F418697
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 351 | 202 | 350 | 86 |
Family's Representative Sequence
| Representative Sequence | 3300031995|Ga0307409_100248096|Ga0307409_1002480962 |
| Length | 89 |
| Sequence | MMEDYGIIGWIVIGGLAGGIAKLLMPGRDPGGCIVTVLLGIAGALVAGWLGRAVGWYDANDQGAGFIAAIVGAFLLLLIYRVIAGRRRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 55 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 129 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 130 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 131 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 132 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 133 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 134 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 135 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 136 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 137 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 138 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 139 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 140 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 141 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 142 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 143 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 144 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 145 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 146 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 147 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 149 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 150 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 152 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 153 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 154 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 155 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 156 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 157 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 158 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 159 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 160 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 161 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 162 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 163 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 164 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 165 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 166 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 167 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 168 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 169 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 170 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 171 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 172 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 173 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 174 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 175 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 176 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 182 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 183 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 184 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 185 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 188 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 189 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 190 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 191 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 192 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 193 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 194 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 195 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 196 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 197 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.43 |
| Metatranscriptomes | 0.28 |
| Isolates | 0.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.14 |
| Nodule | 0 |
| Rhizoplane | 6.27 |
| Rhizosphere | 91.45 |
| Stem | 0 |
| Stem Tuber | 0.28 |
| Unclassified | 0.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_6265034 | 2162886012 | Bacteria | 871 |
| 2 | rootH1_10227068 | 3300003323 | Bacteria | 1146 |
| 3 | Ga0065712_10142496 | 3300005290 | Bacteria | 1438 |
| 4 | Ga0065715_10006332 | 3300005293 | Bacteria | 3883 |
| 5 | Ga0065715_10019073 | 3300005293 | Bacteria | 1726 |
| 6 | Ga0070658_10022891 | 3300005327 | Bacteria | 5015 |
| 7 | Ga0070658_10068417 | 3300005327 | Bacteria | 2903 |
| 8 | Ga0070658_10136827 | 3300005327 | Bacteria | 2044 |
| 9 | Ga0070658_10462982 | 3300005327 | Unclassified | 1093 |
| 10 | Ga0070658_11162074 | 3300005327 | Unclassified | 671 |
| 11 | Ga0070676_10767212 | 3300005328 | Unclassified | 709 |
| 12 | Ga0070676_11568705 | 3300005328 | Bacteria | 508 |
| 13 | Ga0070683_100853238 | 3300005329 | Unclassified | 873 |
| 14 | Ga0070670_100048043 | 3300005331 | Bacteria | 3673 |
| 15 | Ga0070670_100049722 | 3300005331 | Bacteria | 3604 |
| 16 | Ga0070670_100106430 | 3300005331 | Bacteria | 2417 |
| 17 | Ga0070670_101189922 | 3300005331 | Bacteria | 696 |
| 18 | Ga0070677_10001482 | 3300005333 | Bacteria | 7430 |
| 19 | Ga0070677_10203469 | 3300005333 | Bacteria | 957 |
| 20 | Ga0068869_101012395 | 3300005334 | Bacteria | 724 |
| 21 | Ga0070666_10044883 | 3300005335 | Bacteria | 2963 |
| 22 | Ga0070666_11019490 | 3300005335 | Bacteria | 614 |
| 23 | Ga0070680_100275136 | 3300005336 | Bacteria | 1426 |
| 24 | Ga0068868_101727552 | 3300005338 | Unclassified | 590 |
| 25 | Ga0070660_100063394 | 3300005339 | Bacteria | 2873 |
| 26 | Ga0070687_101283501 | 3300005343 | Bacteria | 543 |
| 27 | Ga0070661_100019297 | 3300005344 | Bacteria | 4860 |
| 28 | Ga0070661_100072971 | 3300005344 | Bacteria | 2526 |
| 29 | Ga0070661_100525199 | 3300005344 | Bacteria | 950 |
| 30 | Ga0070661_101074115 | 3300005344 | Unclassified | 670 |
| 31 | Ga0070692_10546531 | 3300005345 | Bacteria | 758 |
| 32 | Ga0070668_100025261 | 3300005347 | Bacteria | 4503 |
| 33 | Ga0070668_100359888 | 3300005347 | Bacteria | 1233 |
| 34 | Ga0070668_101808683 | 3300005347 | Bacteria | 562 |
| 35 | Ga0070669_100013193 | 3300005353 | Bacteria | 5874 |
| 36 | Ga0070669_100757402 | 3300005353 | Unclassified | 823 |
| 37 | Ga0070675_100011593 | 3300005354 | Bacteria | 6904 |
| 38 | Ga0070675_100026972 | 3300005354 | Bacteria | 4613 |
| 39 | Ga0070671_100035325 | 3300005355 | Bacteria | 4140 |
| 40 | Ga0070671_101252777 | 3300005355 | Bacteria | 653 |
| 41 | Ga0070674_100078245 | 3300005356 | Bacteria | 2356 |
| 42 | Ga0070673_100073244 | 3300005364 | Bacteria | 2757 |
| 43 | Ga0070673_100619423 | 3300005364 | Unclassified | 988 |
| 44 | Ga0070673_102185533 | 3300005364 | Bacteria | 526 |
| 45 | Ga0070688_100946983 | 3300005365 | Unclassified | 681 |
| 46 | Ga0070659_100026598 | 3300005366 | Bacteria | 4453 |
| 47 | Ga0070659_100150383 | 3300005366 | Bacteria | 1899 |
| 48 | Ga0070659_100188814 | 3300005366 | Bacteria | 1693 |
| 49 | Ga0070667_100028538 | 3300005367 | Bacteria | 4647 |
| 50 | Ga0070714_100008378 | 3300005435 | Bacteria | 8068 |
| 51 | Ga0070713_100349957 | 3300005436 | Bacteria | 1370 |
| 52 | Ga0070663_100081043 | 3300005455 | Bacteria | 2385 |
| 53 | Ga0070663_100841371 | 3300005455 | Unclassified | 789 |
| 54 | Ga0070663_101001994 | 3300005455 | Unclassified | 726 |
| 55 | Ga0070663_101462300 | 3300005455 | Unclassified | 607 |
| 56 | Ga0070678_100163472 | 3300005456 | Unclassified | 1806 |
| 57 | Ga0070662_100006956 | 3300005457 | Bacteria | 7319 |
| 58 | Ga0070662_100024876 | 3300005457 | Bacteria | 4130 |
| 59 | Ga0070662_100042331 | 3300005457 | Bacteria | 3253 |
| 60 | Ga0070662_100822709 | 3300005457 | Bacteria | 790 |
| 61 | Ga0070681_10469862 | 3300005458 | Bacteria | 1170 |
| 62 | Ga0070681_11790744 | 3300005458 | Bacteria | 541 |
| 63 | Ga0068867_100508046 | 3300005459 | Bacteria | 1037 |
| 64 | Ga0070684_100508332 | 3300005535 | Bacteria | 1116 |
| 65 | Ga0070684_101652225 | 3300005535 | Unclassified | 604 |
| 66 | Ga0068853_100135164 | 3300005539 | Bacteria | 2210 |
| 67 | Ga0070672_100494363 | 3300005543 | Unclassified | 1058 |
| 68 | Ga0070672_101441848 | 3300005543 | Unclassified | 616 |
| 69 | Ga0070686_100584182 | 3300005544 | Bacteria | 878 |
| 70 | Ga0068855_100013172 | 3300005563 | Bacteria | 9974 |
| 71 | Ga0068855_100267377 | 3300005563 | Bacteria | 1903 |
| 72 | Ga0070664_100002761 | 3300005564 | Bacteria | 14168 |
| 73 | Ga0070664_100005532 | 3300005564 | Bacteria | 10141 |
| 74 | Ga0070664_100047638 | 3300005564 | Bacteria | 3621 |
| 75 | Ga0070664_100173954 | 3300005564 | Unclassified | 1911 |
| 76 | Ga0070664_100853099 | 3300005564 | Unclassified | 853 |
| 77 | Ga0068854_100212947 | 3300005578 | Bacteria | 1525 |
| 78 | Ga0068856_100081860 | 3300005614 | Bacteria | 3204 |
| 79 | Ga0068856_100110532 | 3300005614 | Bacteria | 2745 |
| 80 | Ga0068856_102611076 | 3300005614 | Bacteria | 511 |
| 81 | Ga0068852_100003515 | 3300005616 | Bacteria | 10961 |
| 82 | Ga0068852_100035142 | 3300005616 | Bacteria | 4176 |
| 83 | Ga0068852_102035615 | 3300005616 | Bacteria | 596 |
| 84 | Ga0068859_100001549 | 3300005617 | Bacteria | 23444 |
| 85 | Ga0068864_100084836 | 3300005618 | Bacteria | 2784 |
| 86 | Ga0068864_100185737 | 3300005618 | Bacteria | 1903 |
| 87 | Ga0068866_10473974 | 3300005718 | Bacteria | 823 |
| 88 | Ga0068861_100644622 | 3300005719 | Bacteria | 978 |
| 89 | Ga0068861_100661372 | 3300005719 | Bacteria | 966 |
| 90 | Ga0068851_10050201 | 3300005834 | Bacteria | 2118 |
| 91 | Ga0068863_100017339 | 3300005841 | Bacteria | 6905 |
| 92 | Ga0068858_100670365 | 3300005842 | Bacteria | 1008 |
| 93 | Ga0068860_100005237 | 3300005843 | Bacteria | 13170 |
| 94 | Ga0068862_100000075 | 3300005844 | Bacteria | 117819 |
| 95 | Ga0068862_100076411 | 3300005844 | Bacteria | 2898 |
| 96 | Ga0070715_10580613 | 3300006163 | Bacteria | 654 |
| 97 | Ga0075367_10403560 | 3300006178 | Bacteria | 864 |
| 98 | Ga0075366_10008607 | 3300006195 | Bacteria | 5682 |
| 99 | Ga0097621_101534775 | 3300006237 | Unclassified | 632 |
| 100 | Ga0075370_10264885 | 3300006353 | Bacteria | 1020 |
| 101 | Ga0068871_100399968 | 3300006358 | Unclassified | 1223 |
| 102 | Ga0068871_101208437 | 3300006358 | Bacteria | 709 |
| 103 | Ga0068871_101728431 | 3300006358 | Unclassified | 593 |
| 104 | Ga0075433_10047137 | 3300006852 | Bacteria | 3749 |
| 105 | Ga0075433_10153552 | 3300006852 | Bacteria | 2048 |
| 106 | Ga0075434_100003361 | 3300006871 | Bacteria | 14317 |
| 107 | Ga0075436_101512451 | 3300006914 | Bacteria | 510 |
| 108 | Ga0097620_100001549 | 3300006931 | Bacteria | 23444 |
| 109 | Ga0111539_10437960 | 3300009094 | Bacteria | 1522 |
| 110 | Ga0111539_12059204 | 3300009094 | Bacteria | 662 |
| 111 | Ga0105245_11361441 | 3300009098 | Unclassified | 759 |
| 112 | Ga0114129_10012318 | 3300009147 | Bacteria | 12168 |
| 113 | Ga0114129_12672930 | 3300009147 | Unclassified | 595 |
| 114 | Ga0105241_12205427 | 3300009174 | Bacteria | 546 |
| 115 | Ga0105242_12890924 | 3300009176 | Bacteria | 531 |
| 116 | Ga0105248_10085335 | 3300009177 | Bacteria | 3553 |
| 117 | Ga0105248_11452685 | 3300009177 | Bacteria | 776 |
| 118 | Ga0105249_10349380 | 3300009553 | Bacteria | 1498 |
| 119 | Ga0105249_10464943 | 3300009553 | Bacteria | 1306 |
| 120 | Ga0105246_12515243 | 3300011119 | Unclassified | 507 |
| 121 | Ga0157327_1030390 | 3300012512 | Unclassified | 671 |
| 122 | Ga0157373_10008353 | 3300013100 | Bacteria | 7693 |
| 123 | Ga0157373_10566021 | 3300013100 | Bacteria | 825 |
| 124 | Ga0157371_10017657 | 3300013102 | Bacteria | 5293 |
| 125 | Ga0157371_10359652 | 3300013102 | Bacteria | 1061 |
| 126 | Ga0157369_10013212 | 3300013105 | Bacteria | 9345 |
| 127 | Ga0157369_10378275 | 3300013105 | Bacteria | 1470 |
| 128 | Ga0157369_12383431 | 3300013105 | Unclassified | 536 |
| 129 | Ga0157374_10388447 | 3300013296 | Unclassified | 1391 |
| 130 | Ga0157378_11235478 | 3300013297 | Unclassified | 787 |
| 131 | Ga0163162_13160095 | 3300013306 | Bacteria | 529 |
| 132 | Ga0163162_13170535 | 3300013306 | Bacteria | 528 |
| 133 | Ga0157375_10409526 | 3300013308 | Unclassified | 1522 |
| 134 | Ga0157375_12399273 | 3300013308 | Unclassified | 629 |
| 135 | Ga0163163_11208264 | 3300014325 | Unclassified | 819 |
| 136 | Ga0157380_10046399 | 3300014326 | Bacteria | 3412 |
| 137 | Ga0157376_10420186 | 3300014969 | Unclassified | 1297 |
| 138 | Ga0163161_10284907 | 3300017792 | Bacteria | 1297 |
| 139 | Ga0207656_10010354 | 3300025321 | Bacteria | 3492 |
| 140 | Ga0207656_10024282 | 3300025321 | Bacteria | 2450 |
| 141 | Ga0207682_10000899 | 3300025893 | Bacteria | 13769 |
| 142 | Ga0207682_10143476 | 3300025893 | Bacteria | 1073 |
| 143 | Ga0207642_10232824 | 3300025899 | Bacteria | 1036 |
| 144 | Ga0207710_10002858 | 3300025900 | Bacteria | 7860 |
| 145 | Ga0207688_10017136 | 3300025901 | Bacteria | 3937 |
| 146 | Ga0207688_10083965 | 3300025901 | Bacteria | 1822 |
| 147 | Ga0207688_10513792 | 3300025901 | Bacteria | 751 |
| 148 | Ga0207680_10049819 | 3300025903 | Bacteria | 2495 |
| 149 | Ga0207645_10330602 | 3300025907 | Bacteria | 1018 |
| 150 | Ga0207643_10313891 | 3300025908 | Bacteria | 978 |
| 151 | Ga0207705_10006764 | 3300025909 | Bacteria | 8475 |
| 152 | Ga0207705_10096376 | 3300025909 | Bacteria | 2172 |
| 153 | Ga0207705_10379489 | 3300025909 | Unclassified | 1092 |
| 154 | Ga0207684_11544700 | 3300025910 | Unclassified | 539 |
| 155 | Ga0207707_10409983 | 3300025912 | Bacteria | 1163 |
| 156 | Ga0207662_11002399 | 3300025918 | Bacteria | 593 |
| 157 | Ga0207657_10002456 | 3300025919 | Bacteria | 20031 |
| 158 | Ga0207649_10013230 | 3300025920 | Bacteria | 4604 |
| 159 | Ga0207649_10037152 | 3300025920 | Bacteria | 2940 |
| 160 | Ga0207649_10049849 | 3300025920 | Bacteria | 2588 |
| 161 | Ga0207649_10697510 | 3300025920 | Bacteria | 787 |
| 162 | Ga0207649_11165724 | 3300025920 | Unclassified | 609 |
| 163 | Ga0207681_10718392 | 3300025923 | Unclassified | 831 |
| 164 | Ga0207650_10075443 | 3300025925 | Bacteria | 2545 |
| 165 | Ga0207650_10100025 | 3300025925 | Bacteria | 2230 |
| 166 | Ga0207650_10259138 | 3300025925 | Bacteria | 1410 |
| 167 | Ga0207659_10013492 | 3300025926 | Bacteria | 5235 |
| 168 | Ga0207659_10104422 | 3300025926 | Bacteria | 2143 |
| 169 | Ga0207700_10168191 | 3300025928 | Bacteria | 1827 |
| 170 | Ga0207700_10819300 | 3300025928 | Unclassified | 833 |
| 171 | Ga0207664_10004690 | 3300025929 | Bacteria | 9274 |
| 172 | Ga0207644_10020511 | 3300025931 | Bacteria | 4493 |
| 173 | Ga0207644_10292832 | 3300025931 | Bacteria | 1310 |
| 174 | Ga0207690_10016823 | 3300025932 | Bacteria | 4456 |
| 175 | Ga0207690_10153342 | 3300025932 | Bacteria | 1710 |
| 176 | Ga0207690_10178983 | 3300025932 | Bacteria | 1595 |
| 177 | Ga0207690_11744738 | 3300025932 | Bacteria | 520 |
| 178 | Ga0207706_10008560 | 3300025933 | Bacteria | 9430 |
| 179 | Ga0207706_10036108 | 3300025933 | Bacteria | 4391 |
| 180 | Ga0207706_10120330 | 3300025933 | Bacteria | 2308 |
| 181 | Ga0207670_10171359 | 3300025936 | Bacteria | 1628 |
| 182 | Ga0207669_10206603 | 3300025937 | Bacteria | 1430 |
| 183 | Ga0207691_10238734 | 3300025940 | Bacteria | 1572 |
| 184 | Ga0207691_10469893 | 3300025940 | Unclassified | 1069 |
| 185 | Ga0207691_11312220 | 3300025940 | Unclassified | 597 |
| 186 | Ga0207689_10138759 | 3300025942 | Bacteria | 2003 |
| 187 | Ga0207661_10630086 | 3300025944 | Unclassified | 985 |
| 188 | Ga0207661_11056856 | 3300025944 | Unclassified | 748 |
| 189 | Ga0207679_10017661 | 3300025945 | Bacteria | 4763 |
| 190 | Ga0207679_10129762 | 3300025945 | Bacteria | 2020 |
| 191 | Ga0207679_10134811 | 3300025945 | Unclassified | 1987 |
| 192 | Ga0207679_10814657 | 3300025945 | Unclassified | 852 |
| 193 | Ga0207679_11085757 | 3300025945 | Bacteria | 734 |
| 194 | Ga0207679_12177688 | 3300025945 | Bacteria | 503 |
| 195 | Ga0207667_10461542 | 3300025949 | Bacteria | 1290 |
| 196 | Ga0207651_10257434 | 3300025960 | Unclassified | 1431 |
| 197 | Ga0207651_10687534 | 3300025960 | Unclassified | 900 |
| 198 | Ga0207651_11088813 | 3300025960 | Bacteria | 716 |
| 199 | Ga0207712_10000012 | 3300025961 | Bacteria | 392363 |
| 200 | Ga0207712_10074572 | 3300025961 | Bacteria | 2450 |
| 201 | Ga0207668_10047150 | 3300025972 | Bacteria | 2949 |
| 202 | Ga0207668_10128549 | 3300025972 | Bacteria | 1931 |
| 203 | Ga0207668_11062179 | 3300025972 | Bacteria | 725 |
| 204 | Ga0207668_11116457 | 3300025972 | Bacteria | 707 |
| 205 | Ga0207658_10008780 | 3300025986 | Bacteria | 6862 |
| 206 | Ga0207658_10189176 | 3300025986 | Bacteria | 1709 |
| 207 | Ga0207677_11148349 | 3300026023 | Unclassified | 710 |
| 208 | Ga0207639_10423871 | 3300026041 | Unclassified | 1203 |
| 209 | Ga0207678_10407677 | 3300026067 | Bacteria | 1177 |
| 210 | Ga0207702_10017757 | 3300026078 | Bacteria | 5889 |
| 211 | Ga0207702_10101196 | 3300026078 | Bacteria | 2544 |
| 212 | Ga0207641_10002367 | 3300026088 | Bacteria | 17403 |
| 213 | Ga0207641_11834906 | 3300026088 | Unclassified | 608 |
| 214 | Ga0207676_10577733 | 3300026095 | Unclassified | 1077 |
| 215 | Ga0207675_100073156 | 3300026118 | Bacteria | 3207 |
| 216 | Ga0207675_100771426 | 3300026118 | Bacteria | 973 |
| 217 | Ga0207675_101079831 | 3300026118 | Bacteria | 822 |
| 218 | Ga0207683_10613173 | 3300026121 | Unclassified | 1007 |
| 219 | Ga0207683_10933198 | 3300026121 | Bacteria | 806 |
| 220 | Ga0207683_12058056 | 3300026121 | Unclassified | 519 |
| 221 | Ga0207698_10016543 | 3300026142 | Bacteria | 4975 |
| 222 | Ga0207698_10382644 | 3300026142 | Unclassified | 1339 |
| 223 | Ga0207698_10659261 | 3300026142 | Bacteria | 1037 |
| 224 | Ga0209983_1088619 | 3300027665 | Bacteria | 696 |
| 225 | Ga0268265_10000087 | 3300028380 | Bacteria | 117852 |
| 226 | Ga0268265_10108460 | 3300028380 | Bacteria | 2260 |
| 227 | Ga0268264_10001015 | 3300028381 | Bacteria | 28303 |
| 228 | Ga0314311_1016505 | 3300030733 | Bacteria | 1209 |
| 229 | Ga0316179_1057253 | 3300030734 | Bacteria | 796 |
| 230 | Ga0316180_1191543 | 3300030736 | Bacteria | 659 |
| 231 | Ga0316183_1090669 | 3300030742 | Bacteria | 985 |
| 232 | Ga0316182_1027801 | 3300030745 | Bacteria | 1037 |
| 233 | Ga0316182_1291412 | 3300030745 | Bacteria | 1398 |
| 234 | Ga0307408_100062875 | 3300031548 | Bacteria | 2714 |
| 235 | Ga0307408_100471265 | 3300031548 | Bacteria | 1093 |
| 236 | Ga0307408_100975583 | 3300031548 | Bacteria | 780 |
| 237 | Ga0307408_102142300 | 3300031548 | Bacteria | 540 |
| 238 | Ga0307405_10068934 | 3300031731 | Bacteria | 2266 |
| 239 | Ga0307405_10089238 | 3300031731 | Bacteria | 2036 |
| 240 | Ga0307405_10119955 | 3300031731 | Bacteria | 1798 |
| 241 | Ga0307413_10127294 | 3300031824 | Bacteria | 1737 |
| 242 | Ga0307413_11206394 | 3300031824 | Bacteria | 658 |
| 243 | Ga0307410_10002031 | 3300031852 | Bacteria | 9548 |
| 244 | Ga0307410_10051771 | 3300031852 | Bacteria | 2769 |
| 245 | Ga0307410_10370196 | 3300031852 | Bacteria | 1150 |
| 246 | Ga0307406_10033488 | 3300031901 | Bacteria | 3146 |
| 247 | Ga0307407_10862214 | 3300031903 | Bacteria | 693 |
| 248 | Ga0307412_10268789 | 3300031911 | Bacteria | 1333 |
| 249 | Ga0307412_10394198 | 3300031911 | Unclassified | 1125 |
| 250 | Ga0307412_11099365 | 3300031911 | Bacteria | 707 |
| 251 | Ga0307409_100143797 | 3300031995 | Bacteria | 2059 |
| 252 | Ga0307409_100196969 | 3300031995 | Bacteria | 1799 |
| 253 | Ga0307409_100248096 | 3300031995 | Bacteria | 1626 |
| 254 | Ga0307409_101952338 | 3300031995 | Bacteria | 616 |
| 255 | Ga0307416_100000853 | 3300032002 | Bacteria | 16054 |
| 256 | Ga0307416_100405000 | 3300032002 | Bacteria | 1403 |
| 257 | Ga0307416_100569454 | 3300032002 | Bacteria | 1208 |
| 258 | Ga0307416_101620355 | 3300032002 | Bacteria | 752 |
| 259 | Ga0307416_102290720 | 3300032002 | Bacteria | 641 |
| 260 | Ga0307414_10000904 | 3300032004 | Bacteria | 15210 |
| 261 | Ga0307411_10124752 | 3300032005 | Bacteria | 1870 |
| 262 | Ga0307415_100026338 | 3300032126 | Bacteria | 3666 |
| 263 | Ga0373959_0092406 | 3300034820 | Bacteria | 711 |
| 264 | Ga0373949_0047423 | 3300035090 | Unclassified | 1074 |
| 265 | Ga0373932_0031082 | 3300035112 | Unclassified | 1485 |
| 266 | Ga0373941_0349211 | 3300035115 | Bacteria | 601 |
| 267 | Ga0373960_0368430 | 3300035121 | Unclassified | 548 |
| 268 | Ga0373935_1410416 | 3300035692 | Bacteria | 521 |
| 269 | Ga0373947_1137192 | 3300035725 | Bacteria | 532 |
| 270 | Ga0395899_0066080 | 3300037312 | Bacteria | 2656 |
| 271 | Ga0395900_0025988 | 3300037418 | Bacteria | 5995 |
| 272 | Ga0395900_0778130 | 3300037418 | Bacteria | 886 |
| 273 | Ga0395900_1127147 | 3300037418 | Unclassified | 701 |
| 274 | Ga0395905_0004140 | 3300037471 | Bacteria | 15179 |
| 275 | Ga0395905_0009301 | 3300037471 | Bacteria | 9614 |
| 276 | Ga0395905_0037976 | 3300037471 | Bacteria | 4519 |
| 277 | Ga0395905_0054963 | 3300037471 | Bacteria | 3726 |
| 278 | Ga0395905_0103972 | 3300037471 | Bacteria | 2666 |
| 279 | Ga0395905_0280720 | 3300037471 | Bacteria | 1552 |
| 280 | Ga0395905_0603032 | 3300037471 | Unclassified | 1000 |
| 281 | Ga0395901_0049725 | 3300038443 | Bacteria | 4356 |
| 282 | Ga0395901_0398303 | 3300038443 | Bacteria | 1415 |
| 283 | Ga0395901_0432417 | 3300038443 | Unclassified | 1348 |
| 284 | Ga0395901_1531689 | 3300038443 | Unclassified | 622 |
| 285 | Ga0436363_1287039 | 3300039450 | Bacteria | 1231 |
| 286 | Ga0439461_0021157 | 3300041410 | Bacteria | 1294 |
| 287 | Ga0439466_0282204 | 3300041411 | Bacteria | 503 |
| 288 | Ga0451802_2129832 | 3300041460 | Unclassified | 655 |
| 289 | Ga0439432_070144 | 3300042006 | Bacteria | 1070 |
| 290 | Ga0439449_0100663 | 3300042007 | Bacteria | 1068 |
| 291 | Ga0439462_0054827 | 3300042015 | Bacteria | 1075 |
| 292 | Ga0439462_0205998 | 3300042015 | Bacteria | 561 |
| 293 | Ga0439434_0123362 | 3300042435 | Unclassified | 846 |
| 294 | Ga0451577_1631614 | 3300042876 | Unclassified | 568 |
| 295 | Ga0466972_0027887 | 3300044658 | Bacteria | 2791 |
| 296 | Ga0466972_0050561 | 3300044658 | Bacteria | 2006 |
| 297 | Ga0466965_0149619 | 3300044683 | Bacteria | 1220 |
| 298 | Ga0466965_0337136 | 3300044683 | Bacteria | 824 |
| 299 | Ga0466966_0172851 | 3300044684 | Bacteria | 1312 |
| 300 | Ga0466966_0311370 | 3300044684 | Bacteria | 946 |
| 301 | Ga0466961_0295617 | 3300044693 | Bacteria | 990 |
| 302 | Ga0466963_0115535 | 3300044694 | Bacteria | 1844 |
| 303 | Ga0466963_0161994 | 3300044694 | Bacteria | 1557 |
| 304 | Ga0466963_0452673 | 3300044694 | Bacteria | 906 |
| 305 | Ga0466971_0122353 | 3300044719 | Bacteria | 1205 |
| 306 | Ga0466957_0123834 | 3300044842 | Bacteria | 1650 |
| 307 | Ga0466960_0163621 | 3300044901 | Bacteria | 1196 |
| 308 | Ga0466959_0170180 | 3300045049 | Bacteria | 1528 |
| 309 | Ga0466958_0210806 | 3300045836 | Bacteria | 1238 |
| 310 | Ga0466967_0129038 | 3300045976 | Bacteria | 2345 |
| 311 | Ga0466967_0922619 | 3300045976 | Bacteria | 869 |
| 312 | Ga0466967_2052567 | 3300045976 | Unclassified | 568 |
| 313 | Ga0495590_0127010 | 3300046457 | Unclassified | 916 |
| 314 | Ga0495585_0210305 | 3300046492 | Bacteria | 986 |
| 315 | Ga0495642_0076606 | 3300046528 | Bacteria | 1404 |
| 316 | Ga0495670_0241225 | 3300046691 | Bacteria | 962 |
| 317 | Ga0496101_1101436 | 3300048904 | Bacteria | 623 |
| 318 | Ga0496102_0733380 | 3300048905 | Unclassified | 911 |
| 319 | Ga0496104_0237386 | 3300048907 | Bacteria | 1735 |
| 320 | Ga0496105_0146600 | 3300048908 | Unclassified | 1941 |
| 321 | Ga0496107_0077274 | 3300048910 | Bacteria | 2425 |
| 322 | Ga0496108_0034982 | 3300048911 | Bacteria | 4174 |
| 323 | Ga0496108_0071297 | 3300048911 | Bacteria | 2931 |
| 324 | Ga0496109_0020606 | 3300048912 | Bacteria | 5824 |
| 325 | Ga0496109_0052339 | 3300048912 | Bacteria | 3721 |
| 326 | Ga0496109_0517913 | 3300048912 | Bacteria | 1126 |
| 327 | Ga0496109_0709375 | 3300048912 | Unclassified | 943 |
| 328 | Ga0496110_0036955 | 3300048913 | Bacteria | 4243 |
| 329 | Ga0496110_0236834 | 3300048913 | Unclassified | 1661 |
| 330 | Ga0496110_1017062 | 3300048913 | Bacteria | 736 |
| 331 | Ga0496111_0054967 | 3300048914 | Bacteria | 2879 |
| 332 | Ga0496111_0959210 | 3300048914 | Bacteria | 614 |
| 333 | Ga0496111_1182857 | 3300048914 | Bacteria | 542 |
| 334 | Ga0496112_0059671 | 3300048915 | Bacteria | 3759 |
| 335 | Ga0496112_0420419 | 3300048915 | Unclassified | 1275 |
| 336 | Ga0496113_0011581 | 3300048916 | Bacteria | 5893 |
| 337 | Ga0496113_0026889 | 3300048916 | Bacteria | 4118 |
| 338 | Ga0496124_0244467 | 3300048927 | Bacteria | 1332 |
| 339 | Ga0501201_035845 | 3300049651 | Bacteria | 581 |
| 340 | Ga0501247_042849 | 3300049677 | Bacteria | 651 |
| 341 | Ga0501260_055904 | 3300049689 | Unclassified | 506 |
| 342 | Ga0501268_061629 | 3300049765 | Bacteria | 744 |
| 343 | nmdc:mga0k408_30555_c1 | 3300050493 | Bacteria | 3072 |
| 344 | nmdc:mga05p37_28626_c1 | 3300050507 | Bacteria | 6796 |
| 345 | nmdc:mga05p37_91746_c1 | 3300050507 | Bacteria | 3743 |
| 346 | nmdc:mga0qj67_1152536_c1 | 3300050509 | Unclassified | 604 |
| 347 | nmdc:mga0n895_1777886_c1 | 3300050512 | Unclassified | 578 |
| 348 | nmdc:mga08x19_625189_c1 | 3300050514 | Bacteria | 763 |
| 349 | nmdc:mga0a205_36211_c1 | 3300050515 | Bacteria | 4741 |
| 350 | Ga0587076_191297 | 3300059645 | Bacteria | 521 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006852 | Ga0075433_10047137 | Ga0075433_100471374 | 80 |
| 2 | 3300006871 | Ga0075434_100003361 | Ga0075434_1000033619 | 80 |
| 3 | 3300050512 | nmdc:mga0n895_1777886_c1 | nmdc:mga0n895_1777886_c1_43_297 | 80 |
| 4 | 3300050515 | nmdc:mga0a205_36211_c1 | nmdc:mga0a205_36211_c1_3428_3682 | 80 |
| 5 | 3300005327 | Ga0070658_10068417 | Ga0070658_100684173 | 81 |
| 6 | 3300005335 | Ga0070666_11019490 | Ga0070666_110194901 | 81 |
| 7 | 3300005344 | Ga0070661_100072971 | Ga0070661_1000729714 | 81 |
| 8 | 3300005455 | Ga0070663_100081043 | Ga0070663_1000810432 | 81 |
| 9 | 3300005563 | Ga0068855_100013172 | Ga0068855_10001317212 | 81 |
| 10 | 3300005614 | Ga0068856_100110532 | Ga0068856_1001105323 | 81 |
| 11 | 3300005616 | Ga0068852_100003515 | Ga0068852_10000351512 | 81 |
| 12 | 3300013100 | Ga0157373_10566021 | Ga0157373_105660211 | 81 |
| 13 | 3300013102 | Ga0157371_10017657 | Ga0157371_100176573 | 81 |
| 14 | 3300013105 | Ga0157369_10013212 | Ga0157369_100132123 | 81 |
| 15 | 3300025920 | Ga0207649_10013230 | Ga0207649_100132307 | 81 |
| 16 | 3300026078 | Ga0207702_10017757 | Ga0207702_100177579 | 81 |
| 17 | 3300026142 | Ga0207698_10016543 | Ga0207698_100165433 | 81 |
| 18 | 3300005365 | Ga0070688_100946983 | Ga0070688_1009469831 | 82 |
| 19 | 3300009098 | Ga0105245_11361441 | Ga0105245_113614412 | 82 |
| 20 | 3300009177 | Ga0105248_11452685 | Ga0105248_114526852 | 82 |
| 21 | 3300013297 | Ga0157378_11235478 | Ga0157378_112354782 | 82 |
| 22 | 3300013308 | Ga0157375_12399273 | Ga0157375_123992731 | 82 |
| 23 | 3300025908 | Ga0207643_10313891 | Ga0207643_103138912 | 82 |
| 24 | 3300025936 | Ga0207670_10171359 | Ga0207670_101713593 | 82 |
| 25 | 3300026088 | Ga0207641_11834906 | Ga0207641_118349061 | 82 |
| 26 | 3300035090 | Ga0373949_0047423 | Ga0373949_0047423_587_850 | 82 |
| 27 | 3300035112 | Ga0373932_0031082 | Ga0373932_0031082_456_719 | 82 |
| 28 | 3300035121 | Ga0373960_0368430 | Ga0373960_0368430_18_281 | 82 |
| 29 | 3300042015 | Ga0439462_0205998 | Ga0439462_0205998_167_421 | 82 |
| 30 | 3300005327 | Ga0070658_10462982 | Ga0070658_104629821 | 83 |
| 31 | 3300005336 | Ga0070680_100275136 | Ga0070680_1002751363 | 83 |
| 32 | 3300005366 | Ga0070659_100150383 | Ga0070659_1001503831 | 83 |
| 33 | 3300005458 | Ga0070681_10469862 | Ga0070681_104698622 | 83 |
| 34 | 3300005535 | Ga0070684_100508332 | Ga0070684_1005083321 | 83 |
| 35 | 3300006163 | Ga0070715_10580613 | Ga0070715_105806131 | 83 |
| 36 | 3300006852 | Ga0075433_10153552 | Ga0075433_101535523 | 83 |
| 37 | 3300006914 | Ga0075436_101512451 | Ga0075436_1015124512 | 83 |
| 38 | 3300009147 | Ga0114129_10012318 | Ga0114129_100123184 | 83 |
| 39 | 3300009147 | Ga0114129_12672930 | Ga0114129_126729301 | 83 |
| 40 | 3300014969 | Ga0157376_10420186 | Ga0157376_104201862 | 83 |
| 41 | 3300025909 | Ga0207705_10379489 | Ga0207705_103794891 | 83 |
| 42 | 3300025912 | Ga0207707_10409983 | Ga0207707_104099832 | 83 |
| 43 | 3300025932 | Ga0207690_10178983 | Ga0207690_101789831 | 83 |
| 44 | 3300026121 | Ga0207683_12058056 | Ga0207683_120580561 | 83 |
| 45 | 3300031548 | Ga0307408_100062875 | Ga0307408_1000628753 | 83 |
| 46 | 3300031731 | Ga0307405_10068934 | Ga0307405_100689342 | 83 |
| 47 | 3300031911 | Ga0307412_10394198 | Ga0307412_103941981 | 83 |
| 48 | 3300039450 | Ga0436363_1287039 | Ga0436363_1287039_944_1198 | 83 |
| 49 | 3300041460 | Ga0451802_2129832 | Ga0451802_2129832_376_633 | 83 |
| 50 | 3300048907 | Ga0496104_0237386 | Ga0496104_0237386_760_1017 | 83 |
| 51 | 3300050507 | nmdc:mga05p37_28626_c1 | nmdc:mga05p37_28626_c1_1264_1518 | 83 |
| 52 | 3300050507 | nmdc:mga05p37_91746_c1 | nmdc:mga05p37_91746_c1_349_603 | 83 |
| 53 | 3300050509 | nmdc:mga0qj67_1152536_c1 | nmdc:mga0qj67_1152536_c1_61_327 | 83 |
| 54 | 3300050514 | nmdc:mga08x19_625189_c1 | nmdc:mga08x19_625189_c1_79_336 | 83 |
| 55 | 3300005290 | Ga0065712_10142496 | Ga0065712_101424962 | 84 |
| 56 | 3300005293 | Ga0065715_10019073 | Ga0065715_100190733 | 84 |
| 57 | 3300005334 | Ga0068869_101012395 | Ga0068869_1010123952 | 84 |
| 58 | 3300005347 | Ga0070668_101808683 | Ga0070668_1018086831 | 84 |
| 59 | 3300005719 | Ga0068861_100644622 | Ga0068861_1006446222 | 84 |
| 60 | 3300006178 | Ga0075367_10403560 | Ga0075367_104035602 | 84 |
| 61 | 3300006195 | Ga0075366_10008607 | Ga0075366_100086076 | 84 |
| 62 | 3300006353 | Ga0075370_10264885 | Ga0075370_102648852 | 84 |
| 63 | 3300006358 | Ga0068871_101728431 | Ga0068871_1017284312 | 84 |
| 64 | 3300009094 | Ga0111539_10437960 | Ga0111539_104379601 | 84 |
| 65 | 3300025910 | Ga0207684_11544700 | Ga0207684_115447001 | 84 |
| 66 | 3300025972 | Ga0207668_11062179 | Ga0207668_110621792 | 84 |
| 67 | 3300026118 | Ga0207675_100073156 | Ga0207675_1000731564 | 84 |
| 68 | 3300041411 | Ga0439466_0282204 | Ga0439466_0282204_95_355 | 84 |
| 69 | 3300049689 | Ga0501260_055904 | Ga0501260_055904_92_352 | 84 |
| 70 | 3300050493 | nmdc:mga0k408_30555_c1 | nmdc:mga0k408_30555_c1_2742_3005 | 84 |
| 71 | 3300059645 | Ga0587076_191297 | Ga0587076_191297_98_355 | 84 |
| 72 | 3300003323 | rootH1_10227068 | rootH1_102270682 | 85 |
| 73 | 3300005343 | Ga0070687_101283501 | Ga0070687_1012835011 | 85 |
| 74 | 3300005458 | Ga0070681_11790744 | Ga0070681_117907441 | 85 |
| 75 | 3300005616 | Ga0068852_102035615 | Ga0068852_1020356152 | 85 |
| 76 | 3300005617 | Ga0068859_100001549 | Ga0068859_10000154919 | 85 |
| 77 | 3300005841 | Ga0068863_100017339 | Ga0068863_1000173393 | 85 |
| 78 | 3300005843 | Ga0068860_100005237 | Ga0068860_1000052374 | 85 |
| 79 | 3300005844 | Ga0068862_100000075 | Ga0068862_10000007520 | 85 |
| 80 | 3300006358 | Ga0068871_101208437 | Ga0068871_1012084372 | 85 |
| 81 | 3300006931 | Ga0097620_100001549 | Ga0097620_1000015492 | 85 |
| 82 | 3300009094 | Ga0111539_12059204 | Ga0111539_120592042 | 85 |
| 83 | 3300009553 | Ga0105249_10349380 | Ga0105249_103493802 | 85 |
| 84 | 3300013105 | Ga0157369_12383431 | Ga0157369_123834311 | 85 |
| 85 | 3300025900 | Ga0207710_10002858 | Ga0207710_100028585 | 85 |
| 86 | 3300025961 | Ga0207712_10000012 | Ga0207712_10000012368 | 85 |
| 87 | 3300026088 | Ga0207641_10002367 | Ga0207641_100023672 | 85 |
| 88 | 3300026118 | Ga0207675_101079831 | Ga0207675_1010798312 | 85 |
| 89 | 3300028380 | Ga0268265_10000087 | Ga0268265_1000008717 | 85 |
| 90 | 3300028381 | Ga0268264_10001015 | Ga0268264_1000101534 | 85 |
| 91 | 3300030733 | Ga0314311_1016505 | Ga0314311_10165052 | 85 |
| 92 | 3300030734 | Ga0316179_1057253 | Ga0316179_10572532 | 85 |
| 93 | 3300030736 | Ga0316180_1191543 | Ga0316180_11915432 | 85 |
| 94 | 3300030742 | Ga0316183_1090669 | Ga0316183_10906692 | 85 |
| 95 | 3300030745 | Ga0316182_1291412 | Ga0316182_12914122 | 85 |
| 96 | 3300031548 | Ga0307408_102142300 | Ga0307408_1021423002 | 85 |
| 97 | 3300048912 | Ga0496109_0517913 | Ga0496109_0517913_268_528 | 85 |
| 98 | 3300048913 | Ga0496110_1017062 | Ga0496110_1017062_128_385 | 85 |
| 99 | 3300048914 | Ga0496111_0959210 | Ga0496111_0959210_97_354 | 85 |
| 100 | iso_pu_bacteria | 2885427238 | 2885427340 | 85 |
| 101 | 2162886012 | MBSR1b_contig_6265034 | MBSR1b_0262.00003070 | 86 |
| 102 | 3300005293 | Ga0065715_10006332 | Ga0065715_100063327 | 86 |
| 103 | 3300005327 | Ga0070658_10022891 | Ga0070658_100228913 | 86 |
| 104 | 3300005327 | Ga0070658_10136827 | Ga0070658_101368273 | 86 |
| 105 | 3300005327 | Ga0070658_11162074 | Ga0070658_111620742 | 86 |
| 106 | 3300005328 | Ga0070676_10767212 | Ga0070676_107672122 | 86 |
| 107 | 3300005328 | Ga0070676_11568705 | Ga0070676_115687051 | 86 |
| 108 | 3300005329 | Ga0070683_100853238 | Ga0070683_1008532382 | 86 |
| 109 | 3300005331 | Ga0070670_100048043 | Ga0070670_1000480432 | 86 |
| 110 | 3300005331 | Ga0070670_100049722 | Ga0070670_1000497223 | 86 |
| 111 | 3300005331 | Ga0070670_100106430 | Ga0070670_1001064305 | 86 |
| 112 | 3300005331 | Ga0070670_101189922 | Ga0070670_1011899221 | 86 |
| 113 | 3300005333 | Ga0070677_10001482 | Ga0070677_1000148211 | 86 |
| 114 | 3300005333 | Ga0070677_10203469 | Ga0070677_102034692 | 86 |
| 115 | 3300005335 | Ga0070666_10044883 | Ga0070666_100448836 | 86 |
| 116 | 3300005338 | Ga0068868_101727552 | Ga0068868_1017275521 | 86 |
| 117 | 3300005339 | Ga0070660_100063394 | Ga0070660_1000633946 | 86 |
| 118 | 3300005344 | Ga0070661_100019297 | Ga0070661_1000192972 | 86 |
| 119 | 3300005344 | Ga0070661_100525199 | Ga0070661_1005251991 | 86 |
| 120 | 3300005344 | Ga0070661_101074115 | Ga0070661_1010741152 | 86 |
| 121 | 3300005345 | Ga0070692_10546531 | Ga0070692_105465311 | 86 |
| 122 | 3300005347 | Ga0070668_100025261 | Ga0070668_1000252612 | 86 |
| 123 | 3300005347 | Ga0070668_100359888 | Ga0070668_1003598882 | 86 |
| 124 | 3300005353 | Ga0070669_100013193 | Ga0070669_1000131934 | 86 |
| 125 | 3300005353 | Ga0070669_100757402 | Ga0070669_1007574021 | 86 |
| 126 | 3300005354 | Ga0070675_100011593 | Ga0070675_1000115939 | 86 |
| 127 | 3300005354 | Ga0070675_100026972 | Ga0070675_1000269726 | 86 |
| 128 | 3300005355 | Ga0070671_100035325 | Ga0070671_1000353253 | 86 |
| 129 | 3300005355 | Ga0070671_101252777 | Ga0070671_1012527771 | 86 |
| 130 | 3300005356 | Ga0070674_100078245 | Ga0070674_1000782452 | 86 |
| 131 | 3300005364 | Ga0070673_100073244 | Ga0070673_1000732442 | 86 |
| 132 | 3300005364 | Ga0070673_100619423 | Ga0070673_1006194232 | 86 |
| 133 | 3300005364 | Ga0070673_102185533 | Ga0070673_1021855331 | 86 |
| 134 | 3300005366 | Ga0070659_100026598 | Ga0070659_1000265982 | 86 |
| 135 | 3300005366 | Ga0070659_100188814 | Ga0070659_1001888142 | 86 |
| 136 | 3300005367 | Ga0070667_100028538 | Ga0070667_1000285383 | 86 |
| 137 | 3300005435 | Ga0070714_100008378 | Ga0070714_1000083786 | 86 |
| 138 | 3300005436 | Ga0070713_100349957 | Ga0070713_1003499572 | 86 |
| 139 | 3300005455 | Ga0070663_100841371 | Ga0070663_1008413712 | 86 |
| 140 | 3300005455 | Ga0070663_101001994 | Ga0070663_1010019941 | 86 |
| 141 | 3300005455 | Ga0070663_101462300 | Ga0070663_1014623001 | 86 |
| 142 | 3300005456 | Ga0070678_100163472 | Ga0070678_1001634722 | 86 |
| 143 | 3300005457 | Ga0070662_100006956 | Ga0070662_1000069565 | 86 |
| 144 | 3300005457 | Ga0070662_100024876 | Ga0070662_1000248763 | 86 |
| 145 | 3300005457 | Ga0070662_100042331 | Ga0070662_1000423314 | 86 |
| 146 | 3300005457 | Ga0070662_100822709 | Ga0070662_1008227092 | 86 |
| 147 | 3300005459 | Ga0068867_100508046 | Ga0068867_1005080462 | 86 |
| 148 | 3300005535 | Ga0070684_101652225 | Ga0070684_1016522252 | 86 |
| 149 | 3300005539 | Ga0068853_100135164 | Ga0068853_1001351641 | 86 |
| 150 | 3300005543 | Ga0070672_100494363 | Ga0070672_1004943632 | 86 |
| 151 | 3300005543 | Ga0070672_101441848 | Ga0070672_1014418481 | 86 |
| 152 | 3300005544 | Ga0070686_100584182 | Ga0070686_1005841822 | 86 |
| 153 | 3300005563 | Ga0068855_100267377 | Ga0068855_1002673772 | 86 |
| 154 | 3300005564 | Ga0070664_100002761 | Ga0070664_1000027614 | 86 |
| 155 | 3300005564 | Ga0070664_100005532 | Ga0070664_1000055323 | 86 |
| 156 | 3300005564 | Ga0070664_100047638 | Ga0070664_1000476382 | 86 |
| 157 | 3300005564 | Ga0070664_100173954 | Ga0070664_1001739542 | 86 |
| 158 | 3300005564 | Ga0070664_100853099 | Ga0070664_1008530992 | 86 |
| 159 | 3300005578 | Ga0068854_100212947 | Ga0068854_1002129472 | 86 |
| 160 | 3300005614 | Ga0068856_100081860 | Ga0068856_1000818602 | 86 |
| 161 | 3300005614 | Ga0068856_102611076 | Ga0068856_1026110761 | 86 |
| 162 | 3300005616 | Ga0068852_100035142 | Ga0068852_1000351423 | 86 |
| 163 | 3300005618 | Ga0068864_100084836 | Ga0068864_1000848365 | 86 |
| 164 | 3300005618 | Ga0068864_100185737 | Ga0068864_1001857372 | 86 |
| 165 | 3300005718 | Ga0068866_10473974 | Ga0068866_104739742 | 86 |
| 166 | 3300005719 | Ga0068861_100661372 | Ga0068861_1006613721 | 86 |
| 167 | 3300005834 | Ga0068851_10050201 | Ga0068851_100502013 | 86 |
| 168 | 3300005842 | Ga0068858_100670365 | Ga0068858_1006703652 | 86 |
| 169 | 3300005844 | Ga0068862_100076411 | Ga0068862_1000764112 | 86 |
| 170 | 3300006237 | Ga0097621_101534775 | Ga0097621_1015347752 | 86 |
| 171 | 3300006358 | Ga0068871_100399968 | Ga0068871_1003999682 | 86 |
| 172 | 3300009174 | Ga0105241_12205427 | Ga0105241_122054271 | 86 |
| 173 | 3300009176 | Ga0105242_12890924 | Ga0105242_128909241 | 86 |
| 174 | 3300009177 | Ga0105248_10085335 | Ga0105248_100853354 | 86 |
| 175 | 3300009553 | Ga0105249_10464943 | Ga0105249_104649432 | 86 |
| 176 | 3300011119 | Ga0105246_12515243 | Ga0105246_125152431 | 86 |
| 177 | 3300012512 | Ga0157327_1030390 | Ga0157327_10303901 | 86 |
| 178 | 3300013100 | Ga0157373_10008353 | Ga0157373_100083533 | 86 |
| 179 | 3300013102 | Ga0157371_10359652 | Ga0157371_103596522 | 86 |
| 180 | 3300013105 | Ga0157369_10378275 | Ga0157369_103782753 | 86 |
| 181 | 3300013296 | Ga0157374_10388447 | Ga0157374_103884472 | 86 |
| 182 | 3300013306 | Ga0163162_13160095 | Ga0163162_131600951 | 86 |
| 183 | 3300013306 | Ga0163162_13170535 | Ga0163162_131705352 | 86 |
| 184 | 3300013308 | Ga0157375_10409526 | Ga0157375_104095262 | 86 |
| 185 | 3300014325 | Ga0163163_11208264 | Ga0163163_112082642 | 86 |
| 186 | 3300014326 | Ga0157380_10046399 | Ga0157380_100463996 | 86 |
| 187 | 3300017792 | Ga0163161_10284907 | Ga0163161_102849072 | 86 |
| 188 | 3300025321 | Ga0207656_10010354 | Ga0207656_100103543 | 86 |
| 189 | 3300025321 | Ga0207656_10024282 | Ga0207656_100242822 | 86 |
| 190 | 3300025893 | Ga0207682_10000899 | Ga0207682_1000089911 | 86 |
| 191 | 3300025893 | Ga0207682_10143476 | Ga0207682_101434762 | 86 |
| 192 | 3300025899 | Ga0207642_10232824 | Ga0207642_102328242 | 86 |
| 193 | 3300025901 | Ga0207688_10017136 | Ga0207688_100171365 | 86 |
| 194 | 3300025901 | Ga0207688_10083965 | Ga0207688_100839652 | 86 |
| 195 | 3300025901 | Ga0207688_10513792 | Ga0207688_105137922 | 86 |
| 196 | 3300025903 | Ga0207680_10049819 | Ga0207680_100498192 | 86 |
| 197 | 3300025907 | Ga0207645_10330602 | Ga0207645_103306022 | 86 |
| 198 | 3300025909 | Ga0207705_10006764 | Ga0207705_100067648 | 86 |
| 199 | 3300025909 | Ga0207705_10096376 | Ga0207705_100963762 | 86 |
| 200 | 3300025918 | Ga0207662_11002399 | Ga0207662_110023991 | 86 |
| 201 | 3300025919 | Ga0207657_10002456 | Ga0207657_1000245616 | 86 |
| 202 | 3300025920 | Ga0207649_10037152 | Ga0207649_100371522 | 86 |
| 203 | 3300025920 | Ga0207649_10049849 | Ga0207649_100498492 | 86 |
| 204 | 3300025920 | Ga0207649_10697510 | Ga0207649_106975102 | 86 |
| 205 | 3300025920 | Ga0207649_11165724 | Ga0207649_111657242 | 86 |
| 206 | 3300025923 | Ga0207681_10718392 | Ga0207681_107183921 | 86 |
| 207 | 3300025925 | Ga0207650_10075443 | Ga0207650_100754432 | 86 |
| 208 | 3300025925 | Ga0207650_10100025 | Ga0207650_101000252 | 86 |
| 209 | 3300025925 | Ga0207650_10259138 | Ga0207650_102591382 | 86 |
| 210 | 3300025926 | Ga0207659_10013492 | Ga0207659_100134922 | 86 |
| 211 | 3300025926 | Ga0207659_10104422 | Ga0207659_101044222 | 86 |
| 212 | 3300025928 | Ga0207700_10168191 | Ga0207700_101681912 | 86 |
| 213 | 3300025928 | Ga0207700_10819300 | Ga0207700_108193002 | 86 |
| 214 | 3300025929 | Ga0207664_10004690 | Ga0207664_100046903 | 86 |
| 215 | 3300025931 | Ga0207644_10020511 | Ga0207644_100205117 | 86 |
| 216 | 3300025931 | Ga0207644_10292832 | Ga0207644_102928322 | 86 |
| 217 | 3300025932 | Ga0207690_10016823 | Ga0207690_100168236 | 86 |
| 218 | 3300025932 | Ga0207690_10153342 | Ga0207690_101533422 | 86 |
| 219 | 3300025932 | Ga0207690_11744738 | Ga0207690_117447381 | 86 |
| 220 | 3300025933 | Ga0207706_10008560 | Ga0207706_1000856012 | 86 |
| 221 | 3300025933 | Ga0207706_10036108 | Ga0207706_100361085 | 86 |
| 222 | 3300025933 | Ga0207706_10120330 | Ga0207706_101203302 | 86 |
| 223 | 3300025937 | Ga0207669_10206603 | Ga0207669_102066032 | 86 |
| 224 | 3300025940 | Ga0207691_10238734 | Ga0207691_102387342 | 86 |
| 225 | 3300025940 | Ga0207691_10469893 | Ga0207691_104698932 | 86 |
| 226 | 3300025940 | Ga0207691_11312220 | Ga0207691_113122202 | 86 |
| 227 | 3300025942 | Ga0207689_10138759 | Ga0207689_101387592 | 86 |
| 228 | 3300025944 | Ga0207661_10630086 | Ga0207661_106300862 | 86 |
| 229 | 3300025944 | Ga0207661_11056856 | Ga0207661_110568561 | 86 |
| 230 | 3300025945 | Ga0207679_10017661 | Ga0207679_100176612 | 86 |
| 231 | 3300025945 | Ga0207679_10129762 | Ga0207679_101297622 | 86 |
| 232 | 3300025945 | Ga0207679_10134811 | Ga0207679_101348112 | 86 |
| 233 | 3300025945 | Ga0207679_10814657 | Ga0207679_108146572 | 86 |
| 234 | 3300025945 | Ga0207679_11085757 | Ga0207679_110857572 | 86 |
| 235 | 3300025945 | Ga0207679_12177688 | Ga0207679_121776881 | 86 |
| 236 | 3300025949 | Ga0207667_10461542 | Ga0207667_104615422 | 86 |
| 237 | 3300025960 | Ga0207651_10257434 | Ga0207651_102574342 | 86 |
| 238 | 3300025960 | Ga0207651_10687534 | Ga0207651_106875342 | 86 |
| 239 | 3300025960 | Ga0207651_11088813 | Ga0207651_110888132 | 86 |
| 240 | 3300025961 | Ga0207712_10074572 | Ga0207712_100745723 | 86 |
| 241 | 3300025972 | Ga0207668_10047150 | Ga0207668_100471503 | 86 |
| 242 | 3300025972 | Ga0207668_10128549 | Ga0207668_101285493 | 86 |
| 243 | 3300025972 | Ga0207668_11116457 | Ga0207668_111164571 | 86 |
| 244 | 3300025986 | Ga0207658_10008780 | Ga0207658_100087803 | 86 |
| 245 | 3300025986 | Ga0207658_10189176 | Ga0207658_101891762 | 86 |
| 246 | 3300026023 | Ga0207677_11148349 | Ga0207677_111483492 | 86 |
| 247 | 3300026041 | Ga0207639_10423871 | Ga0207639_104238712 | 86 |
| 248 | 3300026067 | Ga0207678_10407677 | Ga0207678_104076771 | 86 |
| 249 | 3300026078 | Ga0207702_10101196 | Ga0207702_101011962 | 86 |
| 250 | 3300026095 | Ga0207676_10577733 | Ga0207676_105777332 | 86 |
| 251 | 3300026118 | Ga0207675_100771426 | Ga0207675_1007714262 | 86 |
| 252 | 3300026121 | Ga0207683_10613173 | Ga0207683_106131732 | 86 |
| 253 | 3300026121 | Ga0207683_10933198 | Ga0207683_109331981 | 86 |
| 254 | 3300026142 | Ga0207698_10382644 | Ga0207698_103826442 | 86 |
| 255 | 3300026142 | Ga0207698_10659261 | Ga0207698_106592612 | 86 |
| 256 | 3300027665 | Ga0209983_1088619 | Ga0209983_10886192 | 86 |
| 257 | 3300028380 | Ga0268265_10108460 | Ga0268265_101084603 | 86 |
| 258 | 3300030745 | Ga0316182_1027801 | Ga0316182_10278012 | 86 |
| 259 | 3300031548 | Ga0307408_100471265 | Ga0307408_1004712652 | 86 |
| 260 | 3300031548 | Ga0307408_100975583 | Ga0307408_1009755832 | 86 |
| 261 | 3300031731 | Ga0307405_10089238 | Ga0307405_100892383 | 86 |
| 262 | 3300031731 | Ga0307405_10119955 | Ga0307405_101199552 | 86 |
| 263 | 3300031824 | Ga0307413_10127294 | Ga0307413_101272943 | 86 |
| 264 | 3300031824 | Ga0307413_11206394 | Ga0307413_112063942 | 86 |
| 265 | 3300031852 | Ga0307410_10002031 | Ga0307410_100020317 | 86 |
| 266 | 3300031852 | Ga0307410_10051771 | Ga0307410_100517713 | 86 |
| 267 | 3300031852 | Ga0307410_10370196 | Ga0307410_103701962 | 86 |
| 268 | 3300031901 | Ga0307406_10033488 | Ga0307406_100334885 | 86 |
| 269 | 3300031903 | Ga0307407_10862214 | Ga0307407_108622142 | 86 |
| 270 | 3300031911 | Ga0307412_10268789 | Ga0307412_102687892 | 86 |
| 271 | 3300031911 | Ga0307412_11099365 | Ga0307412_110993652 | 86 |
| 272 | 3300031995 | Ga0307409_100143797 | Ga0307409_1001437972 | 86 |
| 273 | 3300031995 | Ga0307409_100196969 | Ga0307409_1001969692 | 86 |
| 274 | 3300031995 | Ga0307409_100248096 | Ga0307409_1002480962 | 86 |
| 275 | 3300031995 | Ga0307409_101952338 | Ga0307409_1019523381 | 86 |
| 276 | 3300032002 | Ga0307416_100000853 | Ga0307416_1000008535 | 86 |
| 277 | 3300032002 | Ga0307416_100405000 | Ga0307416_1004050002 | 86 |
| 278 | 3300032002 | Ga0307416_100569454 | Ga0307416_1005694542 | 86 |
| 279 | 3300032002 | Ga0307416_101620355 | Ga0307416_1016203552 | 86 |
| 280 | 3300032002 | Ga0307416_102290720 | Ga0307416_1022907202 | 86 |
| 281 | 3300032004 | Ga0307414_10000904 | Ga0307414_1000090413 | 86 |
| 282 | 3300032005 | Ga0307411_10124752 | Ga0307411_101247522 | 86 |
| 283 | 3300032126 | Ga0307415_100026338 | Ga0307415_1000263383 | 86 |
| 284 | 3300034820 | Ga0373959_0092406 | Ga0373959_0092406_95_355 | 86 |
| 285 | 3300035115 | Ga0373941_0349211 | Ga0373941_0349211_285_545 | 86 |
| 286 | 3300035692 | Ga0373935_1410416 | Ga0373935_1410416_191_451 | 86 |
| 287 | 3300035725 | Ga0373947_1137192 | Ga0373947_1137192_156_416 | 86 |
| 288 | 3300037312 | Ga0395899_0066080 | Ga0395899_0066080_40_300 | 86 |
| 289 | 3300037418 | Ga0395900_0025988 | Ga0395900_0025988_2805_3065 | 86 |
| 290 | 3300037418 | Ga0395900_0778130 | Ga0395900_0778130_543_803 | 86 |
| 291 | 3300037418 | Ga0395900_1127147 | Ga0395900_1127147_111_371 | 86 |
| 292 | 3300037471 | Ga0395905_0004140 | Ga0395905_0004140_6720_6983 | 86 |
| 293 | 3300037471 | Ga0395905_0009301 | Ga0395905_0009301_2871_3131 | 86 |
| 294 | 3300037471 | Ga0395905_0037976 | Ga0395905_0037976_1975_2238 | 86 |
| 295 | 3300037471 | Ga0395905_0054963 | Ga0395905_0054963_2732_2992 | 86 |
| 296 | 3300037471 | Ga0395905_0103972 | Ga0395905_0103972_761_1021 | 86 |
| 297 | 3300037471 | Ga0395905_0280720 | Ga0395905_0280720_1069_1329 | 86 |
| 298 | 3300037471 | Ga0395905_0603032 | Ga0395905_0603032_550_810 | 86 |
| 299 | 3300038443 | Ga0395901_0049725 | Ga0395901_0049725_1517_1777 | 86 |
| 300 | 3300038443 | Ga0395901_0398303 | Ga0395901_0398303_64_327 | 86 |
| 301 | 3300038443 | Ga0395901_0432417 | Ga0395901_0432417_534_794 | 86 |
| 302 | 3300038443 | Ga0395901_1531689 | Ga0395901_1531689_112_372 | 86 |
| 303 | 3300041410 | Ga0439461_0021157 | Ga0439461_0021157_440_706 | 86 |
| 304 | 3300042006 | Ga0439432_070144 | Ga0439432_070144_482_748 | 86 |
| 305 | 3300042007 | Ga0439449_0100663 | Ga0439449_0100663_685_945 | 86 |
| 306 | 3300042015 | Ga0439462_0054827 | Ga0439462_0054827_218_484 | 86 |
| 307 | 3300042435 | Ga0439434_0123362 | Ga0439434_0123362_529_795 | 86 |
| 308 | 3300042876 | Ga0451577_1631614 | Ga0451577_1631614_86_400 | 86 |
| 309 | 3300044658 | Ga0466972_0027887 | Ga0466972_0027887_120_380 | 86 |
| 310 | 3300044658 | Ga0466972_0050561 | Ga0466972_0050561_1446_1709 | 86 |
| 311 | 3300044683 | Ga0466965_0149619 | Ga0466965_0149619_297_557 | 86 |
| 312 | 3300044683 | Ga0466965_0337136 | Ga0466965_0337136_91_351 | 86 |
| 313 | 3300044684 | Ga0466966_0172851 | Ga0466966_0172851_926_1186 | 86 |
| 314 | 3300044684 | Ga0466966_0311370 | Ga0466966_0311370_219_479 | 86 |
| 315 | 3300044693 | Ga0466961_0295617 | Ga0466961_0295617_610_870 | 86 |
| 316 | 3300044694 | Ga0466963_0115535 | Ga0466963_0115535_1346_1606 | 86 |
| 317 | 3300044694 | Ga0466963_0161994 | Ga0466963_0161994_1219_1479 | 86 |
| 318 | 3300044694 | Ga0466963_0452673 | Ga0466963_0452673_115_375 | 86 |
| 319 | 3300044719 | Ga0466971_0122353 | Ga0466971_0122353_549_809 | 86 |
| 320 | 3300044842 | Ga0466957_0123834 | Ga0466957_0123834_1090_1350 | 86 |
| 321 | 3300044901 | Ga0466960_0163621 | Ga0466960_0163621_553_816 | 86 |
| 322 | 3300045049 | Ga0466959_0170180 | Ga0466959_0170180_1046_1306 | 86 |
| 323 | 3300045836 | Ga0466958_0210806 | Ga0466958_0210806_757_1017 | 86 |
| 324 | 3300045976 | Ga0466967_0129038 | Ga0466967_0129038_448_711 | 86 |
| 325 | 3300045976 | Ga0466967_0922619 | Ga0466967_0922619_344_604 | 86 |
| 326 | 3300045976 | Ga0466967_2052567 | Ga0466967_2052567_83_343 | 86 |
| 327 | 3300046457 | Ga0495590_0127010 | Ga0495590_0127010_113_385 | 86 |
| 328 | 3300046492 | Ga0495585_0210305 | Ga0495585_0210305_18_284 | 86 |
| 329 | 3300046528 | Ga0495642_0076606 | Ga0495642_0076606_791_1063 | 86 |
| 330 | 3300046691 | Ga0495670_0241225 | Ga0495670_0241225_103_369 | 86 |
| 331 | 3300048904 | Ga0496101_1101436 | Ga0496101_1101436_255_515 | 86 |
| 332 | 3300048905 | Ga0496102_0733380 | Ga0496102_0733380_452_712 | 86 |
| 333 | 3300048908 | Ga0496105_0146600 | Ga0496105_0146600_819_1079 | 86 |
| 334 | 3300048910 | Ga0496107_0077274 | Ga0496107_0077274_2013_2273 | 86 |
| 335 | 3300048911 | Ga0496108_0034982 | Ga0496108_0034982_3686_3979 | 86 |
| 336 | 3300048911 | Ga0496108_0071297 | Ga0496108_0071297_2536_2796 | 86 |
| 337 | 3300048912 | Ga0496109_0020606 | Ga0496109_0020606_5429_5689 | 86 |
| 338 | 3300048912 | Ga0496109_0052339 | Ga0496109_0052339_1467_1730 | 86 |
| 339 | 3300048912 | Ga0496109_0709375 | Ga0496109_0709375_49_309 | 86 |
| 340 | 3300048913 | Ga0496110_0036955 | Ga0496110_0036955_2731_2991 | 86 |
| 341 | 3300048913 | Ga0496110_0236834 | Ga0496110_0236834_421_684 | 86 |
| 342 | 3300048914 | Ga0496111_0054967 | Ga0496111_0054967_997_1257 | 86 |
| 343 | 3300048914 | Ga0496111_1182857 | Ga0496111_1182857_220_489 | 86 |
| 344 | 3300048915 | Ga0496112_0059671 | Ga0496112_0059671_2105_2365 | 86 |
| 345 | 3300048915 | Ga0496112_0420419 | Ga0496112_0420419_604_864 | 86 |
| 346 | 3300048916 | Ga0496113_0011581 | Ga0496113_0011581_3147_3407 | 86 |
| 347 | 3300048916 | Ga0496113_0026889 | Ga0496113_0026889_863_1123 | 86 |
| 348 | 3300048927 | Ga0496124_0244467 | Ga0496124_0244467_36_305 | 86 |
| 349 | 3300049651 | Ga0501201_035845 | Ga0501201_035845_262_522 | 86 |
| 350 | 3300049677 | Ga0501247_042849 | Ga0501247_042849_130_390 | 86 |
| 351 | 3300049765 | Ga0501268_061629 | Ga0501268_061629_382_642 | 86 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar