371 Ga0070708_100033157
372 Ga0070662_100548349
373 Ga0068867_100008131
374 Ga0068867_100056478
375 Ga0070706_100002001
376 Ga0070698_100058198
377 Ga0068853_100048385
378 Ga0070672_100217145
379 Ga0070665_100102502
380 Ga0070665_100347631
381 Ga0068857_100010180
382 Ga0068854_100009921
383 Ga0068870_10074482
384 Ga0068860_100003437
385 Ga0068862_100013294
386 Ga0075368_10026505
387 Ga0075368_10029226
388 Ga0075363_100055667
389 Ga0075363_100101700
390 Ga0075363_100162150
391 Ga0075362_10012442
392 Ga0075362_10050368
393 Ga0075367_10008954
394 Ga0075367_10019927
395 Ga0075367_10056689
396 Ga0075367_10136415
397 Ga0075369_10000489
398 Ga0075366_10000903
399 Ga0075366_10006115
400 Ga0075366_10011740
401 Ga0075370_10003030
402 Ga0075370_10010939
403 Ga0075370_10023429
404 Ga0075429_100002217
405 Ga0068865_100408089
406 Ga0105251_10000098
407 Ga0105251_10004167
408 Ga0105240_10029724
409 Ga0105240_10403680
410 Ga0111539_10762123
411 Ga0105245_10033803
412 Ga0105247_10094002
413 Ga0114129_10013426
414 Ga0105243_10016506
415 Ga0105243_10062040
416 Ga0105241_10064261
417 Ga0105242_10113132
418 Ga0105242_10220929
419 Ga0105242_10405421
420 Ga0105248_10801005
421 Ga0105237_10037800
422 Ga0105237_10046055
423 Ga0105249_10244605
424 Ga0105239_10056124
425 Ga0105246_10000778
426 Ga0105246_10340878
427 Ga0171462_1015
428 Ga0157378_10234361
429 Ga0163162_10047061
430 Ga0163162_10057014
431 Ga0157375_10780369
432 Ga0157380_10219339
433 Ga0182008_10001373
434 Ga0157379_10130000
435 Ga0157376_10000620
436 Ga0157376_10959757
437 Ga0182006_1026735
438 Ga0163161_10026650
439 Ga0163161_10034092
440 Ga0207655_1000449
441 Ga0207713_1000061
442 Ga0207713_1000330
443 Ga0207710_10083587
444 Ga0207688_10067800
445 Ga0207680_10193653
446 Ga0207643_10015768
447 Ga0207684_10019493
448 Ga0207695_10061893
449 Ga0207671_10041094
450 Ga0207671_10049088
451 Ga0207681_10446300
452 Ga0207650_10000259
453 Ga0207650_10283536
454 Ga0207659_10017903
455 Ga0207644_10247753
456 Ga0207644_10426519
457 Ga0207690_10567535
458 Ga0207706_10035664
459 Ga0207706_10474453
460 Ga0207686_10068983
461 Ga0207691_10074907
462 Ga0207689_10128469
463 Ga0207689_10172787
464 Ga0207651_10154954
465 Ga0207640_10236737
466 Ga0207658_10073498
467 Ga0207658_10227647
468 Ga0207639_10024527
469 Ga0207648_10003368
470 Ga0207648_10016212
471 Ga0207676_10599384
472 Ga0207674_10008463
473 Ga0207683_10022444
474 Ga0209282_1000934
475 Ga0268266_10331358
476 Ga0268266_10433339
477 Ga0268265_10100744
478 Ga0268264_10000020
479 Ga0268264_10844915
480 Ga0307517_10225559
481 Ga0307515_10000067
482 Ga0307515_10001836
483 Ga0307515_10220780
484 Ga0307515_10261414
485 Ga0307512_10066467
486 Ga0265327_10003656
487 Ga0307513_10022166
488 Ga0307513_10026537
489 Ga0307513_10030380
490 Ga0307513_10220898
491 Ga0307509_10004345
492 Ga0307509_10024197
493 Ga0307508_10008897
494 Ga0307508_10095077
495 Ga0307508_10147834
496 Ga0307508_10151777
497 Ga0307514_10005212
498 Ga0307514_10086443
499 Ga0307516_10001738
500 Ga0307516_10016230
501 Ga0307405_10014491
502 Ga0307405_10107625
503 Ga0307518_10166946
504 Ga0307412_10152788
505 Ga0307416_100102509
506 Ga0307411_10049974
507 Ga0307507_10082700
508 Ga0307507_10148710
509 Ga0307510_10137919
510 Ga0373925_0130904
511 Ga0395899_0002715
512 Ga0395900_0074588
513 Ga0395898_0185177
514 Ga0395905_0233895
515 Ga0395905_0390287
516 Ga0436364_0170508
517 Ga0436364_1292328
518 Ga0395901_0114716
519 Ga0395901_0432127
520 Ga0436361_0694654
521 Ga0439436_0012579
522 Ga0439438_023677
523 Ga0439439_0003236
524 Ga0439461_0035649
525 Ga0439431_0014516
526 Ga0439431_0031625
527 Ga0439433_0027512
528 Ga0439449_0001676
529 Ga0439462_0004772
530 Ga0450923_024437
531 Ga0450894_003606
532 Ga0450895_006236
533 Ga0450906_018623
534 Ga0439446_0055217
535 Ga0450909_009617
536 Ga0439434_0106018
537 Ga0450918_007733
538 Ga0466961_0091064
539 Ga0466957_0134619
540 Ga0451576_0107277
541 Ga0451576_0555746
542 Ga0495592_0000131
543 Ga0495590_0020645
544 Ga0495629_0072772
545 Ga0495651_0060248
546 Ga0495650_0008643
547 Ga0495580_0009254
548 Ga0495605_0000080
549 Ga0495605_0013849
550 Ga0495605_0026927
551 Ga0495605_0060408
552 Ga0495639_0000001
553 Ga0495639_0001601
554 Ga0495584_0001106
555 Ga0495585_0000072
556 Ga0495594_0024728
557 Ga0495610_0002534
558 Ga0495610_0022187
559 Ga0495610_0079526
560 Ga0495618_0418205
561 Ga0495630_0173148
562 Ga0495631_0095372
563 Ga0495632_0000207
564 Ga0495632_0018371
565 Ga0495632_0125022
566 Ga0495637_0004267
567 Ga0495637_0014950
568 Ga0495637_0024262
569 Ga0495637_0047594
570 Ga0495643_0015434
571 Ga0495666_0109609
572 Ga0495642_0007002
573 Ga0495654_0000313
574 Ga0495654_0063027
575 Ga0495609_0000111
576 Ga0495621_0011816
577 Ga0495622_0000627
578 Ga0495622_0155157
579 Ga0495633_0186312
580 Ga0495656_0000831
581 Ga0495668_0109106
582 Ga0495625_0033692
583 Ga0495625_0042094
584 Ga0495625_0051697
585 Ga0495661_0000009
586 Ga0495661_0000010
587 Ga0495661_0043408
588 Ga0495661_0213620
589 Ga0495588_0039985
590 Ga0495670_0128289
591 Ga0495649_0000091
592 Ga0495649_0025086
593 Ga0495589_0018803
594 Ga0495660_0000152
595 Ga0495660_0102376
596 Ga0495636_0000127
597 Ga0495672_0002879
598 Ga0495672_0012028
599 Ga0495680_0258935
600 Ga0495683_0000004
601 Ga0495687_001729
602 Ga0495687_013576
603 Ga0495687_036130
604 Ga0495679_003660
605 Ga0495679_009634
606 Ga0495673_0002876
607 Ga0495593_0001600
608 Ga0495602_0101764
609 Ga0495614_0261970
610 Ga0495626_0001968
611 Ga0495626_0055323
612 Ga0495626_0093441
613 Ga0496100_0002213
614 Ga0496101_0001976
615 Ga0496102_0010008
616 Ga0496103_0032636
617 Ga0496104_0014876
618 Ga0496104_0393463
619 Ga0496105_0010935
620 Ga0496106_0007861
621 Ga0496108_0020410
622 Ga0496108_0150341
623 Ga0496109_0010940
624 Ga0496109_0214905
625 Ga0496110_0004472
626 Ga0496110_0015216
627 Ga0496110_0806070
628 Ga0496111_0014555
629 Ga0496114_0036706
630 Ga0496117_0089900
631 Ga0496118_0044282
632 Ga0496118_0088638
633 Ga0496121_0054418
634 Ga0496121_0117080
635 Ga0496122_0018977
636 Ga0496124_0000035
637 Ga0496124_0005442
638 Ga0496125_0019664
639 Ga0496125_0078223
640 Ga0496126_0070076
641 Ga0496126_0259174
642 Ga0495678_000014
643 Ga0495678_001900
644 Ga0495678_020699
645 Ga0495678_038293
646 Ga0495682_0004501
647 Ga0501047_0030621
648 nmdc:mga03683_38277_c1
649 nmdc:mga03683_38278_c1
650 nmdc:mga03n38_45211_c1
651 nmdc:mga0k408_10609_c1
652 nmdc:mga0k408_15234_c2
653 nmdc:mga0k408_1592_c1
654 nmdc:mga0k408_2137_c1
655 nmdc:mga0k408_5814_c1
656 nmdc:mga06z11_277800_c1
657 nmdc:mga06z11_36125_c1
658 nmdc:mga04h51_57392_c1
659 nmdc:mga07m45_10438_c1
660 nmdc:mga07m45_10689_c1
661 nmdc:mga07m45_51697_c1
662 nmdc:mga05p37_1040901_c1
663 nmdc:mga09592_675_c1
664 nmdc:mga0qj67_11078_c1
665 nmdc:mga0sz30_11440_c1
666 Ga0500635_0019499
667 Ga0500583_0039511
668 Ga0500607_019622
669 Ga0500618_001292
670 Ga0500618_031130
671 Ga0500658_0022916
672 Ga0500590_110400
673 Ga0500603_021591
674 Ga0500619_016511
675 Ga0500634_0027921
676 Ga0500639_110136
677 Ga0500552_000792
678 Ga0500596_001832
679 2508730172
680 2511270403
681 2511364486
682 2599328728
683 2599878063
684 2687579193
685 2738809954
686 2738897314
687 2776266417
688 2819562198
689 2825656959
690 2844322766
691 2903734718
692 2906604971
693 2931400437
694 2978974774
695 2984606221
696 3005602639
697 3005716983
698 3005726109
699 8016590207
700 8054285377
701 8054507129
702 8056976574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03746

LamB_YcsF

LamB/YcsF family

3

234

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dfa-assembly1.cif.gz_A crystal structure of lactam utilization protein from thermus thermophilus hb8 0.9427 1 250
2dfa-assembly1.cif.gz_A crystal structure of lactam utilization protein from thermus thermophilus hb8 0.939 1 250
1v6t-assembly1.cif.gz_A crystal structure of lactam utilization protein from pyrococcus horikoshii ot3 0.9386 1 252
1xw8-assembly1.cif.gz_A-2 x-ray structure of putative lactam utilization protein ybgl. northeast structural genomics consortium target et90. 0.9344 1 249
1v6t-assembly1.cif.gz_A crystal structure of lactam utilization protein from pyrococcus horikoshii ot3 0.9277 1 252
ID Description Score Start End Superfamily
af_Q2FXX2_1_250_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9467 1 250 3.20.20.370
af_Q2FXX2_1_250_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9431 1 250 3.20.20.370
2dfaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9427 1 250 3.20.20.370
2dfaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.939 1 250 3.20.20.370
1v6tA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9386 1 252 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A0P9M5U7-F1-model_v4 LamB/YcsF family protein 0.983 94 255 GO:0005975
AF-A0A2G8MLR3-F1-model_v4 deleted 0.98 133 252
AF-A0A836ZPQ4-F1-model_v4 deleted 0.9754 121 255
AF-A0A512E3I0-F1-model_v4 5-oxoprolinase subunit A (5-OPase subunit A) (EC 3.5.2.9) (5-oxoprolinase (ATP-hydrolyzing) subunit A) 0.972 1 255 GO:0005524
GO:0005975
GO:0017168
AF-A0A520GRZ7-F1-model_v4 5-oxoprolinase subunit A (5-OPase subunit A) (EC 3.5.2.9) (5-oxoprolinase (ATP-hydrolyzing) subunit A) 0.971 1 255 GO:0005524
GO:0005975
GO:0017168

Map