F418697

General Info

Members Datasets Scaffolds Average Seq Length
351 202 350 86

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100248096|Ga0307409_1002480962
Length 89
Sequence MMEDYGIIGWIVIGGLAGGIAKLLMPGRDPGGCIVTVLLGIAGALVAGWLGRAVGWYDANDQGAGFIAAIVGAFLLLLIYRVIAGRRRV

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
129 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
130 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
131 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
132 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
158 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
159 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
160 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
163 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
177 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
178 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
193 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
194 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
195 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.28
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 6.27
Rhizosphere 91.45
Stem 0
Stem Tuber 0.28
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_6265034 2162886012 Bacteria 871
2 rootH1_10227068 3300003323 Bacteria 1146
3 Ga0065712_10142496 3300005290 Bacteria 1438
4 Ga0065715_10006332 3300005293 Bacteria 3883
5 Ga0065715_10019073 3300005293 Bacteria 1726
6 Ga0070658_10022891 3300005327 Bacteria 5015
7 Ga0070658_10068417 3300005327 Bacteria 2903
8 Ga0070658_10136827 3300005327 Bacteria 2044
9 Ga0070658_10462982 3300005327 Unclassified 1093
10 Ga0070658_11162074 3300005327 Unclassified 671
11 Ga0070676_10767212 3300005328 Unclassified 709
12 Ga0070676_11568705 3300005328 Bacteria 508
13 Ga0070683_100853238 3300005329 Unclassified 873
14 Ga0070670_100048043 3300005331 Bacteria 3673
15 Ga0070670_100049722 3300005331 Bacteria 3604
16 Ga0070670_100106430 3300005331 Bacteria 2417
17 Ga0070670_101189922 3300005331 Bacteria 696
18 Ga0070677_10001482 3300005333 Bacteria 7430
19 Ga0070677_10203469 3300005333 Bacteria 957
20 Ga0068869_101012395 3300005334 Bacteria 724
21 Ga0070666_10044883 3300005335 Bacteria 2963
22 Ga0070666_11019490 3300005335 Bacteria 614
23 Ga0070680_100275136 3300005336 Bacteria 1426
24 Ga0068868_101727552 3300005338 Unclassified 590
25 Ga0070660_100063394 3300005339 Bacteria 2873
26 Ga0070687_101283501 3300005343 Bacteria 543
27 Ga0070661_100019297 3300005344 Bacteria 4860
28 Ga0070661_100072971 3300005344 Bacteria 2526
29 Ga0070661_100525199 3300005344 Bacteria 950
30 Ga0070661_101074115 3300005344 Unclassified 670
31 Ga0070692_10546531 3300005345 Bacteria 758
32 Ga0070668_100025261 3300005347 Bacteria 4503
33 Ga0070668_100359888 3300005347 Bacteria 1233
34 Ga0070668_101808683 3300005347 Bacteria 562
35 Ga0070669_100013193 3300005353 Bacteria 5874
36 Ga0070669_100757402 3300005353 Unclassified 823
37 Ga0070675_100011593 3300005354 Bacteria 6904
38 Ga0070675_100026972 3300005354 Bacteria 4613
39 Ga0070671_100035325 3300005355 Bacteria 4140
40 Ga0070671_101252777 3300005355 Bacteria 653
41 Ga0070674_100078245 3300005356 Bacteria 2356
42 Ga0070673_100073244 3300005364 Bacteria 2757
43 Ga0070673_100619423 3300005364 Unclassified 988
44 Ga0070673_102185533 3300005364 Bacteria 526
45 Ga0070688_100946983 3300005365 Unclassified 681
46 Ga0070659_100026598 3300005366 Bacteria 4453
47 Ga0070659_100150383 3300005366 Bacteria 1899
48 Ga0070659_100188814 3300005366 Bacteria 1693
49 Ga0070667_100028538 3300005367 Bacteria 4647
50 Ga0070714_100008378 3300005435 Bacteria 8068
51 Ga0070713_100349957 3300005436 Bacteria 1370
52 Ga0070663_100081043 3300005455 Bacteria 2385
53 Ga0070663_100841371 3300005455 Unclassified 789
54 Ga0070663_101001994 3300005455 Unclassified 726
55 Ga0070663_101462300 3300005455 Unclassified 607
56 Ga0070678_100163472 3300005456 Unclassified 1806
57 Ga0070662_100006956 3300005457 Bacteria 7319
58 Ga0070662_100024876 3300005457 Bacteria 4130
59 Ga0070662_100042331 3300005457 Bacteria 3253
60 Ga0070662_100822709 3300005457 Bacteria 790
61 Ga0070681_10469862 3300005458 Bacteria 1170
62 Ga0070681_11790744 3300005458 Bacteria 541
63 Ga0068867_100508046 3300005459 Bacteria 1037
64 Ga0070684_100508332 3300005535 Bacteria 1116
65 Ga0070684_101652225 3300005535 Unclassified 604
66 Ga0068853_100135164 3300005539 Bacteria 2210
67 Ga0070672_100494363 3300005543 Unclassified 1058
68 Ga0070672_101441848 3300005543 Unclassified 616
69 Ga0070686_100584182 3300005544 Bacteria 878
70 Ga0068855_100013172 3300005563 Bacteria 9974
71 Ga0068855_100267377 3300005563 Bacteria 1903
72 Ga0070664_100002761 3300005564 Bacteria 14168
73 Ga0070664_100005532 3300005564 Bacteria 10141
74 Ga0070664_100047638 3300005564 Bacteria 3621
75 Ga0070664_100173954 3300005564 Unclassified 1911
76 Ga0070664_100853099 3300005564 Unclassified 853
77 Ga0068854_100212947 3300005578 Bacteria 1525
78 Ga0068856_100081860 3300005614 Bacteria 3204
79 Ga0068856_100110532 3300005614 Bacteria 2745
80 Ga0068856_102611076 3300005614 Bacteria 511
81 Ga0068852_100003515 3300005616 Bacteria 10961
82 Ga0068852_100035142 3300005616 Bacteria 4176
83 Ga0068852_102035615 3300005616 Bacteria 596
84 Ga0068859_100001549 3300005617 Bacteria 23444
85 Ga0068864_100084836 3300005618 Bacteria 2784
86 Ga0068864_100185737 3300005618 Bacteria 1903
87 Ga0068866_10473974 3300005718 Bacteria 823
88 Ga0068861_100644622 3300005719 Bacteria 978
89 Ga0068861_100661372 3300005719 Bacteria 966
90 Ga0068851_10050201 3300005834 Bacteria 2118
91 Ga0068863_100017339 3300005841 Bacteria 6905
92 Ga0068858_100670365 3300005842 Bacteria 1008
93 Ga0068860_100005237 3300005843 Bacteria 13170
94 Ga0068862_100000075 3300005844 Bacteria 117819
95 Ga0068862_100076411 3300005844 Bacteria 2898
96 Ga0070715_10580613 3300006163 Bacteria 654
97 Ga0075367_10403560 3300006178 Bacteria 864
98 Ga0075366_10008607 3300006195 Bacteria 5682
99 Ga0097621_101534775 3300006237 Unclassified 632
100 Ga0075370_10264885 3300006353 Bacteria 1020
101 Ga0068871_100399968 3300006358 Unclassified 1223
102 Ga0068871_101208437 3300006358 Bacteria 709
103 Ga0068871_101728431 3300006358 Unclassified 593
104 Ga0075433_10047137 3300006852 Bacteria 3749
105 Ga0075433_10153552 3300006852 Bacteria 2048
106 Ga0075434_100003361 3300006871 Bacteria 14317
107 Ga0075436_101512451 3300006914 Bacteria 510
108 Ga0097620_100001549 3300006931 Bacteria 23444
109 Ga0111539_10437960 3300009094 Bacteria 1522
110 Ga0111539_12059204 3300009094 Bacteria 662
111 Ga0105245_11361441 3300009098 Unclassified 759
112 Ga0114129_10012318 3300009147 Bacteria 12168
113 Ga0114129_12672930 3300009147 Unclassified 595
114 Ga0105241_12205427 3300009174 Bacteria 546
115 Ga0105242_12890924 3300009176 Bacteria 531
116 Ga0105248_10085335 3300009177 Bacteria 3553
117 Ga0105248_11452685 3300009177 Bacteria 776
118 Ga0105249_10349380 3300009553 Bacteria 1498
119 Ga0105249_10464943 3300009553 Bacteria 1306
120 Ga0105246_12515243 3300011119 Unclassified 507
121 Ga0157327_1030390 3300012512 Unclassified 671
122 Ga0157373_10008353 3300013100 Bacteria 7693
123 Ga0157373_10566021 3300013100 Bacteria 825
124 Ga0157371_10017657 3300013102 Bacteria 5293
125 Ga0157371_10359652 3300013102 Bacteria 1061
126 Ga0157369_10013212 3300013105 Bacteria 9345
127 Ga0157369_10378275 3300013105 Bacteria 1470
128 Ga0157369_12383431 3300013105 Unclassified 536
129 Ga0157374_10388447 3300013296 Unclassified 1391
130 Ga0157378_11235478 3300013297 Unclassified 787
131 Ga0163162_13160095 3300013306 Bacteria 529
132 Ga0163162_13170535 3300013306 Bacteria 528
133 Ga0157375_10409526 3300013308 Unclassified 1522
134 Ga0157375_12399273 3300013308 Unclassified 629
135 Ga0163163_11208264 3300014325 Unclassified 819
136 Ga0157380_10046399 3300014326 Bacteria 3412
137 Ga0157376_10420186 3300014969 Unclassified 1297
138 Ga0163161_10284907 3300017792 Bacteria 1297
139 Ga0207656_10010354 3300025321 Bacteria 3492
140 Ga0207656_10024282 3300025321 Bacteria 2450
141 Ga0207682_10000899 3300025893 Bacteria 13769
142 Ga0207682_10143476 3300025893 Bacteria 1073
143 Ga0207642_10232824 3300025899 Bacteria 1036
144 Ga0207710_10002858 3300025900 Bacteria 7860
145 Ga0207688_10017136 3300025901 Bacteria 3937
146 Ga0207688_10083965 3300025901 Bacteria 1822
147 Ga0207688_10513792 3300025901 Bacteria 751
148 Ga0207680_10049819 3300025903 Bacteria 2495
149 Ga0207645_10330602 3300025907 Bacteria 1018
150 Ga0207643_10313891 3300025908 Bacteria 978
151 Ga0207705_10006764 3300025909 Bacteria 8475
152 Ga0207705_10096376 3300025909 Bacteria 2172
153 Ga0207705_10379489 3300025909 Unclassified 1092
154 Ga0207684_11544700 3300025910 Unclassified 539
155 Ga0207707_10409983 3300025912 Bacteria 1163
156 Ga0207662_11002399 3300025918 Bacteria 593
157 Ga0207657_10002456 3300025919 Bacteria 20031
158 Ga0207649_10013230 3300025920 Bacteria 4604
159 Ga0207649_10037152 3300025920 Bacteria 2940
160 Ga0207649_10049849 3300025920 Bacteria 2588
161 Ga0207649_10697510 3300025920 Bacteria 787
162 Ga0207649_11165724 3300025920 Unclassified 609
163 Ga0207681_10718392 3300025923 Unclassified 831
164 Ga0207650_10075443 3300025925 Bacteria 2545
165 Ga0207650_10100025 3300025925 Bacteria 2230
166 Ga0207650_10259138 3300025925 Bacteria 1410
167 Ga0207659_10013492 3300025926 Bacteria 5235
168 Ga0207659_10104422 3300025926 Bacteria 2143
169 Ga0207700_10168191 3300025928 Bacteria 1827
170 Ga0207700_10819300 3300025928 Unclassified 833
171 Ga0207664_10004690 3300025929 Bacteria 9274
172 Ga0207644_10020511 3300025931 Bacteria 4493
173 Ga0207644_10292832 3300025931 Bacteria 1310
174 Ga0207690_10016823 3300025932 Bacteria 4456
175 Ga0207690_10153342 3300025932 Bacteria 1710
176 Ga0207690_10178983 3300025932 Bacteria 1595
177 Ga0207690_11744738 3300025932 Bacteria 520
178 Ga0207706_10008560 3300025933 Bacteria 9430
179 Ga0207706_10036108 3300025933 Bacteria 4391
180 Ga0207706_10120330 3300025933 Bacteria 2308
181 Ga0207670_10171359 3300025936 Bacteria 1628
182 Ga0207669_10206603 3300025937 Bacteria 1430
183 Ga0207691_10238734 3300025940 Bacteria 1572
184 Ga0207691_10469893 3300025940 Unclassified 1069
185 Ga0207691_11312220 3300025940 Unclassified 597
186 Ga0207689_10138759 3300025942 Bacteria 2003
187 Ga0207661_10630086 3300025944 Unclassified 985
188 Ga0207661_11056856 3300025944 Unclassified 748
189 Ga0207679_10017661 3300025945 Bacteria 4763
190 Ga0207679_10129762 3300025945 Bacteria 2020
191 Ga0207679_10134811 3300025945 Unclassified 1987
192 Ga0207679_10814657 3300025945 Unclassified 852
193 Ga0207679_11085757 3300025945 Bacteria 734
194 Ga0207679_12177688 3300025945 Bacteria 503
195 Ga0207667_10461542 3300025949 Bacteria 1290
196 Ga0207651_10257434 3300025960 Unclassified 1431
197 Ga0207651_10687534 3300025960 Unclassified 900
198 Ga0207651_11088813 3300025960 Bacteria 716
199 Ga0207712_10000012 3300025961 Bacteria 392363
200 Ga0207712_10074572 3300025961 Bacteria 2450
201 Ga0207668_10047150 3300025972 Bacteria 2949
202 Ga0207668_10128549 3300025972 Bacteria 1931
203 Ga0207668_11062179 3300025972 Bacteria 725
204 Ga0207668_11116457 3300025972 Bacteria 707
205 Ga0207658_10008780 3300025986 Bacteria 6862
206 Ga0207658_10189176 3300025986 Bacteria 1709
207 Ga0207677_11148349 3300026023 Unclassified 710
208 Ga0207639_10423871 3300026041 Unclassified 1203
209 Ga0207678_10407677 3300026067 Bacteria 1177
210 Ga0207702_10017757 3300026078 Bacteria 5889
211 Ga0207702_10101196 3300026078 Bacteria 2544
212 Ga0207641_10002367 3300026088 Bacteria 17403
213 Ga0207641_11834906 3300026088 Unclassified 608
214 Ga0207676_10577733 3300026095 Unclassified 1077
215 Ga0207675_100073156 3300026118 Bacteria 3207
216 Ga0207675_100771426 3300026118 Bacteria 973
217 Ga0207675_101079831 3300026118 Bacteria 822
218 Ga0207683_10613173 3300026121 Unclassified 1007
219 Ga0207683_10933198 3300026121 Bacteria 806
220 Ga0207683_12058056 3300026121 Unclassified 519
221 Ga0207698_10016543 3300026142 Bacteria 4975
222 Ga0207698_10382644 3300026142 Unclassified 1339
223 Ga0207698_10659261 3300026142 Bacteria 1037
224 Ga0209983_1088619 3300027665 Bacteria 696
225 Ga0268265_10000087 3300028380 Bacteria 117852
226 Ga0268265_10108460 3300028380 Bacteria 2260
227 Ga0268264_10001015 3300028381 Bacteria 28303
228 Ga0314311_1016505 3300030733 Bacteria 1209
229 Ga0316179_1057253 3300030734 Bacteria 796
230 Ga0316180_1191543 3300030736 Bacteria 659
231 Ga0316183_1090669 3300030742 Bacteria 985
232 Ga0316182_1027801 3300030745 Bacteria 1037
233 Ga0316182_1291412 3300030745 Bacteria 1398
234 Ga0307408_100062875 3300031548 Bacteria 2714
235 Ga0307408_100471265 3300031548 Bacteria 1093
236 Ga0307408_100975583 3300031548 Bacteria 780
237 Ga0307408_102142300 3300031548 Bacteria 540
238 Ga0307405_10068934 3300031731 Bacteria 2266
239 Ga0307405_10089238 3300031731 Bacteria 2036
240 Ga0307405_10119955 3300031731 Bacteria 1798
241 Ga0307413_10127294 3300031824 Bacteria 1737
242 Ga0307413_11206394 3300031824 Bacteria 658
243 Ga0307410_10002031 3300031852 Bacteria 9548
244 Ga0307410_10051771 3300031852 Bacteria 2769
245 Ga0307410_10370196 3300031852 Bacteria 1150
246 Ga0307406_10033488 3300031901 Bacteria 3146
247 Ga0307407_10862214 3300031903 Bacteria 693
248 Ga0307412_10268789 3300031911 Bacteria 1333
249 Ga0307412_10394198 3300031911 Unclassified 1125
250 Ga0307412_11099365 3300031911 Bacteria 707
251 Ga0307409_100143797 3300031995 Bacteria 2059
252 Ga0307409_100196969 3300031995 Bacteria 1799
253 Ga0307409_100248096 3300031995 Bacteria 1626
254 Ga0307409_101952338 3300031995 Bacteria 616
255 Ga0307416_100000853 3300032002 Bacteria 16054
256 Ga0307416_100405000 3300032002 Bacteria 1403
257 Ga0307416_100569454 3300032002 Bacteria 1208
258 Ga0307416_101620355 3300032002 Bacteria 752
259 Ga0307416_102290720 3300032002 Bacteria 641
260 Ga0307414_10000904 3300032004 Bacteria 15210
261 Ga0307411_10124752 3300032005 Bacteria 1870
262 Ga0307415_100026338 3300032126 Bacteria 3666
263 Ga0373959_0092406 3300034820 Bacteria 711
264 Ga0373949_0047423 3300035090 Unclassified 1074
265 Ga0373932_0031082 3300035112 Unclassified 1485
266 Ga0373941_0349211 3300035115 Bacteria 601
267 Ga0373960_0368430 3300035121 Unclassified 548
268 Ga0373935_1410416 3300035692 Bacteria 521
269 Ga0373947_1137192 3300035725 Bacteria 532
270 Ga0395899_0066080 3300037312 Bacteria 2656
271 Ga0395900_0025988 3300037418 Bacteria 5995
272 Ga0395900_0778130 3300037418 Bacteria 886
273 Ga0395900_1127147 3300037418 Unclassified 701
274 Ga0395905_0004140 3300037471 Bacteria 15179
275 Ga0395905_0009301 3300037471 Bacteria 9614
276 Ga0395905_0037976 3300037471 Bacteria 4519
277 Ga0395905_0054963 3300037471 Bacteria 3726
278 Ga0395905_0103972 3300037471 Bacteria 2666
279 Ga0395905_0280720 3300037471 Bacteria 1552
280 Ga0395905_0603032 3300037471 Unclassified 1000
281 Ga0395901_0049725 3300038443 Bacteria 4356
282 Ga0395901_0398303 3300038443 Bacteria 1415
283 Ga0395901_0432417 3300038443 Unclassified 1348
284 Ga0395901_1531689 3300038443 Unclassified 622
285 Ga0436363_1287039 3300039450 Bacteria 1231
286 Ga0439461_0021157 3300041410 Bacteria 1294
287 Ga0439466_0282204 3300041411 Bacteria 503
288 Ga0451802_2129832 3300041460 Unclassified 655
289 Ga0439432_070144 3300042006 Bacteria 1070
290 Ga0439449_0100663 3300042007 Bacteria 1068
291 Ga0439462_0054827 3300042015 Bacteria 1075
292 Ga0439462_0205998 3300042015 Bacteria 561
293 Ga0439434_0123362 3300042435 Unclassified 846
294 Ga0451577_1631614 3300042876 Unclassified 568
295 Ga0466972_0027887 3300044658 Bacteria 2791
296 Ga0466972_0050561 3300044658 Bacteria 2006
297 Ga0466965_0149619 3300044683 Bacteria 1220
298 Ga0466965_0337136 3300044683 Bacteria 824
299 Ga0466966_0172851 3300044684 Bacteria 1312
300 Ga0466966_0311370 3300044684 Bacteria 946
301 Ga0466961_0295617 3300044693 Bacteria 990
302 Ga0466963_0115535 3300044694 Bacteria 1844
303 Ga0466963_0161994 3300044694 Bacteria 1557
304 Ga0466963_0452673 3300044694 Bacteria 906
305 Ga0466971_0122353 3300044719 Bacteria 1205
306 Ga0466957_0123834 3300044842 Bacteria 1650
307 Ga0466960_0163621 3300044901 Bacteria 1196
308 Ga0466959_0170180 3300045049 Bacteria 1528
309 Ga0466958_0210806 3300045836 Bacteria 1238
310 Ga0466967_0129038 3300045976 Bacteria 2345
311 Ga0466967_0922619 3300045976 Bacteria 869
312 Ga0466967_2052567 3300045976 Unclassified 568
313 Ga0495590_0127010 3300046457 Unclassified 916
314 Ga0495585_0210305 3300046492 Bacteria 986
315 Ga0495642_0076606 3300046528 Bacteria 1404
316 Ga0495670_0241225 3300046691 Bacteria 962
317 Ga0496101_1101436 3300048904 Bacteria 623
318 Ga0496102_0733380 3300048905 Unclassified 911
319 Ga0496104_0237386 3300048907 Bacteria 1735
320 Ga0496105_0146600 3300048908 Unclassified 1941
321 Ga0496107_0077274 3300048910 Bacteria 2425
322 Ga0496108_0034982 3300048911 Bacteria 4174
323 Ga0496108_0071297 3300048911 Bacteria 2931
324 Ga0496109_0020606 3300048912 Bacteria 5824
325 Ga0496109_0052339 3300048912 Bacteria 3721
326 Ga0496109_0517913 3300048912 Bacteria 1126
327 Ga0496109_0709375 3300048912 Unclassified 943
328 Ga0496110_0036955 3300048913 Bacteria 4243
329 Ga0496110_0236834 3300048913 Unclassified 1661
330 Ga0496110_1017062 3300048913 Bacteria 736
331 Ga0496111_0054967 3300048914 Bacteria 2879
332 Ga0496111_0959210 3300048914 Bacteria 614
333 Ga0496111_1182857 3300048914 Bacteria 542
334 Ga0496112_0059671 3300048915 Bacteria 3759
335 Ga0496112_0420419 3300048915 Unclassified 1275
336 Ga0496113_0011581 3300048916 Bacteria 5893
337 Ga0496113_0026889 3300048916 Bacteria 4118
338 Ga0496124_0244467 3300048927 Bacteria 1332
339 Ga0501201_035845 3300049651 Bacteria 581
340 Ga0501247_042849 3300049677 Bacteria 651
341 Ga0501260_055904 3300049689 Unclassified 506
342 Ga0501268_061629 3300049765 Bacteria 744
343 nmdc:mga0k408_30555_c1 3300050493 Bacteria 3072
344 nmdc:mga05p37_28626_c1 3300050507 Bacteria 6796
345 nmdc:mga05p37_91746_c1 3300050507 Bacteria 3743
346 nmdc:mga0qj67_1152536_c1 3300050509 Unclassified 604
347 nmdc:mga0n895_1777886_c1 3300050512 Unclassified 578
348 nmdc:mga08x19_625189_c1 3300050514 Bacteria 763
349 nmdc:mga0a205_36211_c1 3300050515 Bacteria 4741
350 Ga0587076_191297 3300059645 Bacteria 521

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006852 Ga0075433_10047137 Ga0075433_100471374 80
2 3300006871 Ga0075434_100003361 Ga0075434_1000033619 80
3 3300050512 nmdc:mga0n895_1777886_c1 nmdc:mga0n895_1777886_c1_43_297 80
4 3300050515 nmdc:mga0a205_36211_c1 nmdc:mga0a205_36211_c1_3428_3682 80
5 3300005327 Ga0070658_10068417 Ga0070658_100684173 81
6 3300005335 Ga0070666_11019490 Ga0070666_110194901 81
7 3300005344 Ga0070661_100072971 Ga0070661_1000729714 81
8 3300005455 Ga0070663_100081043 Ga0070663_1000810432 81
9 3300005563 Ga0068855_100013172 Ga0068855_10001317212 81
10 3300005614 Ga0068856_100110532 Ga0068856_1001105323 81
11 3300005616 Ga0068852_100003515 Ga0068852_10000351512 81
12 3300013100 Ga0157373_10566021 Ga0157373_105660211 81
13 3300013102 Ga0157371_10017657 Ga0157371_100176573 81
14 3300013105 Ga0157369_10013212 Ga0157369_100132123 81
15 3300025920 Ga0207649_10013230 Ga0207649_100132307 81
16 3300026078 Ga0207702_10017757 Ga0207702_100177579 81
17 3300026142 Ga0207698_10016543 Ga0207698_100165433 81
18 3300005365 Ga0070688_100946983 Ga0070688_1009469831 82
19 3300009098 Ga0105245_11361441 Ga0105245_113614412 82
20 3300009177 Ga0105248_11452685 Ga0105248_114526852 82
21 3300013297 Ga0157378_11235478 Ga0157378_112354782 82
22 3300013308 Ga0157375_12399273 Ga0157375_123992731 82
23 3300025908 Ga0207643_10313891 Ga0207643_103138912 82
24 3300025936 Ga0207670_10171359 Ga0207670_101713593 82
25 3300026088 Ga0207641_11834906 Ga0207641_118349061 82
26 3300035090 Ga0373949_0047423 Ga0373949_0047423_587_850 82
27 3300035112 Ga0373932_0031082 Ga0373932_0031082_456_719 82
28 3300035121 Ga0373960_0368430 Ga0373960_0368430_18_281 82
29 3300042015 Ga0439462_0205998 Ga0439462_0205998_167_421 82
30 3300005327 Ga0070658_10462982 Ga0070658_104629821 83
31 3300005336 Ga0070680_100275136 Ga0070680_1002751363 83
32 3300005366 Ga0070659_100150383 Ga0070659_1001503831 83
33 3300005458 Ga0070681_10469862 Ga0070681_104698622 83
34 3300005535 Ga0070684_100508332 Ga0070684_1005083321 83
35 3300006163 Ga0070715_10580613 Ga0070715_105806131 83
36 3300006852 Ga0075433_10153552 Ga0075433_101535523 83
37 3300006914 Ga0075436_101512451 Ga0075436_1015124512 83
38 3300009147 Ga0114129_10012318 Ga0114129_100123184 83
39 3300009147 Ga0114129_12672930 Ga0114129_126729301 83
40 3300014969 Ga0157376_10420186 Ga0157376_104201862 83
41 3300025909 Ga0207705_10379489 Ga0207705_103794891 83
42 3300025912 Ga0207707_10409983 Ga0207707_104099832 83
43 3300025932 Ga0207690_10178983 Ga0207690_101789831 83
44 3300026121 Ga0207683_12058056 Ga0207683_120580561 83
45 3300031548 Ga0307408_100062875 Ga0307408_1000628753 83
46 3300031731 Ga0307405_10068934 Ga0307405_100689342 83
47 3300031911 Ga0307412_10394198 Ga0307412_103941981 83
48 3300039450 Ga0436363_1287039 Ga0436363_1287039_944_1198 83
49 3300041460 Ga0451802_2129832 Ga0451802_2129832_376_633 83
50 3300048907 Ga0496104_0237386 Ga0496104_0237386_760_1017 83
51 3300050507 nmdc:mga05p37_28626_c1 nmdc:mga05p37_28626_c1_1264_1518 83
52 3300050507 nmdc:mga05p37_91746_c1 nmdc:mga05p37_91746_c1_349_603 83
53 3300050509 nmdc:mga0qj67_1152536_c1 nmdc:mga0qj67_1152536_c1_61_327 83
54 3300050514 nmdc:mga08x19_625189_c1 nmdc:mga08x19_625189_c1_79_336 83
55 3300005290 Ga0065712_10142496 Ga0065712_101424962 84
56 3300005293 Ga0065715_10019073 Ga0065715_100190733 84
57 3300005334 Ga0068869_101012395 Ga0068869_1010123952 84
58 3300005347 Ga0070668_101808683 Ga0070668_1018086831 84
59 3300005719 Ga0068861_100644622 Ga0068861_1006446222 84
60 3300006178 Ga0075367_10403560 Ga0075367_104035602 84
61 3300006195 Ga0075366_10008607 Ga0075366_100086076 84
62 3300006353 Ga0075370_10264885 Ga0075370_102648852 84
63 3300006358 Ga0068871_101728431 Ga0068871_1017284312 84
64 3300009094 Ga0111539_10437960 Ga0111539_104379601 84
65 3300025910 Ga0207684_11544700 Ga0207684_115447001 84
66 3300025972 Ga0207668_11062179 Ga0207668_110621792 84
67 3300026118 Ga0207675_100073156 Ga0207675_1000731564 84
68 3300041411 Ga0439466_0282204 Ga0439466_0282204_95_355 84
69 3300049689 Ga0501260_055904 Ga0501260_055904_92_352 84
70 3300050493 nmdc:mga0k408_30555_c1 nmdc:mga0k408_30555_c1_2742_3005 84
71 3300059645 Ga0587076_191297 Ga0587076_191297_98_355 84
72 3300003323 rootH1_10227068 rootH1_102270682 85
73 3300005343 Ga0070687_101283501 Ga0070687_1012835011 85
74 3300005458 Ga0070681_11790744 Ga0070681_117907441 85
75 3300005616 Ga0068852_102035615 Ga0068852_1020356152 85
76 3300005617 Ga0068859_100001549 Ga0068859_10000154919 85
77 3300005841 Ga0068863_100017339 Ga0068863_1000173393 85
78 3300005843 Ga0068860_100005237 Ga0068860_1000052374 85
79 3300005844 Ga0068862_100000075 Ga0068862_10000007520 85
80 3300006358 Ga0068871_101208437 Ga0068871_1012084372 85
81 3300006931 Ga0097620_100001549 Ga0097620_1000015492 85
82 3300009094 Ga0111539_12059204 Ga0111539_120592042 85
83 3300009553 Ga0105249_10349380 Ga0105249_103493802 85
84 3300013105 Ga0157369_12383431 Ga0157369_123834311 85
85 3300025900 Ga0207710_10002858 Ga0207710_100028585 85
86 3300025961 Ga0207712_10000012 Ga0207712_10000012368 85
87 3300026088 Ga0207641_10002367 Ga0207641_100023672 85
88 3300026118 Ga0207675_101079831 Ga0207675_1010798312 85
89 3300028380 Ga0268265_10000087 Ga0268265_1000008717 85
90 3300028381 Ga0268264_10001015 Ga0268264_1000101534 85
91 3300030733 Ga0314311_1016505 Ga0314311_10165052 85
92 3300030734 Ga0316179_1057253 Ga0316179_10572532 85
93 3300030736 Ga0316180_1191543 Ga0316180_11915432 85
94 3300030742 Ga0316183_1090669 Ga0316183_10906692 85
95 3300030745 Ga0316182_1291412 Ga0316182_12914122 85
96 3300031548 Ga0307408_102142300 Ga0307408_1021423002 85
97 3300048912 Ga0496109_0517913 Ga0496109_0517913_268_528 85
98 3300048913 Ga0496110_1017062 Ga0496110_1017062_128_385 85
99 3300048914 Ga0496111_0959210 Ga0496111_0959210_97_354 85
100 iso_pu_bacteria 2885427238 2885427340 85
101 2162886012 MBSR1b_contig_6265034 MBSR1b_0262.00003070 86
102 3300005293 Ga0065715_10006332 Ga0065715_100063327 86
103 3300005327 Ga0070658_10022891 Ga0070658_100228913 86
104 3300005327 Ga0070658_10136827 Ga0070658_101368273 86
105 3300005327 Ga0070658_11162074 Ga0070658_111620742 86
106 3300005328 Ga0070676_10767212 Ga0070676_107672122 86
107 3300005328 Ga0070676_11568705 Ga0070676_115687051 86
108 3300005329 Ga0070683_100853238 Ga0070683_1008532382 86
109 3300005331 Ga0070670_100048043 Ga0070670_1000480432 86
110 3300005331 Ga0070670_100049722 Ga0070670_1000497223 86
111 3300005331 Ga0070670_100106430 Ga0070670_1001064305 86
112 3300005331 Ga0070670_101189922 Ga0070670_1011899221 86
113 3300005333 Ga0070677_10001482 Ga0070677_1000148211 86
114 3300005333 Ga0070677_10203469 Ga0070677_102034692 86
115 3300005335 Ga0070666_10044883 Ga0070666_100448836 86
116 3300005338 Ga0068868_101727552 Ga0068868_1017275521 86
117 3300005339 Ga0070660_100063394 Ga0070660_1000633946 86
118 3300005344 Ga0070661_100019297 Ga0070661_1000192972 86
119 3300005344 Ga0070661_100525199 Ga0070661_1005251991 86
120 3300005344 Ga0070661_101074115 Ga0070661_1010741152 86
121 3300005345 Ga0070692_10546531 Ga0070692_105465311 86
122 3300005347 Ga0070668_100025261 Ga0070668_1000252612 86
123 3300005347 Ga0070668_100359888 Ga0070668_1003598882 86
124 3300005353 Ga0070669_100013193 Ga0070669_1000131934 86
125 3300005353 Ga0070669_100757402 Ga0070669_1007574021 86
126 3300005354 Ga0070675_100011593 Ga0070675_1000115939 86
127 3300005354 Ga0070675_100026972 Ga0070675_1000269726 86
128 3300005355 Ga0070671_100035325 Ga0070671_1000353253 86
129 3300005355 Ga0070671_101252777 Ga0070671_1012527771 86
130 3300005356 Ga0070674_100078245 Ga0070674_1000782452 86
131 3300005364 Ga0070673_100073244 Ga0070673_1000732442 86
132 3300005364 Ga0070673_100619423 Ga0070673_1006194232 86
133 3300005364 Ga0070673_102185533 Ga0070673_1021855331 86
134 3300005366 Ga0070659_100026598 Ga0070659_1000265982 86
135 3300005366 Ga0070659_100188814 Ga0070659_1001888142 86
136 3300005367 Ga0070667_100028538 Ga0070667_1000285383 86
137 3300005435 Ga0070714_100008378 Ga0070714_1000083786 86
138 3300005436 Ga0070713_100349957 Ga0070713_1003499572 86
139 3300005455 Ga0070663_100841371 Ga0070663_1008413712 86
140 3300005455 Ga0070663_101001994 Ga0070663_1010019941 86
141 3300005455 Ga0070663_101462300 Ga0070663_1014623001 86
142 3300005456 Ga0070678_100163472 Ga0070678_1001634722 86
143 3300005457 Ga0070662_100006956 Ga0070662_1000069565 86
144 3300005457 Ga0070662_100024876 Ga0070662_1000248763 86
145 3300005457 Ga0070662_100042331 Ga0070662_1000423314 86
146 3300005457 Ga0070662_100822709 Ga0070662_1008227092 86
147 3300005459 Ga0068867_100508046 Ga0068867_1005080462 86
148 3300005535 Ga0070684_101652225 Ga0070684_1016522252 86
149 3300005539 Ga0068853_100135164 Ga0068853_1001351641 86
150 3300005543 Ga0070672_100494363 Ga0070672_1004943632 86
151 3300005543 Ga0070672_101441848 Ga0070672_1014418481 86
152 3300005544 Ga0070686_100584182 Ga0070686_1005841822 86
153 3300005563 Ga0068855_100267377 Ga0068855_1002673772 86
154 3300005564 Ga0070664_100002761 Ga0070664_1000027614 86
155 3300005564 Ga0070664_100005532 Ga0070664_1000055323 86
156 3300005564 Ga0070664_100047638 Ga0070664_1000476382 86
157 3300005564 Ga0070664_100173954 Ga0070664_1001739542 86
158 3300005564 Ga0070664_100853099 Ga0070664_1008530992 86
159 3300005578 Ga0068854_100212947 Ga0068854_1002129472 86
160 3300005614 Ga0068856_100081860 Ga0068856_1000818602 86
161 3300005614 Ga0068856_102611076 Ga0068856_1026110761 86
162 3300005616 Ga0068852_100035142 Ga0068852_1000351423 86
163 3300005618 Ga0068864_100084836 Ga0068864_1000848365 86
164 3300005618 Ga0068864_100185737 Ga0068864_1001857372 86
165 3300005718 Ga0068866_10473974 Ga0068866_104739742 86
166 3300005719 Ga0068861_100661372 Ga0068861_1006613721 86
167 3300005834 Ga0068851_10050201 Ga0068851_100502013 86
168 3300005842 Ga0068858_100670365 Ga0068858_1006703652 86
169 3300005844 Ga0068862_100076411 Ga0068862_1000764112 86
170 3300006237 Ga0097621_101534775 Ga0097621_1015347752 86
171 3300006358 Ga0068871_100399968 Ga0068871_1003999682 86
172 3300009174 Ga0105241_12205427 Ga0105241_122054271 86
173 3300009176 Ga0105242_12890924 Ga0105242_128909241 86
174 3300009177 Ga0105248_10085335 Ga0105248_100853354 86
175 3300009553 Ga0105249_10464943 Ga0105249_104649432 86
176 3300011119 Ga0105246_12515243 Ga0105246_125152431 86
177 3300012512 Ga0157327_1030390 Ga0157327_10303901 86
178 3300013100 Ga0157373_10008353 Ga0157373_100083533 86
179 3300013102 Ga0157371_10359652 Ga0157371_103596522 86
180 3300013105 Ga0157369_10378275 Ga0157369_103782753 86
181 3300013296 Ga0157374_10388447 Ga0157374_103884472 86
182 3300013306 Ga0163162_13160095 Ga0163162_131600951 86
183 3300013306 Ga0163162_13170535 Ga0163162_131705352 86
184 3300013308 Ga0157375_10409526 Ga0157375_104095262 86
185 3300014325 Ga0163163_11208264 Ga0163163_112082642 86
186 3300014326 Ga0157380_10046399 Ga0157380_100463996 86
187 3300017792 Ga0163161_10284907 Ga0163161_102849072 86
188 3300025321 Ga0207656_10010354 Ga0207656_100103543 86
189 3300025321 Ga0207656_10024282 Ga0207656_100242822 86
190 3300025893 Ga0207682_10000899 Ga0207682_1000089911 86
191 3300025893 Ga0207682_10143476 Ga0207682_101434762 86
192 3300025899 Ga0207642_10232824 Ga0207642_102328242 86
193 3300025901 Ga0207688_10017136 Ga0207688_100171365 86
194 3300025901 Ga0207688_10083965 Ga0207688_100839652 86
195 3300025901 Ga0207688_10513792 Ga0207688_105137922 86
196 3300025903 Ga0207680_10049819 Ga0207680_100498192 86
197 3300025907 Ga0207645_10330602 Ga0207645_103306022 86
198 3300025909 Ga0207705_10006764 Ga0207705_100067648 86
199 3300025909 Ga0207705_10096376 Ga0207705_100963762 86
200 3300025918 Ga0207662_11002399 Ga0207662_110023991 86
201 3300025919 Ga0207657_10002456 Ga0207657_1000245616 86
202 3300025920 Ga0207649_10037152 Ga0207649_100371522 86
203 3300025920 Ga0207649_10049849 Ga0207649_100498492 86
204 3300025920 Ga0207649_10697510 Ga0207649_106975102 86
205 3300025920 Ga0207649_11165724 Ga0207649_111657242 86
206 3300025923 Ga0207681_10718392 Ga0207681_107183921 86
207 3300025925 Ga0207650_10075443 Ga0207650_100754432 86
208 3300025925 Ga0207650_10100025 Ga0207650_101000252 86
209 3300025925 Ga0207650_10259138 Ga0207650_102591382 86
210 3300025926 Ga0207659_10013492 Ga0207659_100134922 86
211 3300025926 Ga0207659_10104422 Ga0207659_101044222 86
212 3300025928 Ga0207700_10168191 Ga0207700_101681912 86
213 3300025928 Ga0207700_10819300 Ga0207700_108193002 86
214 3300025929 Ga0207664_10004690 Ga0207664_100046903 86
215 3300025931 Ga0207644_10020511 Ga0207644_100205117 86
216 3300025931 Ga0207644_10292832 Ga0207644_102928322 86
217 3300025932 Ga0207690_10016823 Ga0207690_100168236 86
218 3300025932 Ga0207690_10153342 Ga0207690_101533422 86
219 3300025932 Ga0207690_11744738 Ga0207690_117447381 86
220 3300025933 Ga0207706_10008560 Ga0207706_1000856012 86
221 3300025933 Ga0207706_10036108 Ga0207706_100361085 86
222 3300025933 Ga0207706_10120330 Ga0207706_101203302 86
223 3300025937 Ga0207669_10206603 Ga0207669_102066032 86
224 3300025940 Ga0207691_10238734 Ga0207691_102387342 86
225 3300025940 Ga0207691_10469893 Ga0207691_104698932 86
226 3300025940 Ga0207691_11312220 Ga0207691_113122202 86
227 3300025942 Ga0207689_10138759 Ga0207689_101387592 86
228 3300025944 Ga0207661_10630086 Ga0207661_106300862 86
229 3300025944 Ga0207661_11056856 Ga0207661_110568561 86
230 3300025945 Ga0207679_10017661 Ga0207679_100176612 86
231 3300025945 Ga0207679_10129762 Ga0207679_101297622 86
232 3300025945 Ga0207679_10134811 Ga0207679_101348112 86
233 3300025945 Ga0207679_10814657 Ga0207679_108146572 86
234 3300025945 Ga0207679_11085757 Ga0207679_110857572 86
235 3300025945 Ga0207679_12177688 Ga0207679_121776881 86
236 3300025949 Ga0207667_10461542 Ga0207667_104615422 86
237 3300025960 Ga0207651_10257434 Ga0207651_102574342 86
238 3300025960 Ga0207651_10687534 Ga0207651_106875342 86
239 3300025960 Ga0207651_11088813 Ga0207651_110888132 86
240 3300025961 Ga0207712_10074572 Ga0207712_100745723 86
241 3300025972 Ga0207668_10047150 Ga0207668_100471503 86
242 3300025972 Ga0207668_10128549 Ga0207668_101285493 86
243 3300025972 Ga0207668_11116457 Ga0207668_111164571 86
244 3300025986 Ga0207658_10008780 Ga0207658_100087803 86
245 3300025986 Ga0207658_10189176 Ga0207658_101891762 86
246 3300026023 Ga0207677_11148349 Ga0207677_111483492 86
247 3300026041 Ga0207639_10423871 Ga0207639_104238712 86
248 3300026067 Ga0207678_10407677 Ga0207678_104076771 86
249 3300026078 Ga0207702_10101196 Ga0207702_101011962 86
250 3300026095 Ga0207676_10577733 Ga0207676_105777332 86
251 3300026118 Ga0207675_100771426 Ga0207675_1007714262 86
252 3300026121 Ga0207683_10613173 Ga0207683_106131732 86
253 3300026121 Ga0207683_10933198 Ga0207683_109331981 86
254 3300026142 Ga0207698_10382644 Ga0207698_103826442 86
255 3300026142 Ga0207698_10659261 Ga0207698_106592612 86
256 3300027665 Ga0209983_1088619 Ga0209983_10886192 86
257 3300028380 Ga0268265_10108460 Ga0268265_101084603 86
258 3300030745 Ga0316182_1027801 Ga0316182_10278012 86
259 3300031548 Ga0307408_100471265 Ga0307408_1004712652 86
260 3300031548 Ga0307408_100975583 Ga0307408_1009755832 86
261 3300031731 Ga0307405_10089238 Ga0307405_100892383 86
262 3300031731 Ga0307405_10119955 Ga0307405_101199552 86
263 3300031824 Ga0307413_10127294 Ga0307413_101272943 86
264 3300031824 Ga0307413_11206394 Ga0307413_112063942 86
265 3300031852 Ga0307410_10002031 Ga0307410_100020317 86
266 3300031852 Ga0307410_10051771 Ga0307410_100517713 86
267 3300031852 Ga0307410_10370196 Ga0307410_103701962 86
268 3300031901 Ga0307406_10033488 Ga0307406_100334885 86
269 3300031903 Ga0307407_10862214 Ga0307407_108622142 86
270 3300031911 Ga0307412_10268789 Ga0307412_102687892 86
271 3300031911 Ga0307412_11099365 Ga0307412_110993652 86
272 3300031995 Ga0307409_100143797 Ga0307409_1001437972 86
273 3300031995 Ga0307409_100196969 Ga0307409_1001969692 86
274 3300031995 Ga0307409_100248096 Ga0307409_1002480962 86
275 3300031995 Ga0307409_101952338 Ga0307409_1019523381 86
276 3300032002 Ga0307416_100000853 Ga0307416_1000008535 86
277 3300032002 Ga0307416_100405000 Ga0307416_1004050002 86
278 3300032002 Ga0307416_100569454 Ga0307416_1005694542 86
279 3300032002 Ga0307416_101620355 Ga0307416_1016203552 86
280 3300032002 Ga0307416_102290720 Ga0307416_1022907202 86
281 3300032004 Ga0307414_10000904 Ga0307414_1000090413 86
282 3300032005 Ga0307411_10124752 Ga0307411_101247522 86
283 3300032126 Ga0307415_100026338 Ga0307415_1000263383 86
284 3300034820 Ga0373959_0092406 Ga0373959_0092406_95_355 86
285 3300035115 Ga0373941_0349211 Ga0373941_0349211_285_545 86
286 3300035692 Ga0373935_1410416 Ga0373935_1410416_191_451 86
287 3300035725 Ga0373947_1137192 Ga0373947_1137192_156_416 86
288 3300037312 Ga0395899_0066080 Ga0395899_0066080_40_300 86
289 3300037418 Ga0395900_0025988 Ga0395900_0025988_2805_3065 86
290 3300037418 Ga0395900_0778130 Ga0395900_0778130_543_803 86
291 3300037418 Ga0395900_1127147 Ga0395900_1127147_111_371 86
292 3300037471 Ga0395905_0004140 Ga0395905_0004140_6720_6983 86
293 3300037471 Ga0395905_0009301 Ga0395905_0009301_2871_3131 86
294 3300037471 Ga0395905_0037976 Ga0395905_0037976_1975_2238 86
295 3300037471 Ga0395905_0054963 Ga0395905_0054963_2732_2992 86
296 3300037471 Ga0395905_0103972 Ga0395905_0103972_761_1021 86
297 3300037471 Ga0395905_0280720 Ga0395905_0280720_1069_1329 86
298 3300037471 Ga0395905_0603032 Ga0395905_0603032_550_810 86
299 3300038443 Ga0395901_0049725 Ga0395901_0049725_1517_1777 86
300 3300038443 Ga0395901_0398303 Ga0395901_0398303_64_327 86
301 3300038443 Ga0395901_0432417 Ga0395901_0432417_534_794 86
302 3300038443 Ga0395901_1531689 Ga0395901_1531689_112_372 86
303 3300041410 Ga0439461_0021157 Ga0439461_0021157_440_706 86
304 3300042006 Ga0439432_070144 Ga0439432_070144_482_748 86
305 3300042007 Ga0439449_0100663 Ga0439449_0100663_685_945 86
306 3300042015 Ga0439462_0054827 Ga0439462_0054827_218_484 86
307 3300042435 Ga0439434_0123362 Ga0439434_0123362_529_795 86
308 3300042876 Ga0451577_1631614 Ga0451577_1631614_86_400 86
309 3300044658 Ga0466972_0027887 Ga0466972_0027887_120_380 86
310 3300044658 Ga0466972_0050561 Ga0466972_0050561_1446_1709 86
311 3300044683 Ga0466965_0149619 Ga0466965_0149619_297_557 86
312 3300044683 Ga0466965_0337136 Ga0466965_0337136_91_351 86
313 3300044684 Ga0466966_0172851 Ga0466966_0172851_926_1186 86
314 3300044684 Ga0466966_0311370 Ga0466966_0311370_219_479 86
315 3300044693 Ga0466961_0295617 Ga0466961_0295617_610_870 86
316 3300044694 Ga0466963_0115535 Ga0466963_0115535_1346_1606 86
317 3300044694 Ga0466963_0161994 Ga0466963_0161994_1219_1479 86
318 3300044694 Ga0466963_0452673 Ga0466963_0452673_115_375 86
319 3300044719 Ga0466971_0122353 Ga0466971_0122353_549_809 86
320 3300044842 Ga0466957_0123834 Ga0466957_0123834_1090_1350 86
321 3300044901 Ga0466960_0163621 Ga0466960_0163621_553_816 86
322 3300045049 Ga0466959_0170180 Ga0466959_0170180_1046_1306 86
323 3300045836 Ga0466958_0210806 Ga0466958_0210806_757_1017 86
324 3300045976 Ga0466967_0129038 Ga0466967_0129038_448_711 86
325 3300045976 Ga0466967_0922619 Ga0466967_0922619_344_604 86
326 3300045976 Ga0466967_2052567 Ga0466967_2052567_83_343 86
327 3300046457 Ga0495590_0127010 Ga0495590_0127010_113_385 86
328 3300046492 Ga0495585_0210305 Ga0495585_0210305_18_284 86
329 3300046528 Ga0495642_0076606 Ga0495642_0076606_791_1063 86
330 3300046691 Ga0495670_0241225 Ga0495670_0241225_103_369 86
331 3300048904 Ga0496101_1101436 Ga0496101_1101436_255_515 86
332 3300048905 Ga0496102_0733380 Ga0496102_0733380_452_712 86
333 3300048908 Ga0496105_0146600 Ga0496105_0146600_819_1079 86
334 3300048910 Ga0496107_0077274 Ga0496107_0077274_2013_2273 86
335 3300048911 Ga0496108_0034982 Ga0496108_0034982_3686_3979 86
336 3300048911 Ga0496108_0071297 Ga0496108_0071297_2536_2796 86
337 3300048912 Ga0496109_0020606 Ga0496109_0020606_5429_5689 86
338 3300048912 Ga0496109_0052339 Ga0496109_0052339_1467_1730 86
339 3300048912 Ga0496109_0709375 Ga0496109_0709375_49_309 86
340 3300048913 Ga0496110_0036955 Ga0496110_0036955_2731_2991 86
341 3300048913 Ga0496110_0236834 Ga0496110_0236834_421_684 86
342 3300048914 Ga0496111_0054967 Ga0496111_0054967_997_1257 86
343 3300048914 Ga0496111_1182857 Ga0496111_1182857_220_489 86
344 3300048915 Ga0496112_0059671 Ga0496112_0059671_2105_2365 86
345 3300048915 Ga0496112_0420419 Ga0496112_0420419_604_864 86
346 3300048916 Ga0496113_0011581 Ga0496113_0011581_3147_3407 86
347 3300048916 Ga0496113_0026889 Ga0496113_0026889_863_1123 86
348 3300048927 Ga0496124_0244467 Ga0496124_0244467_36_305 86
349 3300049651 Ga0501201_035845 Ga0501201_035845_262_522 86
350 3300049677 Ga0501247_042849 Ga0501247_042849_130_390 86
351 3300049765 Ga0501268_061629 Ga0501268_061629_382_642 86

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04226

Transgly_assoc

Transglycosylase associated protein

37

85

0.96

Feature Viewer

pLDDT pTM Quality
62.88 0.33 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map