F418692
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 351 | 245 | 702 | 402 |
Family's Representative Sequence
| Representative Sequence | 3300031852|Ga0307410_10056071|Ga0307410_100560713 |
| Length | 420 |
| Sequence | MESAAGKPASGKRVVVTGMGIVSPLGNDAASVASALREGRSGLRAMPEYAELGLRSQVAGAPDIDLDAAVDRKLKRFMGDAAAYAYVSMRDAIADAGLSDEQVRDPRTGVIAGSGGGSPQWQVETGDLLRAKGVRRVGPYMVPRTMCSTVSASLATAFGIRGVSYSISAACATSAHCIGAAADMIRHGVQDVVVAGGGEELHWGMTVQFDAMGALSTHFNDTPQRASRPYDVDRDGFVIAGGGGMLVLESYEHAMARGARIHAELTGYGVTSDGADMVAPSGEGAVRCMRMALAGLEGQGDGIAMVDYLNTHGTSTPVGDVVELEAVREAFGEGRVPPLSSTKALTGHSLGAASVHEAIYSLLMLQGGFMAASANIESLDPRAEGFPIVRELREGPLRTVMSNSFGFGGTNASLVFSRID |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 41 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 55 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 57 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 58 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 59 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 67 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 68 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 112 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 113 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 114 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 115 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 116 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 117 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 119 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 120 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 121 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 123 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 124 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 125 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 126 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 127 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 129 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 130 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 131 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 132 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 133 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 134 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 135 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 136 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 137 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 138 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 139 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 140 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 141 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 142 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 143 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 159 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 160 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 161 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 162 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 163 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 164 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 165 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 166 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 167 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 168 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 169 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 170 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 171 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 172 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 173 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 191 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 192 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 193 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 194 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 195 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 196 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 197 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 198 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 199 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 200 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 201 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 202 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 203 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 204 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 205 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 206 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 207 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 208 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 209 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 210 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 211 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 212 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 213 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 214 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 215 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 216 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 217 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 218 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 219 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 220 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 221 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 222 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 223 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 224 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 225 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 226 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 227 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 228 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 229 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 230 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 231 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 232 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 233 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 234 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 235 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 236 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 237 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 238 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 239 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 240 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 241 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 242 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 243 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 244 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 245 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.33 |
| Metatranscriptomes | 0.28 |
| Isolates | 15.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.28 |
| Bulb | 0 |
| Endosphere | 12.82 |
| Nodule | 0.57 |
| Rhizoplane | 3.42 |
| Rhizosphere | 63.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307410_10056071 | 3300031852 | Bacteria | 2678 |
| 2 | JGI24739J22299_10033312 | 3300001989 | Bacteria | 1764 |
| 3 | JGI24735J21928_10001173 | 3300002067 | Bacteria | 9376 |
| 4 | JGI25157J39369_1000425 | 3300002741 | Bacteria | 27809 |
| 5 | JGI25164J39214_1000259 | 3300002772 | Bacteria | 39804 |
| 6 | JGI25152J39213_1000025 | 3300002773 | Bacteria | 103262 |
| 7 | JGI25150J39212_1000066 | 3300002774 | Bacteria | 63677 |
| 8 | JGI25151J46595_10000139 | 3300003187 | Bacteria | 96000 |
| 9 | JGI25165J46597_1000379 | 3300003214 | Bacteria | 48698 |
| 10 | JGI25153J46596_10000101 | 3300003215 | Bacteria | 96639 |
| 11 | Ga0055533_1001936 | 3300003756 | Bacteria | 5106 |
| 12 | Ga0055526_1001045 | 3300003771 | Bacteria | 20206 |
| 13 | Ga0055537_1000028 | 3300003773 | Bacteria | 102200 |
| 14 | Ga0055524_1008829 | 3300003775 | Bacteria | 4153 |
| 15 | Ga0055536_1014313 | 3300003781 | Bacteria | 2798 |
| 16 | Ga0055534_1000180 | 3300003784 | Bacteria | 46550 |
| 17 | Ga0055528_1000262 | 3300003790 | Bacteria | 44658 |
| 18 | Ga0055530_10000784 | 3300003791 | Bacteria | 26455 |
| 19 | Ga0055530_10001799 | 3300003791 | Bacteria | 14874 |
| 20 | Ga0058692_1000026 | 3300003856 | Bacteria | 203096 |
| 21 | Ga0058692_1000040 | 3300003856 | Bacteria | 132805 |
| 22 | Ga0065704_10070584 | 3300005289 | Bacteria | 19772 |
| 23 | Ga0065704_10071027 | 3300005289 | Bacteria | 13649 |
| 24 | Ga0070658_10270363 | 3300005327 | Bacteria | 1445 |
| 25 | Ga0070670_100000327 | 3300005331 | Bacteria | 40304 |
| 26 | Ga0070660_100014483 | 3300005339 | Bacteria | 5682 |
| 27 | Ga0070668_100007980 | 3300005347 | Bacteria | 7863 |
| 28 | Ga0070671_100014773 | 3300005355 | Bacteria | 6310 |
| 29 | Ga0070671_100021105 | 3300005355 | Bacteria | 5318 |
| 30 | Ga0070659_100005462 | 3300005366 | Bacteria | 9133 |
| 31 | Ga0070659_100005978 | 3300005366 | Bacteria | 8773 |
| 32 | Ga0070714_100000209 | 3300005435 | Bacteria | 47271 |
| 33 | Ga0070713_100000941 | 3300005436 | Bacteria | 18599 |
| 34 | Ga0070711_100221579 | 3300005439 | Bacteria | 1471 |
| 35 | Ga0070663_100005378 | 3300005455 | Bacteria | 7606 |
| 36 | Ga0070663_100031196 | 3300005455 | Bacteria | 3661 |
| 37 | Ga0070678_100067569 | 3300005456 | Bacteria | 2661 |
| 38 | Ga0070662_100078759 | 3300005457 | Bacteria | 2449 |
| 39 | Ga0070681_10015355 | 3300005458 | Bacteria | 7618 |
| 40 | Ga0068853_100039277 | 3300005539 | Bacteria | 4036 |
| 41 | Ga0070696_100059795 | 3300005546 | Bacteria | 2664 |
| 42 | Ga0070665_100385079 | 3300005548 | Bacteria | 1410 |
| 43 | Ga0068855_100080392 | 3300005563 | Bacteria | 3779 |
| 44 | Ga0068855_100385384 | 3300005563 | Bacteria | 1538 |
| 45 | Ga0068856_100012146 | 3300005614 | Bacteria | 8342 |
| 46 | Ga0068856_100015556 | 3300005614 | Bacteria | 7354 |
| 47 | Ga0081539_10032374 | 3300005985 | Bacteria | 3203 |
| 48 | Ga0075364_10000005 | 3300006051 | Bacteria | 93405 |
| 49 | Ga0075364_10143153 | 3300006051 | Bacteria | 1609 |
| 50 | Ga0070712_100018015 | 3300006175 | Bacteria | 4581 |
| 51 | Ga0105251_10001131 | 3300009011 | Bacteria | 23181 |
| 52 | Ga0105251_10004086 | 3300009011 | Bacteria | 10221 |
| 53 | Ga0105244_10007450 | 3300009036 | Bacteria | 6958 |
| 54 | Ga0105244_10020309 | 3300009036 | Bacteria | 3693 |
| 55 | Ga0105240_10004091 | 3300009093 | Bacteria | 22410 |
| 56 | Ga0105243_10009646 | 3300009148 | Bacteria | 7349 |
| 57 | Ga0105242_10003311 | 3300009176 | Bacteria | 12543 |
| 58 | Ga0105237_10001315 | 3300009545 | Bacteria | 32979 |
| 59 | Ga0105238_10012451 | 3300009551 | Bacteria | 8580 |
| 60 | Ga0105238_10013663 | 3300009551 | Bacteria | 8199 |
| 61 | Ga0105238_10172341 | 3300009551 | Bacteria | 2140 |
| 62 | Ga0105246_10057369 | 3300011119 | Bacteria | 2694 |
| 63 | Ga0157371_10000658 | 3300013102 | Bacteria | 40993 |
| 64 | Ga0157371_10006458 | 3300013102 | Bacteria | 9667 |
| 65 | Ga0157370_10004714 | 3300013104 | Bacteria | 15541 |
| 66 | Ga0157370_10012773 | 3300013104 | Bacteria | 8686 |
| 67 | Ga0157370_10014062 | 3300013104 | Bacteria | 8213 |
| 68 | Ga0157370_10034549 | 3300013104 | Bacteria | 4921 |
| 69 | Ga0157370_10041445 | 3300013104 | Bacteria | 4441 |
| 70 | Ga0157370_10064191 | 3300013104 | Bacteria | 3477 |
| 71 | Ga0157369_10023991 | 3300013105 | Bacteria | 6786 |
| 72 | Ga0157369_10122661 | 3300013105 | Bacteria | 2756 |
| 73 | Ga0157369_10172733 | 3300013105 | Bacteria | 2277 |
| 74 | Ga0157372_10008543 | 3300013307 | Bacteria | 10876 |
| 75 | Ga0157372_10013068 | 3300013307 | Bacteria | 8857 |
| 76 | Ga0182008_10000090 | 3300014497 | Bacteria | 69702 |
| 77 | Ga0182008_10010326 | 3300014497 | Bacteria | 4999 |
| 78 | Ga0182008_10048202 | 3300014497 | Bacteria | 2116 |
| 79 | Ga0182006_1048555 | 3300015261 | Bacteria | 1641 |
| 80 | Ga0182007_10000025 | 3300015262 | Bacteria | 172058 |
| 81 | Ga0182007_10006817 | 3300015262 | Bacteria | 4860 |
| 82 | Ga0182007_10011444 | 3300015262 | Bacteria | 3455 |
| 83 | Ga0182007_10015357 | 3300015262 | Bacteria | 2859 |
| 84 | Ga0182007_10024156 | 3300015262 | Bacteria | 2130 |
| 85 | Ga0182005_1000063 | 3300015265 | Bacteria | 97663 |
| 86 | Ga0182005_1002220 | 3300015265 | Bacteria | 7135 |
| 87 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 88 | Ga0163161_10155563 | 3300017792 | Bacteria | 1740 |
| 89 | Ga0209674_100033 | 3300025226 | Bacteria | 423450 |
| 90 | Ga0207427_100101 | 3300025231 | Bacteria | 120866 |
| 91 | Ga0209437_100090 | 3300025233 | Bacteria | 247138 |
| 92 | Ga0209258_100622 | 3300025242 | Bacteria | 28085 |
| 93 | Ga0207425_1000040 | 3300025245 | Bacteria | 218121 |
| 94 | Ga0209646_1001250 | 3300025246 | Bacteria | 7210 |
| 95 | Ga0209026_1000114 | 3300025250 | Bacteria | 136985 |
| 96 | Ga0209026_1001808 | 3300025250 | Bacteria | 8817 |
| 97 | Ga0209759_1001159 | 3300025256 | Bacteria | 16722 |
| 98 | Ga0209759_1003000 | 3300025256 | Bacteria | 6989 |
| 99 | Ga0209129_1000011 | 3300025258 | Bacteria | 568657 |
| 100 | Ga0209233_1000077 | 3300025261 | Bacteria | 349570 |
| 101 | Ga0209565_1000037 | 3300025263 | Bacteria | 289371 |
| 102 | Ga0209455_1000254 | 3300025272 | Bacteria | 62595 |
| 103 | Ga0209673_1000032 | 3300025273 | Bacteria | 339956 |
| 104 | Ga0209675_1000020 | 3300025291 | Bacteria | 335854 |
| 105 | Ga0209676_1000063 | 3300025292 | Bacteria | 322025 |
| 106 | Ga0209676_1000149 | 3300025292 | Bacteria | 167854 |
| 107 | Ga0209676_1000199 | 3300025292 | Bacteria | 134270 |
| 108 | Ga0209676_1001331 | 3300025292 | Bacteria | 24900 |
| 109 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 110 | Ga0209564_1000951 | 3300025295 | Bacteria | 37038 |
| 111 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 112 | Ga0209050_1000189 | 3300025298 | Bacteria | 138610 |
| 113 | Ga0209050_1000199 | 3300025298 | Bacteria | 134682 |
| 114 | Ga0209050_1030189 | 3300025298 | Bacteria | 1715 |
| 115 | Ga0209256_1002668 | 3300025299 | Bacteria | 13996 |
| 116 | Ga0209256_1004073 | 3300025299 | Bacteria | 9494 |
| 117 | Ga0209051_1006709 | 3300025303 | Bacteria | 6432 |
| 118 | Ga0209257_1000086 | 3300025304 | Bacteria | 287437 |
| 119 | Ga0209257_1002739 | 3300025304 | Bacteria | 16704 |
| 120 | Ga0207713_1000253 | 3300025735 | Bacteria | 66728 |
| 121 | Ga0207713_1018070 | 3300025735 | Bacteria | 3503 |
| 122 | Ga0207647_10001577 | 3300025904 | Bacteria | 17495 |
| 123 | Ga0207647_10002201 | 3300025904 | Bacteria | 14867 |
| 124 | Ga0207647_10069526 | 3300025904 | Bacteria | 2128 |
| 125 | Ga0207705_10012336 | 3300025909 | Bacteria | 6174 |
| 126 | Ga0207707_10012197 | 3300025912 | Bacteria | 7472 |
| 127 | Ga0207707_10037343 | 3300025912 | Bacteria | 4245 |
| 128 | Ga0207695_10001324 | 3300025913 | Bacteria | 41996 |
| 129 | Ga0207671_10000462 | 3300025914 | Bacteria | 55713 |
| 130 | Ga0207693_10064279 | 3300025915 | Bacteria | 2874 |
| 131 | Ga0207693_10108075 | 3300025915 | Bacteria | 2182 |
| 132 | Ga0207657_10024851 | 3300025919 | Bacteria | 5538 |
| 133 | Ga0207649_10026144 | 3300025920 | Bacteria | 3412 |
| 134 | Ga0207652_10252806 | 3300025921 | Bacteria | 1589 |
| 135 | Ga0207694_10012417 | 3300025924 | Bacteria | 6420 |
| 136 | Ga0207650_10025065 | 3300025925 | Bacteria | 4247 |
| 137 | Ga0207664_10000135 | 3300025929 | Bacteria | 63546 |
| 138 | Ga0207664_10001594 | 3300025929 | Bacteria | 14913 |
| 139 | Ga0207644_10061885 | 3300025931 | Bacteria | 2712 |
| 140 | Ga0207690_10009176 | 3300025932 | Bacteria | 5872 |
| 141 | Ga0207690_10011991 | 3300025932 | Bacteria | 5183 |
| 142 | Ga0207690_10015102 | 3300025932 | Bacteria | 4676 |
| 143 | Ga0207690_10020275 | 3300025932 | Bacteria | 4105 |
| 144 | Ga0207706_10015063 | 3300025933 | Bacteria | 7000 |
| 145 | Ga0207709_10005256 | 3300025935 | Bacteria | 7363 |
| 146 | Ga0207691_10025781 | 3300025940 | Bacteria | 5518 |
| 147 | Ga0207667_10012587 | 3300025949 | Bacteria | 9732 |
| 148 | Ga0207667_10025574 | 3300025949 | Bacteria | 6460 |
| 149 | Ga0207667_10139810 | 3300025949 | Bacteria | 2493 |
| 150 | Ga0207639_10008197 | 3300026041 | Bacteria | 7152 |
| 151 | Ga0207678_10136942 | 3300026067 | Bacteria | 2089 |
| 152 | Ga0207678_10170802 | 3300026067 | Bacteria | 1856 |
| 153 | Ga0207702_10004774 | 3300026078 | Bacteria | 11945 |
| 154 | Ga0207702_10060340 | 3300026078 | Bacteria | 3233 |
| 155 | Ga0207648_10124797 | 3300026089 | Bacteria | 2264 |
| 156 | Ga0207674_10012792 | 3300026116 | Bacteria | 9371 |
| 157 | Ga0207683_10085985 | 3300026121 | Bacteria | 2796 |
| 158 | Ga0209371_1000028 | 3300027312 | Bacteria | 429688 |
| 159 | Ga0209371_1000048 | 3300027312 | Bacteria | 281705 |
| 160 | Ga0209971_1000369 | 3300027682 | Bacteria | 12297 |
| 161 | Ga0209971_1013242 | 3300027682 | Bacteria | 1954 |
| 162 | Ga0209974_10026212 | 3300027876 | Bacteria | 1930 |
| 163 | Ga0268266_10014860 | 3300028379 | Bacteria | 6685 |
| 164 | Ga0268266_10124896 | 3300028379 | Bacteria | 2295 |
| 165 | Ga0265334_10003804 | 3300028573 | Bacteria | 6823 |
| 166 | Ga0268256_1000030 | 3300030500 | Bacteria | 429688 |
| 167 | Ga0268256_1000049 | 3300030500 | Bacteria | 307229 |
| 168 | Ga0316183_1052676 | 3300030742 | Bacteria | 2831 |
| 169 | Ga0316181_1157645 | 3300030744 | Bacteria | 2121 |
| 170 | Ga0316182_1029855 | 3300030745 | Bacteria | 2650 |
| 171 | Ga0265330_10000045 | 3300031235 | Bacteria | 109977 |
| 172 | Ga0265332_10000031 | 3300031238 | Bacteria | 162330 |
| 173 | Ga0265325_10000849 | 3300031241 | Bacteria | 22093 |
| 174 | Ga0307508_10153089 | 3300031616 | Bacteria | 1910 |
| 175 | Ga0316575_10021352 | 3300031665 | Unclassified | 2492 |
| 176 | Ga0265314_10000095 | 3300031711 | Bacteria | 134372 |
| 177 | Ga0316576_10016979 | 3300031727 | Bacteria | 4935 |
| 178 | Ga0316576_10019958 | 3300031727 | Bacteria | 4600 |
| 179 | Ga0307410_10037350 | 3300031852 | Bacteria | 3172 |
| 180 | Ga0307412_10174908 | 3300031911 | Bacteria | 1608 |
| 181 | Ga0307414_10013781 | 3300032004 | Bacteria | 4823 |
| 182 | Ga0307414_10025969 | 3300032004 | Bacteria | 3762 |
| 183 | Ga0316580_10048101 | 3300032139 | Bacteria | 1314 |
| 184 | Ga0307510_10096338 | 3300033180 | Bacteria | 2775 |
| 185 | Ga0316596_1007433 | 3300033541 | Bacteria | 2588 |
| 186 | Ga0316574_0001289 | 3300035398 | Bacteria | 11723 |
| 187 | Ga0395899_0027147 | 3300037312 | Bacteria | 4319 |
| 188 | Ga0395900_0004345 | 3300037418 | Bacteria | 15037 |
| 189 | Ga0395905_0001042 | 3300037471 | Bacteria | 35110 |
| 190 | Ga0395905_0054230 | 3300037471 | Bacteria | 3752 |
| 191 | Ga0395901_0001304 | 3300038443 | Bacteria | 26281 |
| 192 | Ga0395901_0001771 | 3300038443 | Bacteria | 22274 |
| 193 | Ga0237819_00279 | 3300038705 | Bacteria | 18711 |
| 194 | Ga0237819_08555 | 3300038705 | Bacteria | 1412 |
| 195 | Ga0237816_00010 | 3300039145 | Bacteria | 11614 |
| 196 | Ga0439465_0007576 | 3300041413 | Bacteria | 3446 |
| 197 | Ga0451797_0461725 | 3300041453 | Bacteria | 2995 |
| 198 | Ga0451797_0562437 | 3300041453 | Bacteria | 2520 |
| 199 | Ga0451807_2174022 | 3300041486 | Bacteria | 4274 |
| 200 | Ga0451837_0189825 | 3300041494 | Bacteria | 2447 |
| 201 | Ga0439432_007154 | 3300042006 | Bacteria | 3966 |
| 202 | Ga0439449_0003927 | 3300042007 | Bacteria | 5763 |
| 203 | Ga0439449_0011636 | 3300042007 | Bacteria | 3310 |
| 204 | Ga0439449_0011960 | 3300042007 | Bacteria | 3262 |
| 205 | Ga0451577_0030683 | 3300042876 | Bacteria | 4855 |
| 206 | Ga0466967_0332379 | 3300045976 | Bacteria | 1468 |
| 207 | Ga0495627_037644 | 3300046453 | Bacteria | 1500 |
| 208 | Ga0495638_0007566 | 3300046460 | Bacteria | 7771 |
| 209 | Ga0495610_0001130 | 3300046512 | Bacteria | 24312 |
| 210 | Ga0495631_0000369 | 3300046518 | Bacteria | 30975 |
| 211 | Ga0495643_0000936 | 3300046522 | Bacteria | 30307 |
| 212 | Ga0495663_0012694 | 3300046525 | Bacteria | 2349 |
| 213 | Ga0495621_0000047 | 3300046539 | Bacteria | 24266 |
| 214 | Ga0495633_0001525 | 3300046558 | Bacteria | 17819 |
| 215 | Ga0495625_0032805 | 3300046660 | Bacteria | 3846 |
| 216 | Ga0495659_0018285 | 3300046664 | Bacteria | 2334 |
| 217 | Ga0495636_0001671 | 3300047318 | Bacteria | 8453 |
| 218 | Ga0495636_0030184 | 3300047318 | Bacteria | 2215 |
| 219 | Ga0495672_0000079 | 3300047320 | Bacteria | 161885 |
| 220 | Ga0495672_0034540 | 3300047320 | Bacteria | 3123 |
| 221 | Ga0495686_0005987 | 3300047472 | Bacteria | 9456 |
| 222 | Ga0496108_0069385 | 3300048911 | Bacteria | 2974 |
| 223 | Ga0496108_0101817 | 3300048911 | Bacteria | 2450 |
| 224 | Ga0496109_0028725 | 3300048912 | Bacteria | 4978 |
| 225 | Ga0496110_0331332 | 3300048913 | Bacteria | 1387 |
| 226 | Ga0496112_0054371 | 3300048915 | Bacteria | 3933 |
| 227 | Ga0496112_0336064 | 3300048915 | Bacteria | 1454 |
| 228 | Ga0496113_0033493 | 3300048916 | Bacteria | 3741 |
| 229 | Ga0496114_0001425 | 3300048917 | Bacteria | 18148 |
| 230 | Ga0496115_0000092 | 3300048918 | Bacteria | 83381 |
| 231 | Ga0496116_0000742 | 3300048919 | Bacteria | 41599 |
| 232 | Ga0496116_0010746 | 3300048919 | Bacteria | 7641 |
| 233 | Ga0496117_0000483 | 3300048920 | Bacteria | 66226 |
| 234 | Ga0496117_0000763 | 3300048920 | Bacteria | 50659 |
| 235 | Ga0496117_0001569 | 3300048920 | Bacteria | 32439 |
| 236 | Ga0496118_0000732 | 3300048921 | Bacteria | 53036 |
| 237 | Ga0496118_0007163 | 3300048921 | Bacteria | 11930 |
| 238 | Ga0496118_0142964 | 3300048921 | Bacteria | 1512 |
| 239 | Ga0496118_0175124 | 3300048921 | Bacteria | 1304 |
| 240 | Ga0496119_0001225 | 3300048922 | Bacteria | 31961 |
| 241 | Ga0496119_0001601 | 3300048922 | Bacteria | 26908 |
| 242 | Ga0496120_0000262 | 3300048923 | Bacteria | 88205 |
| 243 | Ga0496120_0000564 | 3300048923 | Bacteria | 56487 |
| 244 | Ga0496121_0002092 | 3300048924 | Bacteria | 31479 |
| 245 | Ga0496122_0000537 | 3300048925 | Bacteria | 78505 |
| 246 | Ga0496122_0001070 | 3300048925 | Bacteria | 47552 |
| 247 | Ga0496122_0210715 | 3300048925 | Bacteria | 1126 |
| 248 | Ga0496123_0000541 | 3300048926 | Bacteria | 64921 |
| 249 | Ga0496123_0000898 | 3300048926 | Bacteria | 47136 |
| 250 | Ga0496124_0000384 | 3300048927 | Bacteria | 80610 |
| 251 | Ga0496124_0001971 | 3300048927 | Bacteria | 28014 |
| 252 | Ga0496124_0002812 | 3300048927 | Bacteria | 22045 |
| 253 | Ga0496124_0010102 | 3300048927 | Bacteria | 9619 |
| 254 | Ga0496124_0043200 | 3300048927 | Bacteria | 3875 |
| 255 | Ga0496124_0124317 | 3300048927 | Bacteria | 2057 |
| 256 | Ga0496125_0000475 | 3300048928 | Bacteria | 71075 |
| 257 | Ga0496125_0001928 | 3300048928 | Bacteria | 28389 |
| 258 | Ga0496125_0010968 | 3300048928 | Bacteria | 9101 |
| 259 | Ga0496125_0014570 | 3300048928 | Bacteria | 7651 |
| 260 | Ga0501031_0002690 | 3300049568 | Bacteria | 11312 |
| 261 | Ga0501032_0003364 | 3300049569 | Bacteria | 12276 |
| 262 | Ga0501032_0193724 | 3300049569 | Bacteria | 1328 |
| 263 | Ga0501033_0029499 | 3300049570 | Bacteria | 4122 |
| 264 | Ga0501034_0001201 | 3300049571 | Bacteria | 35561 |
| 265 | Ga0501034_0002057 | 3300049571 | Bacteria | 25184 |
| 266 | Ga0501034_0031988 | 3300049571 | Bacteria | 5344 |
| 267 | Ga0501036_0015163 | 3300049572 | Bacteria | 6436 |
| 268 | Ga0501036_0066856 | 3300049572 | Bacteria | 3042 |
| 269 | Ga0501036_0099171 | 3300049572 | Bacteria | 2464 |
| 270 | Ga0501037_0016465 | 3300049573 | Bacteria | 5441 |
| 271 | Ga0501037_0071462 | 3300049573 | Bacteria | 2524 |
| 272 | Ga0501038_0026218 | 3300049574 | Bacteria | 5191 |
| 273 | Ga0501043_0020527 | 3300049579 | Bacteria | 5182 |
| 274 | Ga0501046_0011021 | 3300049580 | Bacteria | 7746 |
| 275 | Ga0501046_0133287 | 3300049580 | Bacteria | 1883 |
| 276 | Ga0501047_0009308 | 3300049581 | Bacteria | 9277 |
| 277 | Ga0501047_0072226 | 3300049581 | Bacteria | 3321 |
| 278 | Ga0501070_0001008 | 3300049586 | Bacteria | 25249 |
| 279 | Ga0501070_0015805 | 3300049586 | Bacteria | 6346 |
| 280 | Ga0501070_0033241 | 3300049586 | Bacteria | 4316 |
| 281 | Ga0501070_0207977 | 3300049586 | Bacteria | 1607 |
| 282 | Ga0501073_0006334 | 3300049589 | Bacteria | 8812 |
| 283 | Ga0501073_0037036 | 3300049589 | Bacteria | 3465 |
| 284 | Ga0501073_0118680 | 3300049589 | Bacteria | 1833 |
| 285 | Ga0501074_0004810 | 3300049590 | Bacteria | 9682 |
| 286 | Ga0501074_0029424 | 3300049590 | Bacteria | 3978 |
| 287 | Ga0501079_0081252 | 3300049741 | Bacteria | 2506 |
| 288 | Ga0501080_0016888 | 3300049742 | Bacteria | 6741 |
| 289 | Ga0501035_0007796 | 3300049822 | Bacteria | 10004 |
| 290 | Ga0501035_0024811 | 3300049822 | Bacteria | 5498 |
| 291 | Ga0501035_0031068 | 3300049822 | Bacteria | 4865 |
| 292 | Ga0501044_0005279 | 3300049823 | Bacteria | 14367 |
| 293 | Ga0501044_0017340 | 3300049823 | Bacteria | 7723 |
| 294 | Ga0501044_0074457 | 3300049823 | Bacteria | 3449 |
| 295 | Ga0501044_0189780 | 3300049823 | Bacteria | 2018 |
| 296 | Ga0500622_0007234 | 3300053156 | Bacteria | 6321 |
| 297 | Ga0500634_0008726 | 3300053161 | Bacteria | 5080 |
| 298 | 2538833887 | 2537561836 | Bacteria | 3910579 |
| 299 | 2547502137 | 2547132130 | Bacteria | 4660562 |
| 300 | 2572253618 | 2571042365 | Bacteria | 3289345 |
| 301 | 2578459813 | 2576861471 | Bacteria | 4648976 |
| 302 | 2643831776 | 2643221562 | Bacteria | 4048635 |
| 303 | 2643896104 | 2643221577 | Bacteria | 3710843 |
| 304 | 2643908329 | 2643221579 | Bacteria | 4443405 |
| 305 | 2643914633 | 2643221581 | Bacteria | 3893603 |
| 306 | 2644478311 | 2643221685 | Bacteria | 3673288 |
| 307 | 2644528927 | 2643221695 | Bacteria | 3441323 |
| 308 | 2687584898 | 2687453130 | Bacteria | 4227172 |
| 309 | 2747949671 | 2747842428 | Bacteria | 4689383 |
| 310 | 2748018988 | 2747842501 | Bacteria | 5293829 |
| 311 | 2765577492 | 2765235840 | Bacteria | 4663337 |
| 312 | 2816519262 | 2816332141 | Bacteria | 4436036 |
| 313 | 2819662465 | 2818991457 | Bacteria | 5323295 |
| 314 | 2842392487 | 2842391507 | Bacteria | 4486072 |
| 315 | 2842718313 | 2842718218 | Bacteria | 4560148 |
| 316 | 2842761379 | 2842757796 | Bacteria | 3981385 |
| 317 | 2852653466 | 2852649853 | Bacteria | 4036942 |
| 318 | 2852687818 | 2852684882 | Bacteria | 5463342 |
| 319 | 2857445815 | 2857442823 | Bacteria | 4562550 |
| 320 | 2874224342 | 2874220319 | Bacteria | 4594709 |
| 321 | 2894023902 | 2894023352 | Bacteria | 5167372 |
| 322 | 2894416779 | 2894414249 | Bacteria | 4405451 |
| 323 | 2895396240 | 2895395659 | Bacteria | 3983269 |
| 324 | 2895501453 | 2895498888 | Bacteria | 5283788 |
| 325 | 2895514596 | 2895511927 | Bacteria | 6802080 |
| 326 | 2895523922 | 2895522137 | Bacteria | 3284416 |
| 327 | 2895528266 | 2895525241 | Bacteria | 3388457 |
| 328 | 2919091976 | 2919089067 | Bacteria | 4560942 |
| 329 | 2919132009 | 2919130084 | Bacteria | 5301837 |
| 330 | 2919135236 | 2919134579 | Bacteria | 4480386 |
| 331 | 2923517060 | 2923516293 | Bacteria | 3716336 |
| 332 | 2928498608 | 2928496128 | Bacteria | 4631123 |
| 333 | 2929199252 | 2929195423 | Bacteria | 5325372 |
| 334 | 2931382253 | 2931380184 | Bacteria | 4455911 |
| 335 | 2937613064 | 2937610967 | Bacteria | 4618818 |
| 336 | 2939592397 | 2939589442 | Bacteria | 4214238 |
| 337 | 2939615436 | 2939611941 | Bacteria | 3892017 |
| 338 | 2939625369 | 2939622612 | Bacteria | 4698046 |
| 339 | 2939630325 | 2939626828 | Bacteria | 4695272 |
| 340 | 2941477550 | 2941475908 | Bacteria | 4145589 |
| 341 | 2961051106 | 2961047084 | Bacteria | 4594415 |
| 342 | 2961065405 | 2961064222 | Bacteria | 4749990 |
| 343 | 2974310250 | 2974307012 | Bacteria | 4172388 |
| 344 | 2974320717 | 2974320154 | Bacteria | 4571377 |
| 345 | 2977250977 | 2977247770 | Bacteria | 4160543 |
| 346 | 2984514530 | 2984514374 | Bacteria | 4172479 |
| 347 | 2987608904 | 2987605356 | Bacteria | 4187822 |
| 348 | 8021622557 | 8021622325 | Bacteria | 4844743 |
| 349 | 8021626725 | 8021626552 | Bacteria | 4665214 |
| 350 | 8021649211 | 8021648035 | Bacteria | 4772378 |
| 351 | 8057163844 | 8057160832 | Bacteria | 3268302 |
| 352 | Ga0307410_10056071 | |||
| 353 | JGI24739J22299_10033312 | |||
| 354 | JGI24735J21928_10001173 | |||
| 355 | JGI25157J39369_1000425 | |||
| 356 | JGI25164J39214_1000259 | |||
| 357 | JGI25152J39213_1000025 | |||
| 358 | JGI25150J39212_1000066 | |||
| 359 | JGI25151J46595_10000139 | |||
| 360 | JGI25165J46597_1000379 | |||
| 361 | JGI25153J46596_10000101 | |||
| 362 | Ga0055533_1001936 | |||
| 363 | Ga0055526_1001045 | |||
| 364 | Ga0055537_1000028 | |||
| 365 | Ga0055524_1008829 | |||
| 366 | Ga0055536_1014313 | |||
| 367 | Ga0055534_1000180 | |||
| 368 | Ga0055528_1000262 | |||
| 369 | Ga0055530_10000784 | |||
| 370 | Ga0055530_10001799 | |||
| 371 | Ga0058692_1000026 | |||
| 372 | Ga0058692_1000040 | |||
| 373 | Ga0065704_10070584 | |||
| 374 | Ga0065704_10071027 | |||
| 375 | Ga0070658_10270363 | |||
| 376 | Ga0070670_100000327 | |||
| 377 | Ga0070660_100014483 | |||
| 378 | Ga0070668_100007980 | |||
| 379 | Ga0070671_100014773 | |||
| 380 | Ga0070671_100021105 | |||
| 381 | Ga0070659_100005462 | |||
| 382 | Ga0070659_100005978 | |||
| 383 | Ga0070714_100000209 | |||
| 384 | Ga0070713_100000941 | |||
| 385 | Ga0070711_100221579 | |||
| 386 | Ga0070663_100005378 | |||
| 387 | Ga0070663_100031196 | |||
| 388 | Ga0070678_100067569 | |||
| 389 | Ga0070662_100078759 | |||
| 390 | Ga0070681_10015355 | |||
| 391 | Ga0068853_100039277 | |||
| 392 | Ga0070696_100059795 | |||
| 393 | Ga0070665_100385079 | |||
| 394 | Ga0068855_100080392 | |||
| 395 | Ga0068855_100385384 | |||
| 396 | Ga0068856_100012146 | |||
| 397 | Ga0068856_100015556 | |||
| 398 | Ga0081539_10032374 | |||
| 399 | Ga0075364_10000005 | |||
| 400 | Ga0075364_10143153 | |||
| 401 | Ga0070712_100018015 | |||
| 402 | Ga0105251_10001131 | |||
| 403 | Ga0105251_10004086 | |||
| 404 | Ga0105244_10007450 | |||
| 405 | Ga0105244_10020309 | |||
| 406 | Ga0105240_10004091 | |||
| 407 | Ga0105243_10009646 | |||
| 408 | Ga0105242_10003311 | |||
| 409 | Ga0105237_10001315 | |||
| 410 | Ga0105238_10012451 | |||
| 411 | Ga0105238_10013663 | |||
| 412 | Ga0105238_10172341 | |||
| 413 | Ga0105246_10057369 | |||
| 414 | Ga0157371_10000658 | |||
| 415 | Ga0157371_10006458 | |||
| 416 | Ga0157370_10004714 | |||
| 417 | Ga0157370_10012773 | |||
| 418 | Ga0157370_10014062 | |||
| 419 | Ga0157370_10034549 | |||
| 420 | Ga0157370_10041445 | |||
| 421 | Ga0157370_10064191 | |||
| 422 | Ga0157369_10023991 | |||
| 423 | Ga0157369_10122661 | |||
| 424 | Ga0157369_10172733 | |||
| 425 | Ga0157372_10008543 | |||
| 426 | Ga0157372_10013068 | |||
| 427 | Ga0182008_10000090 | |||
| 428 | Ga0182008_10010326 | |||
| 429 | Ga0182008_10048202 | |||
| 430 | Ga0182006_1048555 | |||
| 431 | Ga0182007_10000025 | |||
| 432 | Ga0182007_10006817 | |||
| 433 | Ga0182007_10011444 | |||
| 434 | Ga0182007_10015357 | |||
| 435 | Ga0182007_10024156 | |||
| 436 | Ga0182005_1000063 | |||
| 437 | Ga0182005_1002220 | |||
| 438 | Ga0183368_1003 | |||
| 439 | Ga0163161_10155563 | |||
| 440 | Ga0209674_100033 | |||
| 441 | Ga0207427_100101 | |||
| 442 | Ga0209437_100090 | |||
| 443 | Ga0209258_100622 | |||
| 444 | Ga0207425_1000040 | |||
| 445 | Ga0209646_1001250 | |||
| 446 | Ga0209026_1000114 | |||
| 447 | Ga0209026_1001808 | |||
| 448 | Ga0209759_1001159 | |||
| 449 | Ga0209759_1003000 | |||
| 450 | Ga0209129_1000011 | |||
| 451 | Ga0209233_1000077 | |||
| 452 | Ga0209565_1000037 | |||
| 453 | Ga0209455_1000254 | |||
| 454 | Ga0209673_1000032 | |||
| 455 | Ga0209675_1000020 | |||
| 456 | Ga0209676_1000063 | |||
| 457 | Ga0209676_1000149 | |||
| 458 | Ga0209676_1000199 | |||
| 459 | Ga0209676_1001331 | |||
| 460 | Ga0209025_1000002 | |||
| 461 | Ga0209564_1000951 | |||
| 462 | Ga0209758_1000003 | |||
| 463 | Ga0209050_1000189 | |||
| 464 | Ga0209050_1000199 | |||
| 465 | Ga0209050_1030189 | |||
| 466 | Ga0209256_1002668 | |||
| 467 | Ga0209256_1004073 | |||
| 468 | Ga0209051_1006709 | |||
| 469 | Ga0209257_1000086 | |||
| 470 | Ga0209257_1002739 | |||
| 471 | Ga0207713_1000253 | |||
| 472 | Ga0207713_1018070 | |||
| 473 | Ga0207647_10001577 | |||
| 474 | Ga0207647_10002201 | |||
| 475 | Ga0207647_10069526 | |||
| 476 | Ga0207705_10012336 | |||
| 477 | Ga0207707_10012197 | |||
| 478 | Ga0207707_10037343 | |||
| 479 | Ga0207695_10001324 | |||
| 480 | Ga0207671_10000462 | |||
| 481 | Ga0207693_10064279 | |||
| 482 | Ga0207693_10108075 | |||
| 483 | Ga0207657_10024851 | |||
| 484 | Ga0207649_10026144 | |||
| 485 | Ga0207652_10252806 | |||
| 486 | Ga0207694_10012417 | |||
| 487 | Ga0207650_10025065 | |||
| 488 | Ga0207664_10000135 | |||
| 489 | Ga0207664_10001594 | |||
| 490 | Ga0207644_10061885 | |||
| 491 | Ga0207690_10009176 | |||
| 492 | Ga0207690_10011991 | |||
| 493 | Ga0207690_10015102 | |||
| 494 | Ga0207690_10020275 | |||
| 495 | Ga0207706_10015063 | |||
| 496 | Ga0207709_10005256 | |||
| 497 | Ga0207691_10025781 | |||
| 498 | Ga0207667_10012587 | |||
| 499 | Ga0207667_10025574 | |||
| 500 | Ga0207667_10139810 | |||
| 501 | Ga0207639_10008197 | |||
| 502 | Ga0207678_10136942 | |||
| 503 | Ga0207678_10170802 | |||
| 504 | Ga0207702_10004774 | |||
| 505 | Ga0207702_10060340 | |||
| 506 | Ga0207648_10124797 | |||
| 507 | Ga0207674_10012792 | |||
| 508 | Ga0207683_10085985 | |||
| 509 | Ga0209371_1000028 | |||
| 510 | Ga0209371_1000048 | |||
| 511 | Ga0209971_1000369 | |||
| 512 | Ga0209971_1013242 | |||
| 513 | Ga0209974_10026212 | |||
| 514 | Ga0268266_10014860 | |||
| 515 | Ga0268266_10124896 | |||
| 516 | Ga0265334_10003804 | |||
| 517 | Ga0268256_1000030 | |||
| 518 | Ga0268256_1000049 | |||
| 519 | Ga0316183_1052676 | |||
| 520 | Ga0316181_1157645 | |||
| 521 | Ga0316182_1029855 | |||
| 522 | Ga0265330_10000045 | |||
| 523 | Ga0265332_10000031 | |||
| 524 | Ga0265325_10000849 | |||
| 525 | Ga0307508_10153089 | |||
| 526 | Ga0316575_10021352 | |||
| 527 | Ga0265314_10000095 | |||
| 528 | Ga0316576_10016979 | |||
| 529 | Ga0316576_10019958 | |||
| 530 | Ga0307410_10037350 | |||
| 531 | Ga0307412_10174908 | |||
| 532 | Ga0307414_10013781 | |||
| 533 | Ga0307414_10025969 | |||
| 534 | Ga0316580_10048101 | |||
| 535 | Ga0307510_10096338 | |||
| 536 | Ga0316596_1007433 | |||
| 537 | Ga0316574_0001289 | |||
| 538 | Ga0395899_0027147 | |||
| 539 | Ga0395900_0004345 | |||
| 540 | Ga0395905_0001042 | |||
| 541 | Ga0395905_0054230 | |||
| 542 | Ga0395901_0001304 | |||
| 543 | Ga0395901_0001771 | |||
| 544 | Ga0237819_00279 | |||
| 545 | Ga0237819_08555 | |||
| 546 | Ga0237816_00010 | |||
| 547 | Ga0439465_0007576 | |||
| 548 | Ga0451797_0461725 | |||
| 549 | Ga0451797_0562437 | |||
| 550 | Ga0451807_2174022 | |||
| 551 | Ga0451837_0189825 | |||
| 552 | Ga0439432_007154 | |||
| 553 | Ga0439449_0003927 | |||
| 554 | Ga0439449_0011636 | |||
| 555 | Ga0439449_0011960 | |||
| 556 | Ga0451577_0030683 | |||
| 557 | Ga0466967_0332379 | |||
| 558 | Ga0495627_037644 | |||
| 559 | Ga0495638_0007566 | |||
| 560 | Ga0495610_0001130 | |||
| 561 | Ga0495631_0000369 | |||
| 562 | Ga0495643_0000936 | |||
| 563 | Ga0495663_0012694 | |||
| 564 | Ga0495621_0000047 | |||
| 565 | Ga0495633_0001525 | |||
| 566 | Ga0495625_0032805 | |||
| 567 | Ga0495659_0018285 | |||
| 568 | Ga0495636_0001671 | |||
| 569 | Ga0495636_0030184 | |||
| 570 | Ga0495672_0000079 | |||
| 571 | Ga0495672_0034540 | |||
| 572 | Ga0495686_0005987 | |||
| 573 | Ga0496108_0069385 | |||
| 574 | Ga0496108_0101817 | |||
| 575 | Ga0496109_0028725 | |||
| 576 | Ga0496110_0331332 | |||
| 577 | Ga0496112_0054371 | |||
| 578 | Ga0496112_0336064 | |||
| 579 | Ga0496113_0033493 | |||
| 580 | Ga0496114_0001425 | |||
| 581 | Ga0496115_0000092 | |||
| 582 | Ga0496116_0000742 | |||
| 583 | Ga0496116_0010746 | |||
| 584 | Ga0496117_0000483 | |||
| 585 | Ga0496117_0000763 | |||
| 586 | Ga0496117_0001569 | |||
| 587 | Ga0496118_0000732 | |||
| 588 | Ga0496118_0007163 | |||
| 589 | Ga0496118_0142964 | |||
| 590 | Ga0496118_0175124 | |||
| 591 | Ga0496119_0001225 | |||
| 592 | Ga0496119_0001601 | |||
| 593 | Ga0496120_0000262 | |||
| 594 | Ga0496120_0000564 | |||
| 595 | Ga0496121_0002092 | |||
| 596 | Ga0496122_0000537 | |||
| 597 | Ga0496122_0001070 | |||
| 598 | Ga0496122_0210715 | |||
| 599 | Ga0496123_0000541 | |||
| 600 | Ga0496123_0000898 | |||
| 601 | Ga0496124_0000384 | |||
| 602 | Ga0496124_0001971 | |||
| 603 | Ga0496124_0002812 | |||
| 604 | Ga0496124_0010102 | |||
| 605 | Ga0496124_0043200 | |||
| 606 | Ga0496124_0124317 | |||
| 607 | Ga0496125_0000475 | |||
| 608 | Ga0496125_0001928 | |||
| 609 | Ga0496125_0010968 | |||
| 610 | Ga0496125_0014570 | |||
| 611 | Ga0501031_0002690 | |||
| 612 | Ga0501032_0003364 | |||
| 613 | Ga0501032_0193724 | |||
| 614 | Ga0501033_0029499 | |||
| 615 | Ga0501034_0001201 | |||
| 616 | Ga0501034_0002057 | |||
| 617 | Ga0501034_0031988 | |||
| 618 | Ga0501036_0015163 | |||
| 619 | Ga0501036_0066856 | |||
| 620 | Ga0501036_0099171 | |||
| 621 | Ga0501037_0016465 | |||
| 622 | Ga0501037_0071462 | |||
| 623 | Ga0501038_0026218 | |||
| 624 | Ga0501043_0020527 | |||
| 625 | Ga0501046_0011021 | |||
| 626 | Ga0501046_0133287 | |||
| 627 | Ga0501047_0009308 | |||
| 628 | Ga0501047_0072226 | |||
| 629 | Ga0501070_0001008 | |||
| 630 | Ga0501070_0015805 | |||
| 631 | Ga0501070_0033241 | |||
| 632 | Ga0501070_0207977 | |||
| 633 | Ga0501073_0006334 | |||
| 634 | Ga0501073_0037036 | |||
| 635 | Ga0501073_0118680 | |||
| 636 | Ga0501074_0004810 | |||
| 637 | Ga0501074_0029424 | |||
| 638 | Ga0501079_0081252 | |||
| 639 | Ga0501080_0016888 | |||
| 640 | Ga0501035_0007796 | |||
| 641 | Ga0501035_0024811 | |||
| 642 | Ga0501035_0031068 | |||
| 643 | Ga0501044_0005279 | |||
| 644 | Ga0501044_0017340 | |||
| 645 | Ga0501044_0074457 | |||
| 646 | Ga0501044_0189780 | |||
| 647 | Ga0500622_0007234 | |||
| 648 | Ga0500634_0008726 | |||
| 649 | 2538833887 | |||
| 650 | 2547502137 | |||
| 651 | 2572253618 | |||
| 652 | 2578459813 | |||
| 653 | 2643831776 | |||
| 654 | 2643896104 | |||
| 655 | 2643908329 | |||
| 656 | 2643914633 | |||
| 657 | 2644478311 | |||
| 658 | 2644528927 | |||
| 659 | 2687584898 | |||
| 660 | 2747949671 | |||
| 661 | 2748018988 | |||
| 662 | 2765577492 | |||
| 663 | 2816519262 | |||
| 664 | 2819662465 | |||
| 665 | 2842392487 | |||
| 666 | 2842718313 | |||
| 667 | 2842761379 | |||
| 668 | 2852653466 | |||
| 669 | 2852687818 | |||
| 670 | 2857445815 | |||
| 671 | 2874224342 | |||
| 672 | 2894023902 | |||
| 673 | 2894416779 | |||
| 674 | 2895396240 | |||
| 675 | 2895501453 | |||
| 676 | 2895514596 | |||
| 677 | 2895523922 | |||
| 678 | 2895528266 | |||
| 679 | 2919091976 | |||
| 680 | 2919132009 | |||
| 681 | 2919135236 | |||
| 682 | 2923517060 | |||
| 683 | 2928498608 | |||
| 684 | 2929199252 | |||
| 685 | 2931382253 | |||
| 686 | 2937613064 | |||
| 687 | 2939592397 | |||
| 688 | 2939615436 | |||
| 689 | 2939625369 | |||
| 690 | 2939630325 | |||
| 691 | 2941477550 | |||
| 692 | 2961051106 | |||
| 693 | 2961065405 | |||
| 694 | 2974310250 | |||
| 695 | 2974320717 | |||
| 696 | 2977250977 | |||
| 697 | 2984514530 | |||
| 698 | 2987608904 | |||
| 699 | 8021622557 | |||
| 700 | 8021626725 | |||
| 701 | 8021649211 | |||
| 702 | 8057163844 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7pps-assembly1.cif.gz_B | apo fabb from pseudomonas aeruginosa with single point mutation c161a | 0.9887 | 1 | 398 |
| 2byy-assembly1.cif.gz_A | e.coli kas i h298e mutation | 0.9876 | 1 | 398 |
| 2byx-assembly2.cif.gz_D | kas i lys328ala mutant in complex with fatty acid | 0.9874 | 1 | 398 |
| 2bz4-assembly2.cif.gz_C | structure of e.coli kas i h298q mutant | 0.9873 | 1 | 398 |
| 2cdh-assembly1.cif.gz_A | architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. | 0.9872 | 1 | 398 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1dd8A01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.985 | 6 | 253 | 3.40.47.10 |
| 4xoxB02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9589 | 255 | 398 | 3.40.47.10 |
| 1dd8A01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9583 | 6 | 253 | 3.40.47.10 |
| af_Q0E328_1_239_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9574 | 177 | 396 | 3.40.47.10 |
| af_C6KT99_32_472_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9523 | 2 | 398 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1B0C5T0-F1-model_v4 | Chorismate synthase (EC 4.2.3.5) | 0.989 | 15 | 398 |
GO:0003700
GO:0004107 GO:0004315 GO:0005829 GO:0006633 GO:0008652 GO:0009073 GO:0009423 GO:0010181 |
| AF-A0A448QMU6-F1-model_v4 | deleted | 0.9885 | 1 | 309 |
|
| AF-A0A2D7FCW2-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] synthase 1 (EC 2.3.1.41) (3-oxoacyl-[acyl-carrier-protein] synthase I) (Beta-ketoacyl-ACP synthase I) | 0.9876 | 1 | 398 |
GO:0004315
GO:0005829 GO:0006633 |
| AF-A0A6L8G3B9-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] synthase 1 (EC 2.3.1.41) (3-oxoacyl-[acyl-carrier-protein] synthase I) (Beta-ketoacyl-ACP synthase I) | 0.9868 | 1 | 276 |
GO:0004315
GO:0005829 GO:0006633 |
| AF-A0A508STJ7-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] synthase 1 (EC 2.3.1.41) (3-oxoacyl-[acyl-carrier-protein] synthase I) (Beta-ketoacyl-ACP synthase I) | 0.9862 | 1 | 398 |
GO:0004315
GO:0005829 GO:0006633 |