F418692

General Info

Members Datasets Scaffolds Average Seq Length
351 245 702 402

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10056071|Ga0307410_100560713
Length 420
Sequence MESAAGKPASGKRVVVTGMGIVSPLGNDAASVASALREGRSGLRAMPEYAELGLRSQVAGAPDIDLDAAVDRKLKRFMGDAAAYAYVSMRDAIADAGLSDEQVRDPRTGVIAGSGGGSPQWQVETGDLLRAKGVRRVGPYMVPRTMCSTVSASLATAFGIRGVSYSISAACATSAHCIGAAADMIRHGVQDVVVAGGGEELHWGMTVQFDAMGALSTHFNDTPQRASRPYDVDRDGFVIAGGGGMLVLESYEHAMARGARIHAELTGYGVTSDGADMVAPSGEGAVRCMRMALAGLEGQGDGIAMVDYLNTHGTSTPVGDVVELEAVREAFGEGRVPPLSSTKALTGHSLGAASVHEAIYSLLMLQGGFMAASANIESLDPRAEGFPIVRELREGPLRTVMSNSFGFGGTNASLVFSRID

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
57 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
58 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
65 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
66 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
67 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
113 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
114 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
115 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
116 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
134 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
135 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
136 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
137 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
138 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
139 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
140 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
191 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
192 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
193 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
194 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
195 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
196 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
197 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
198 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
199 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
200 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
201 2643221695 Lysobacter sp. Root494 Isolate Unclassified
202 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
203 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
204 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
205 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
206 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
207 2818991457 Xanthomonas translucens 569 Isolate Unclassified
208 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
209 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
210 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
211 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
212 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
213 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
214 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
215 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
216 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
217 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
218 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
219 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
220 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
221 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
222 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
223 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
224 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
225 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
226 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
227 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
228 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
229 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
230 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
231 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
232 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
233 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
234 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
235 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
236 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
237 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
238 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
239 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
240 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
241 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
242 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
243 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
244 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
245 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.33
Metatranscriptomes 0.28
Isolates 15.38

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 12.82
Nodule 0.57
Rhizoplane 3.42
Rhizosphere 63.25
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10056071 3300031852 Bacteria 2678
2 JGI24739J22299_10033312 3300001989 Bacteria 1764
3 JGI24735J21928_10001173 3300002067 Bacteria 9376
4 JGI25157J39369_1000425 3300002741 Bacteria 27809
5 JGI25164J39214_1000259 3300002772 Bacteria 39804
6 JGI25152J39213_1000025 3300002773 Bacteria 103262
7 JGI25150J39212_1000066 3300002774 Bacteria 63677
8 JGI25151J46595_10000139 3300003187 Bacteria 96000
9 JGI25165J46597_1000379 3300003214 Bacteria 48698
10 JGI25153J46596_10000101 3300003215 Bacteria 96639
11 Ga0055533_1001936 3300003756 Bacteria 5106
12 Ga0055526_1001045 3300003771 Bacteria 20206
13 Ga0055537_1000028 3300003773 Bacteria 102200
14 Ga0055524_1008829 3300003775 Bacteria 4153
15 Ga0055536_1014313 3300003781 Bacteria 2798
16 Ga0055534_1000180 3300003784 Bacteria 46550
17 Ga0055528_1000262 3300003790 Bacteria 44658
18 Ga0055530_10000784 3300003791 Bacteria 26455
19 Ga0055530_10001799 3300003791 Bacteria 14874
20 Ga0058692_1000026 3300003856 Bacteria 203096
21 Ga0058692_1000040 3300003856 Bacteria 132805
22 Ga0065704_10070584 3300005289 Bacteria 19772
23 Ga0065704_10071027 3300005289 Bacteria 13649
24 Ga0070658_10270363 3300005327 Bacteria 1445
25 Ga0070670_100000327 3300005331 Bacteria 40304
26 Ga0070660_100014483 3300005339 Bacteria 5682
27 Ga0070668_100007980 3300005347 Bacteria 7863
28 Ga0070671_100014773 3300005355 Bacteria 6310
29 Ga0070671_100021105 3300005355 Bacteria 5318
30 Ga0070659_100005462 3300005366 Bacteria 9133
31 Ga0070659_100005978 3300005366 Bacteria 8773
32 Ga0070714_100000209 3300005435 Bacteria 47271
33 Ga0070713_100000941 3300005436 Bacteria 18599
34 Ga0070711_100221579 3300005439 Bacteria 1471
35 Ga0070663_100005378 3300005455 Bacteria 7606
36 Ga0070663_100031196 3300005455 Bacteria 3661
37 Ga0070678_100067569 3300005456 Bacteria 2661
38 Ga0070662_100078759 3300005457 Bacteria 2449
39 Ga0070681_10015355 3300005458 Bacteria 7618
40 Ga0068853_100039277 3300005539 Bacteria 4036
41 Ga0070696_100059795 3300005546 Bacteria 2664
42 Ga0070665_100385079 3300005548 Bacteria 1410
43 Ga0068855_100080392 3300005563 Bacteria 3779
44 Ga0068855_100385384 3300005563 Bacteria 1538
45 Ga0068856_100012146 3300005614 Bacteria 8342
46 Ga0068856_100015556 3300005614 Bacteria 7354
47 Ga0081539_10032374 3300005985 Bacteria 3203
48 Ga0075364_10000005 3300006051 Bacteria 93405
49 Ga0075364_10143153 3300006051 Bacteria 1609
50 Ga0070712_100018015 3300006175 Bacteria 4581
51 Ga0105251_10001131 3300009011 Bacteria 23181
52 Ga0105251_10004086 3300009011 Bacteria 10221
53 Ga0105244_10007450 3300009036 Bacteria 6958
54 Ga0105244_10020309 3300009036 Bacteria 3693
55 Ga0105240_10004091 3300009093 Bacteria 22410
56 Ga0105243_10009646 3300009148 Bacteria 7349
57 Ga0105242_10003311 3300009176 Bacteria 12543
58 Ga0105237_10001315 3300009545 Bacteria 32979
59 Ga0105238_10012451 3300009551 Bacteria 8580
60 Ga0105238_10013663 3300009551 Bacteria 8199
61 Ga0105238_10172341 3300009551 Bacteria 2140
62 Ga0105246_10057369 3300011119 Bacteria 2694
63 Ga0157371_10000658 3300013102 Bacteria 40993
64 Ga0157371_10006458 3300013102 Bacteria 9667
65 Ga0157370_10004714 3300013104 Bacteria 15541
66 Ga0157370_10012773 3300013104 Bacteria 8686
67 Ga0157370_10014062 3300013104 Bacteria 8213
68 Ga0157370_10034549 3300013104 Bacteria 4921
69 Ga0157370_10041445 3300013104 Bacteria 4441
70 Ga0157370_10064191 3300013104 Bacteria 3477
71 Ga0157369_10023991 3300013105 Bacteria 6786
72 Ga0157369_10122661 3300013105 Bacteria 2756
73 Ga0157369_10172733 3300013105 Bacteria 2277
74 Ga0157372_10008543 3300013307 Bacteria 10876
75 Ga0157372_10013068 3300013307 Bacteria 8857
76 Ga0182008_10000090 3300014497 Bacteria 69702
77 Ga0182008_10010326 3300014497 Bacteria 4999
78 Ga0182008_10048202 3300014497 Bacteria 2116
79 Ga0182006_1048555 3300015261 Bacteria 1641
80 Ga0182007_10000025 3300015262 Bacteria 172058
81 Ga0182007_10006817 3300015262 Bacteria 4860
82 Ga0182007_10011444 3300015262 Bacteria 3455
83 Ga0182007_10015357 3300015262 Bacteria 2859
84 Ga0182007_10024156 3300015262 Bacteria 2130
85 Ga0182005_1000063 3300015265 Bacteria 97663
86 Ga0182005_1002220 3300015265 Bacteria 7135
87 Ga0183368_1003 3300015687 Bacteria 1276390
88 Ga0163161_10155563 3300017792 Bacteria 1740
89 Ga0209674_100033 3300025226 Bacteria 423450
90 Ga0207427_100101 3300025231 Bacteria 120866
91 Ga0209437_100090 3300025233 Bacteria 247138
92 Ga0209258_100622 3300025242 Bacteria 28085
93 Ga0207425_1000040 3300025245 Bacteria 218121
94 Ga0209646_1001250 3300025246 Bacteria 7210
95 Ga0209026_1000114 3300025250 Bacteria 136985
96 Ga0209026_1001808 3300025250 Bacteria 8817
97 Ga0209759_1001159 3300025256 Bacteria 16722
98 Ga0209759_1003000 3300025256 Bacteria 6989
99 Ga0209129_1000011 3300025258 Bacteria 568657
100 Ga0209233_1000077 3300025261 Bacteria 349570
101 Ga0209565_1000037 3300025263 Bacteria 289371
102 Ga0209455_1000254 3300025272 Bacteria 62595
103 Ga0209673_1000032 3300025273 Bacteria 339956
104 Ga0209675_1000020 3300025291 Bacteria 335854
105 Ga0209676_1000063 3300025292 Bacteria 322025
106 Ga0209676_1000149 3300025292 Bacteria 167854
107 Ga0209676_1000199 3300025292 Bacteria 134270
108 Ga0209676_1001331 3300025292 Bacteria 24900
109 Ga0209025_1000002 3300025294 Bacteria 1393142
110 Ga0209564_1000951 3300025295 Bacteria 37038
111 Ga0209758_1000003 3300025297 Bacteria 1398533
112 Ga0209050_1000189 3300025298 Bacteria 138610
113 Ga0209050_1000199 3300025298 Bacteria 134682
114 Ga0209050_1030189 3300025298 Bacteria 1715
115 Ga0209256_1002668 3300025299 Bacteria 13996
116 Ga0209256_1004073 3300025299 Bacteria 9494
117 Ga0209051_1006709 3300025303 Bacteria 6432
118 Ga0209257_1000086 3300025304 Bacteria 287437
119 Ga0209257_1002739 3300025304 Bacteria 16704
120 Ga0207713_1000253 3300025735 Bacteria 66728
121 Ga0207713_1018070 3300025735 Bacteria 3503
122 Ga0207647_10001577 3300025904 Bacteria 17495
123 Ga0207647_10002201 3300025904 Bacteria 14867
124 Ga0207647_10069526 3300025904 Bacteria 2128
125 Ga0207705_10012336 3300025909 Bacteria 6174
126 Ga0207707_10012197 3300025912 Bacteria 7472
127 Ga0207707_10037343 3300025912 Bacteria 4245
128 Ga0207695_10001324 3300025913 Bacteria 41996
129 Ga0207671_10000462 3300025914 Bacteria 55713
130 Ga0207693_10064279 3300025915 Bacteria 2874
131 Ga0207693_10108075 3300025915 Bacteria 2182
132 Ga0207657_10024851 3300025919 Bacteria 5538
133 Ga0207649_10026144 3300025920 Bacteria 3412
134 Ga0207652_10252806 3300025921 Bacteria 1589
135 Ga0207694_10012417 3300025924 Bacteria 6420
136 Ga0207650_10025065 3300025925 Bacteria 4247
137 Ga0207664_10000135 3300025929 Bacteria 63546
138 Ga0207664_10001594 3300025929 Bacteria 14913
139 Ga0207644_10061885 3300025931 Bacteria 2712
140 Ga0207690_10009176 3300025932 Bacteria 5872
141 Ga0207690_10011991 3300025932 Bacteria 5183
142 Ga0207690_10015102 3300025932 Bacteria 4676
143 Ga0207690_10020275 3300025932 Bacteria 4105
144 Ga0207706_10015063 3300025933 Bacteria 7000
145 Ga0207709_10005256 3300025935 Bacteria 7363
146 Ga0207691_10025781 3300025940 Bacteria 5518
147 Ga0207667_10012587 3300025949 Bacteria 9732
148 Ga0207667_10025574 3300025949 Bacteria 6460
149 Ga0207667_10139810 3300025949 Bacteria 2493
150 Ga0207639_10008197 3300026041 Bacteria 7152
151 Ga0207678_10136942 3300026067 Bacteria 2089
152 Ga0207678_10170802 3300026067 Bacteria 1856
153 Ga0207702_10004774 3300026078 Bacteria 11945
154 Ga0207702_10060340 3300026078 Bacteria 3233
155 Ga0207648_10124797 3300026089 Bacteria 2264
156 Ga0207674_10012792 3300026116 Bacteria 9371
157 Ga0207683_10085985 3300026121 Bacteria 2796
158 Ga0209371_1000028 3300027312 Bacteria 429688
159 Ga0209371_1000048 3300027312 Bacteria 281705
160 Ga0209971_1000369 3300027682 Bacteria 12297
161 Ga0209971_1013242 3300027682 Bacteria 1954
162 Ga0209974_10026212 3300027876 Bacteria 1930
163 Ga0268266_10014860 3300028379 Bacteria 6685
164 Ga0268266_10124896 3300028379 Bacteria 2295
165 Ga0265334_10003804 3300028573 Bacteria 6823
166 Ga0268256_1000030 3300030500 Bacteria 429688
167 Ga0268256_1000049 3300030500 Bacteria 307229
168 Ga0316183_1052676 3300030742 Bacteria 2831
169 Ga0316181_1157645 3300030744 Bacteria 2121
170 Ga0316182_1029855 3300030745 Bacteria 2650
171 Ga0265330_10000045 3300031235 Bacteria 109977
172 Ga0265332_10000031 3300031238 Bacteria 162330
173 Ga0265325_10000849 3300031241 Bacteria 22093
174 Ga0307508_10153089 3300031616 Bacteria 1910
175 Ga0316575_10021352 3300031665 Unclassified 2492
176 Ga0265314_10000095 3300031711 Bacteria 134372
177 Ga0316576_10016979 3300031727 Bacteria 4935
178 Ga0316576_10019958 3300031727 Bacteria 4600
179 Ga0307410_10037350 3300031852 Bacteria 3172
180 Ga0307412_10174908 3300031911 Bacteria 1608
181 Ga0307414_10013781 3300032004 Bacteria 4823
182 Ga0307414_10025969 3300032004 Bacteria 3762
183 Ga0316580_10048101 3300032139 Bacteria 1314
184 Ga0307510_10096338 3300033180 Bacteria 2775
185 Ga0316596_1007433 3300033541 Bacteria 2588
186 Ga0316574_0001289 3300035398 Bacteria 11723
187 Ga0395899_0027147 3300037312 Bacteria 4319
188 Ga0395900_0004345 3300037418 Bacteria 15037
189 Ga0395905_0001042 3300037471 Bacteria 35110
190 Ga0395905_0054230 3300037471 Bacteria 3752
191 Ga0395901_0001304 3300038443 Bacteria 26281
192 Ga0395901_0001771 3300038443 Bacteria 22274
193 Ga0237819_00279 3300038705 Bacteria 18711
194 Ga0237819_08555 3300038705 Bacteria 1412
195 Ga0237816_00010 3300039145 Bacteria 11614
196 Ga0439465_0007576 3300041413 Bacteria 3446
197 Ga0451797_0461725 3300041453 Bacteria 2995
198 Ga0451797_0562437 3300041453 Bacteria 2520
199 Ga0451807_2174022 3300041486 Bacteria 4274
200 Ga0451837_0189825 3300041494 Bacteria 2447
201 Ga0439432_007154 3300042006 Bacteria 3966
202 Ga0439449_0003927 3300042007 Bacteria 5763
203 Ga0439449_0011636 3300042007 Bacteria 3310
204 Ga0439449_0011960 3300042007 Bacteria 3262
205 Ga0451577_0030683 3300042876 Bacteria 4855
206 Ga0466967_0332379 3300045976 Bacteria 1468
207 Ga0495627_037644 3300046453 Bacteria 1500
208 Ga0495638_0007566 3300046460 Bacteria 7771
209 Ga0495610_0001130 3300046512 Bacteria 24312
210 Ga0495631_0000369 3300046518 Bacteria 30975
211 Ga0495643_0000936 3300046522 Bacteria 30307
212 Ga0495663_0012694 3300046525 Bacteria 2349
213 Ga0495621_0000047 3300046539 Bacteria 24266
214 Ga0495633_0001525 3300046558 Bacteria 17819
215 Ga0495625_0032805 3300046660 Bacteria 3846
216 Ga0495659_0018285 3300046664 Bacteria 2334
217 Ga0495636_0001671 3300047318 Bacteria 8453
218 Ga0495636_0030184 3300047318 Bacteria 2215
219 Ga0495672_0000079 3300047320 Bacteria 161885
220 Ga0495672_0034540 3300047320 Bacteria 3123
221 Ga0495686_0005987 3300047472 Bacteria 9456
222 Ga0496108_0069385 3300048911 Bacteria 2974
223 Ga0496108_0101817 3300048911 Bacteria 2450
224 Ga0496109_0028725 3300048912 Bacteria 4978
225 Ga0496110_0331332 3300048913 Bacteria 1387
226 Ga0496112_0054371 3300048915 Bacteria 3933
227 Ga0496112_0336064 3300048915 Bacteria 1454
228 Ga0496113_0033493 3300048916 Bacteria 3741
229 Ga0496114_0001425 3300048917 Bacteria 18148
230 Ga0496115_0000092 3300048918 Bacteria 83381
231 Ga0496116_0000742 3300048919 Bacteria 41599
232 Ga0496116_0010746 3300048919 Bacteria 7641
233 Ga0496117_0000483 3300048920 Bacteria 66226
234 Ga0496117_0000763 3300048920 Bacteria 50659
235 Ga0496117_0001569 3300048920 Bacteria 32439
236 Ga0496118_0000732 3300048921 Bacteria 53036
237 Ga0496118_0007163 3300048921 Bacteria 11930
238 Ga0496118_0142964 3300048921 Bacteria 1512
239 Ga0496118_0175124 3300048921 Bacteria 1304
240 Ga0496119_0001225 3300048922 Bacteria 31961
241 Ga0496119_0001601 3300048922 Bacteria 26908
242 Ga0496120_0000262 3300048923 Bacteria 88205
243 Ga0496120_0000564 3300048923 Bacteria 56487
244 Ga0496121_0002092 3300048924 Bacteria 31479
245 Ga0496122_0000537 3300048925 Bacteria 78505
246 Ga0496122_0001070 3300048925 Bacteria 47552
247 Ga0496122_0210715 3300048925 Bacteria 1126
248 Ga0496123_0000541 3300048926 Bacteria 64921
249 Ga0496123_0000898 3300048926 Bacteria 47136
250 Ga0496124_0000384 3300048927 Bacteria 80610
251 Ga0496124_0001971 3300048927 Bacteria 28014
252 Ga0496124_0002812 3300048927 Bacteria 22045
253 Ga0496124_0010102 3300048927 Bacteria 9619
254 Ga0496124_0043200 3300048927 Bacteria 3875
255 Ga0496124_0124317 3300048927 Bacteria 2057
256 Ga0496125_0000475 3300048928 Bacteria 71075
257 Ga0496125_0001928 3300048928 Bacteria 28389
258 Ga0496125_0010968 3300048928 Bacteria 9101
259 Ga0496125_0014570 3300048928 Bacteria 7651
260 Ga0501031_0002690 3300049568 Bacteria 11312
261 Ga0501032_0003364 3300049569 Bacteria 12276
262 Ga0501032_0193724 3300049569 Bacteria 1328
263 Ga0501033_0029499 3300049570 Bacteria 4122
264 Ga0501034_0001201 3300049571 Bacteria 35561
265 Ga0501034_0002057 3300049571 Bacteria 25184
266 Ga0501034_0031988 3300049571 Bacteria 5344
267 Ga0501036_0015163 3300049572 Bacteria 6436
268 Ga0501036_0066856 3300049572 Bacteria 3042
269 Ga0501036_0099171 3300049572 Bacteria 2464
270 Ga0501037_0016465 3300049573 Bacteria 5441
271 Ga0501037_0071462 3300049573 Bacteria 2524
272 Ga0501038_0026218 3300049574 Bacteria 5191
273 Ga0501043_0020527 3300049579 Bacteria 5182
274 Ga0501046_0011021 3300049580 Bacteria 7746
275 Ga0501046_0133287 3300049580 Bacteria 1883
276 Ga0501047_0009308 3300049581 Bacteria 9277
277 Ga0501047_0072226 3300049581 Bacteria 3321
278 Ga0501070_0001008 3300049586 Bacteria 25249
279 Ga0501070_0015805 3300049586 Bacteria 6346
280 Ga0501070_0033241 3300049586 Bacteria 4316
281 Ga0501070_0207977 3300049586 Bacteria 1607
282 Ga0501073_0006334 3300049589 Bacteria 8812
283 Ga0501073_0037036 3300049589 Bacteria 3465
284 Ga0501073_0118680 3300049589 Bacteria 1833
285 Ga0501074_0004810 3300049590 Bacteria 9682
286 Ga0501074_0029424 3300049590 Bacteria 3978
287 Ga0501079_0081252 3300049741 Bacteria 2506
288 Ga0501080_0016888 3300049742 Bacteria 6741
289 Ga0501035_0007796 3300049822 Bacteria 10004
290 Ga0501035_0024811 3300049822 Bacteria 5498
291 Ga0501035_0031068 3300049822 Bacteria 4865
292 Ga0501044_0005279 3300049823 Bacteria 14367
293 Ga0501044_0017340 3300049823 Bacteria 7723
294 Ga0501044_0074457 3300049823 Bacteria 3449
295 Ga0501044_0189780 3300049823 Bacteria 2018
296 Ga0500622_0007234 3300053156 Bacteria 6321
297 Ga0500634_0008726 3300053161 Bacteria 5080
298 2538833887 2537561836 Bacteria 3910579
299 2547502137 2547132130 Bacteria 4660562
300 2572253618 2571042365 Bacteria 3289345
301 2578459813 2576861471 Bacteria 4648976
302 2643831776 2643221562 Bacteria 4048635
303 2643896104 2643221577 Bacteria 3710843
304 2643908329 2643221579 Bacteria 4443405
305 2643914633 2643221581 Bacteria 3893603
306 2644478311 2643221685 Bacteria 3673288
307 2644528927 2643221695 Bacteria 3441323
308 2687584898 2687453130 Bacteria 4227172
309 2747949671 2747842428 Bacteria 4689383
310 2748018988 2747842501 Bacteria 5293829
311 2765577492 2765235840 Bacteria 4663337
312 2816519262 2816332141 Bacteria 4436036
313 2819662465 2818991457 Bacteria 5323295
314 2842392487 2842391507 Bacteria 4486072
315 2842718313 2842718218 Bacteria 4560148
316 2842761379 2842757796 Bacteria 3981385
317 2852653466 2852649853 Bacteria 4036942
318 2852687818 2852684882 Bacteria 5463342
319 2857445815 2857442823 Bacteria 4562550
320 2874224342 2874220319 Bacteria 4594709
321 2894023902 2894023352 Bacteria 5167372
322 2894416779 2894414249 Bacteria 4405451
323 2895396240 2895395659 Bacteria 3983269
324 2895501453 2895498888 Bacteria 5283788
325 2895514596 2895511927 Bacteria 6802080
326 2895523922 2895522137 Bacteria 3284416
327 2895528266 2895525241 Bacteria 3388457
328 2919091976 2919089067 Bacteria 4560942
329 2919132009 2919130084 Bacteria 5301837
330 2919135236 2919134579 Bacteria 4480386
331 2923517060 2923516293 Bacteria 3716336
332 2928498608 2928496128 Bacteria 4631123
333 2929199252 2929195423 Bacteria 5325372
334 2931382253 2931380184 Bacteria 4455911
335 2937613064 2937610967 Bacteria 4618818
336 2939592397 2939589442 Bacteria 4214238
337 2939615436 2939611941 Bacteria 3892017
338 2939625369 2939622612 Bacteria 4698046
339 2939630325 2939626828 Bacteria 4695272
340 2941477550 2941475908 Bacteria 4145589
341 2961051106 2961047084 Bacteria 4594415
342 2961065405 2961064222 Bacteria 4749990
343 2974310250 2974307012 Bacteria 4172388
344 2974320717 2974320154 Bacteria 4571377
345 2977250977 2977247770 Bacteria 4160543
346 2984514530 2984514374 Bacteria 4172479
347 2987608904 2987605356 Bacteria 4187822
348 8021622557 8021622325 Bacteria 4844743
349 8021626725 8021626552 Bacteria 4665214
350 8021649211 8021648035 Bacteria 4772378
351 8057163844 8057160832 Bacteria 3268302
352 Ga0307410_10056071
353 JGI24739J22299_10033312
354 JGI24735J21928_10001173
355 JGI25157J39369_1000425
356 JGI25164J39214_1000259
357 JGI25152J39213_1000025
358 JGI25150J39212_1000066
359 JGI25151J46595_10000139
360 JGI25165J46597_1000379
361 JGI25153J46596_10000101
362 Ga0055533_1001936
363 Ga0055526_1001045
364 Ga0055537_1000028
365 Ga0055524_1008829
366 Ga0055536_1014313
367 Ga0055534_1000180
368 Ga0055528_1000262
369 Ga0055530_10000784
370 Ga0055530_10001799
371 Ga0058692_1000026
372 Ga0058692_1000040
373 Ga0065704_10070584
374 Ga0065704_10071027
375 Ga0070658_10270363
376 Ga0070670_100000327
377 Ga0070660_100014483
378 Ga0070668_100007980
379 Ga0070671_100014773
380 Ga0070671_100021105
381 Ga0070659_100005462
382 Ga0070659_100005978
383 Ga0070714_100000209
384 Ga0070713_100000941
385 Ga0070711_100221579
386 Ga0070663_100005378
387 Ga0070663_100031196
388 Ga0070678_100067569
389 Ga0070662_100078759
390 Ga0070681_10015355
391 Ga0068853_100039277
392 Ga0070696_100059795
393 Ga0070665_100385079
394 Ga0068855_100080392
395 Ga0068855_100385384
396 Ga0068856_100012146
397 Ga0068856_100015556
398 Ga0081539_10032374
399 Ga0075364_10000005
400 Ga0075364_10143153
401 Ga0070712_100018015
402 Ga0105251_10001131
403 Ga0105251_10004086
404 Ga0105244_10007450
405 Ga0105244_10020309
406 Ga0105240_10004091
407 Ga0105243_10009646
408 Ga0105242_10003311
409 Ga0105237_10001315
410 Ga0105238_10012451
411 Ga0105238_10013663
412 Ga0105238_10172341
413 Ga0105246_10057369
414 Ga0157371_10000658
415 Ga0157371_10006458
416 Ga0157370_10004714
417 Ga0157370_10012773
418 Ga0157370_10014062
419 Ga0157370_10034549
420 Ga0157370_10041445
421 Ga0157370_10064191
422 Ga0157369_10023991
423 Ga0157369_10122661
424 Ga0157369_10172733
425 Ga0157372_10008543
426 Ga0157372_10013068
427 Ga0182008_10000090
428 Ga0182008_10010326
429 Ga0182008_10048202
430 Ga0182006_1048555
431 Ga0182007_10000025
432 Ga0182007_10006817
433 Ga0182007_10011444
434 Ga0182007_10015357
435 Ga0182007_10024156
436 Ga0182005_1000063
437 Ga0182005_1002220
438 Ga0183368_1003
439 Ga0163161_10155563
440 Ga0209674_100033
441 Ga0207427_100101
442 Ga0209437_100090
443 Ga0209258_100622
444 Ga0207425_1000040
445 Ga0209646_1001250
446 Ga0209026_1000114
447 Ga0209026_1001808
448 Ga0209759_1001159
449 Ga0209759_1003000
450 Ga0209129_1000011
451 Ga0209233_1000077
452 Ga0209565_1000037
453 Ga0209455_1000254
454 Ga0209673_1000032
455 Ga0209675_1000020
456 Ga0209676_1000063
457 Ga0209676_1000149
458 Ga0209676_1000199
459 Ga0209676_1001331
460 Ga0209025_1000002
461 Ga0209564_1000951
462 Ga0209758_1000003
463 Ga0209050_1000189
464 Ga0209050_1000199
465 Ga0209050_1030189
466 Ga0209256_1002668
467 Ga0209256_1004073
468 Ga0209051_1006709
469 Ga0209257_1000086
470 Ga0209257_1002739
471 Ga0207713_1000253
472 Ga0207713_1018070
473 Ga0207647_10001577
474 Ga0207647_10002201
475 Ga0207647_10069526
476 Ga0207705_10012336
477 Ga0207707_10012197
478 Ga0207707_10037343
479 Ga0207695_10001324
480 Ga0207671_10000462
481 Ga0207693_10064279
482 Ga0207693_10108075
483 Ga0207657_10024851
484 Ga0207649_10026144
485 Ga0207652_10252806
486 Ga0207694_10012417
487 Ga0207650_10025065
488 Ga0207664_10000135
489 Ga0207664_10001594
490 Ga0207644_10061885
491 Ga0207690_10009176
492 Ga0207690_10011991
493 Ga0207690_10015102
494 Ga0207690_10020275
495 Ga0207706_10015063
496 Ga0207709_10005256
497 Ga0207691_10025781
498 Ga0207667_10012587
499 Ga0207667_10025574
500 Ga0207667_10139810
501 Ga0207639_10008197
502 Ga0207678_10136942
503 Ga0207678_10170802
504 Ga0207702_10004774
505 Ga0207702_10060340
506 Ga0207648_10124797
507 Ga0207674_10012792
508 Ga0207683_10085985
509 Ga0209371_1000028
510 Ga0209371_1000048
511 Ga0209971_1000369
512 Ga0209971_1013242
513 Ga0209974_10026212
514 Ga0268266_10014860
515 Ga0268266_10124896
516 Ga0265334_10003804
517 Ga0268256_1000030
518 Ga0268256_1000049
519 Ga0316183_1052676
520 Ga0316181_1157645
521 Ga0316182_1029855
522 Ga0265330_10000045
523 Ga0265332_10000031
524 Ga0265325_10000849
525 Ga0307508_10153089
526 Ga0316575_10021352
527 Ga0265314_10000095
528 Ga0316576_10016979
529 Ga0316576_10019958
530 Ga0307410_10037350
531 Ga0307412_10174908
532 Ga0307414_10013781
533 Ga0307414_10025969
534 Ga0316580_10048101
535 Ga0307510_10096338
536 Ga0316596_1007433
537 Ga0316574_0001289
538 Ga0395899_0027147
539 Ga0395900_0004345
540 Ga0395905_0001042
541 Ga0395905_0054230
542 Ga0395901_0001304
543 Ga0395901_0001771
544 Ga0237819_00279
545 Ga0237819_08555
546 Ga0237816_00010
547 Ga0439465_0007576
548 Ga0451797_0461725
549 Ga0451797_0562437
550 Ga0451807_2174022
551 Ga0451837_0189825
552 Ga0439432_007154
553 Ga0439449_0003927
554 Ga0439449_0011636
555 Ga0439449_0011960
556 Ga0451577_0030683
557 Ga0466967_0332379
558 Ga0495627_037644
559 Ga0495638_0007566
560 Ga0495610_0001130
561 Ga0495631_0000369
562 Ga0495643_0000936
563 Ga0495663_0012694
564 Ga0495621_0000047
565 Ga0495633_0001525
566 Ga0495625_0032805
567 Ga0495659_0018285
568 Ga0495636_0001671
569 Ga0495636_0030184
570 Ga0495672_0000079
571 Ga0495672_0034540
572 Ga0495686_0005987
573 Ga0496108_0069385
574 Ga0496108_0101817
575 Ga0496109_0028725
576 Ga0496110_0331332
577 Ga0496112_0054371
578 Ga0496112_0336064
579 Ga0496113_0033493
580 Ga0496114_0001425
581 Ga0496115_0000092
582 Ga0496116_0000742
583 Ga0496116_0010746
584 Ga0496117_0000483
585 Ga0496117_0000763
586 Ga0496117_0001569
587 Ga0496118_0000732
588 Ga0496118_0007163
589 Ga0496118_0142964
590 Ga0496118_0175124
591 Ga0496119_0001225
592 Ga0496119_0001601
593 Ga0496120_0000262
594 Ga0496120_0000564
595 Ga0496121_0002092
596 Ga0496122_0000537
597 Ga0496122_0001070
598 Ga0496122_0210715
599 Ga0496123_0000541
600 Ga0496123_0000898
601 Ga0496124_0000384
602 Ga0496124_0001971
603 Ga0496124_0002812
604 Ga0496124_0010102
605 Ga0496124_0043200
606 Ga0496124_0124317
607 Ga0496125_0000475
608 Ga0496125_0001928
609 Ga0496125_0010968
610 Ga0496125_0014570
611 Ga0501031_0002690
612 Ga0501032_0003364
613 Ga0501032_0193724
614 Ga0501033_0029499
615 Ga0501034_0001201
616 Ga0501034_0002057
617 Ga0501034_0031988
618 Ga0501036_0015163
619 Ga0501036_0066856
620 Ga0501036_0099171
621 Ga0501037_0016465
622 Ga0501037_0071462
623 Ga0501038_0026218
624 Ga0501043_0020527
625 Ga0501046_0011021
626 Ga0501046_0133287
627 Ga0501047_0009308
628 Ga0501047_0072226
629 Ga0501070_0001008
630 Ga0501070_0015805
631 Ga0501070_0033241
632 Ga0501070_0207977
633 Ga0501073_0006334
634 Ga0501073_0037036
635 Ga0501073_0118680
636 Ga0501074_0004810
637 Ga0501074_0029424
638 Ga0501079_0081252
639 Ga0501080_0016888
640 Ga0501035_0007796
641 Ga0501035_0024811
642 Ga0501035_0031068
643 Ga0501044_0005279
644 Ga0501044_0017340
645 Ga0501044_0074457
646 Ga0501044_0189780
647 Ga0500622_0007234
648 Ga0500634_0008726
649 2538833887
650 2547502137
651 2572253618
652 2578459813
653 2643831776
654 2643896104
655 2643908329
656 2643914633
657 2644478311
658 2644528927
659 2687584898
660 2747949671
661 2748018988
662 2765577492
663 2816519262
664 2819662465
665 2842392487
666 2842718313
667 2842761379
668 2852653466
669 2852687818
670 2857445815
671 2874224342
672 2894023902
673 2894416779
674 2895396240
675 2895501453
676 2895514596
677 2895523922
678 2895528266
679 2919091976
680 2919132009
681 2919135236
682 2923517060
683 2928498608
684 2929199252
685 2931382253
686 2937613064
687 2939592397
688 2939615436
689 2939625369
690 2939630325
691 2941477550
692 2961051106
693 2961065405
694 2974310250
695 2974320717
696 2977250977
697 2984514530
698 2987608904
699 8021622557
700 8021626725
701 8021649211
702 8057163844

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

11

254

0.93

PF02801

Ketoacyl-synt_C

Beta-ketoacyl synthase, C-terminal domain

262

377

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pps-assembly1.cif.gz_B apo fabb from pseudomonas aeruginosa with single point mutation c161a 0.9887 1 398
2byy-assembly1.cif.gz_A e.coli kas i h298e mutation 0.9876 1 398
2byx-assembly2.cif.gz_D kas i lys328ala mutant in complex with fatty acid 0.9874 1 398
2bz4-assembly2.cif.gz_C structure of e.coli kas i h298q mutant 0.9873 1 398
2cdh-assembly1.cif.gz_A architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. 0.9872 1 398
ID Description Score Start End Superfamily
1dd8A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.985 6 253 3.40.47.10
4xoxB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9589 255 398 3.40.47.10
1dd8A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9583 6 253 3.40.47.10
af_Q0E328_1_239_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9574 177 396 3.40.47.10
af_C6KT99_32_472_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9523 2 398 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A1B0C5T0-F1-model_v4 Chorismate synthase (EC 4.2.3.5) 0.989 15 398 GO:0003700
GO:0004107
GO:0004315
GO:0005829
GO:0006633
GO:0008652
GO:0009073
GO:0009423
GO:0010181
AF-A0A448QMU6-F1-model_v4 deleted 0.9885 1 309
AF-A0A2D7FCW2-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] synthase 1 (EC 2.3.1.41) (3-oxoacyl-[acyl-carrier-protein] synthase I) (Beta-ketoacyl-ACP synthase I) 0.9876 1 398 GO:0004315
GO:0005829
GO:0006633
AF-A0A6L8G3B9-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] synthase 1 (EC 2.3.1.41) (3-oxoacyl-[acyl-carrier-protein] synthase I) (Beta-ketoacyl-ACP synthase I) 0.9868 1 276 GO:0004315
GO:0005829
GO:0006633
AF-A0A508STJ7-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] synthase 1 (EC 2.3.1.41) (3-oxoacyl-[acyl-carrier-protein] synthase I) (Beta-ketoacyl-ACP synthase I) 0.9862 1 398 GO:0004315
GO:0005829
GO:0006633

Map