F418745

General Info

Members Datasets Scaffolds Average Seq Length
351 274 265 393

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0151666|Ga0466967_0151666_1093_2154
Length 353
Sequence VIPYTYFGHTDPKSFIGFDAIVLATDSFFMAMFFFLSGLFVWPGLAHKAPSVFFRDRLVRLGLPFAIAALTIIPLAYYAIELRANPEITFAAYWWKTITVGPWPSGPVWFLWVLLAFDLSACAAFQISPTLLDPLNRLSLRGHDKPLNFFYALIAVTAIVYIPMRVSYGPNVWFEFGPFSVQINRVLLYAAYFYFGAGIGAANFERGVLGADGQLSQRGMGAWIVAMVVPYTLLWVLIAIKREVLGNQPTQPAWYEATYGLFFVAFSAATMFAILAYFLNRRRSEFSVLDRMQADAYGIFLVHYPVVLWIQYALFDLDVPAIAKATVAFVGTTVVSWGITWALRQVPGAKSIL

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
5 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
6 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
7 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
8 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
9 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
10 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
11 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
12 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
13 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
14 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
15 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
16 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
17 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
18 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
19 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
20 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
21 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
22 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
23 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
24 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
25 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
26 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
27 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
28 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
29 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
30 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
31 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
32 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
33 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
34 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
35 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
36 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
37 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
38 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
39 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
40 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
41 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
42 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
43 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
44 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
45 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
46 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
47 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
48 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
49 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
50 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
51 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
52 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
53 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
54 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
55 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
56 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
57 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
58 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
59 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
60 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
61 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
62 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
63 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
64 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
65 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
66 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
67 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
68 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
69 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
70 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
71 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
72 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
74 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
75 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
76 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
77 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
78 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
79 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
80 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
81 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
82 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
83 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
84 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
85 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
86 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
87 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
90 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
91 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
144 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
145 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
146 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
151 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
152 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
153 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
154 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
155 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
156 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
157 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
160 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
166 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
167 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
168 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
248 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
249 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
250 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
251 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
252 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
253 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
256 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
257 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
261 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
262 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
263 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
264 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
265 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
266 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
267 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
268 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
269 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
270 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
271 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
272 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
273 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
274 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.5
Metatranscriptomes 0
Isolates 24.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.12
Nodule 20.51
Rhizoplane 7.41
Rhizosphere 54.7
Stem 0
Stem Tuber 0
Unclassified 10.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000141 3300003203 Bacteria 31326
2 JGI25153J46596_10001533 3300003215 Bacteria 13713
3 JGI25160J50197_1001294 3300003354 Bacteria 12650
4 Ga0055543_1003754 3300004625 Bacteria 4340
5 Ga0065165_1002974 3300005262 Bacteria 12862
6 Ga0065165_1003005 3300005262 Bacteria 12758
7 Ga0065712_10110763 3300005290 Bacteria 1830
8 Ga0070658_10107279 3300005327 Bacteria 2311
9 Ga0070658_10225725 3300005327 Bacteria 1585
10 Ga0070683_100054825 3300005329 Bacteria 3697
11 Ga0070683_100085836 3300005329 Bacteria 2951
12 Ga0070683_100148009 3300005329 Bacteria 2226
13 Ga0070680_100003306 3300005336 Bacteria 12032
14 Ga0070680_100075298 3300005336 Bacteria 2778
15 Ga0070680_100111539 3300005336 Bacteria 2277
16 Ga0070660_100053294 3300005339 Bacteria 3120
17 Ga0070691_10022461 3300005341 Bacteria 2927
18 Ga0070659_100066547 3300005366 Bacteria 2855
19 Ga0070713_100185101 3300005436 Bacteria 1874
20 Ga0070710_10081825 3300005437 Bacteria 1886
21 Ga0070711_100047871 3300005439 Bacteria 2920
22 Ga0070681_10028949 3300005458 Bacteria 5565
23 Ga0070681_10052193 3300005458 Bacteria 4078
24 Ga0070681_10064419 3300005458 Bacteria 3635
25 Ga0070681_10087176 3300005458 Bacteria 3074
26 Ga0070679_100027061 3300005530 Bacteria 5639
27 Ga0070679_100044585 3300005530 Bacteria 4418
28 Ga0070679_100046319 3300005530 Bacteria 4334
29 Ga0070684_100014121 3300005535 Bacteria 6458
30 Ga0070684_100028313 3300005535 Bacteria 4739
31 Ga0070697_100147482 3300005536 Bacteria 1982
32 Ga0068853_100005359 3300005539 Bacteria 10046
33 Ga0068853_100068588 3300005539 Bacteria 3083
34 Ga0068853_100091017 3300005539 Bacteria 2682
35 Ga0070665_100098678 3300005548 Bacteria 2925
36 Ga0068855_100010147 3300005563 Bacteria 11351
37 Ga0068855_100021003 3300005563 Bacteria 7830
38 Ga0068857_100089229 3300005577 Bacteria 2758
39 Ga0068854_100189379 3300005578 Bacteria 1611
40 Ga0068856_100004479 3300005614 Bacteria 13897
41 Ga0068852_100027430 3300005616 Bacteria 4642
42 Ga0068860_100000317 3300005843 Bacteria 65673
43 Ga0081539_10000008 3300005985 Bacteria 525071
44 Ga0070717_10006275 3300006028 Bacteria 8732
45 Ga0075365_10077598 3300006038 Bacteria 2244
46 Ga0070716_100116924 3300006173 Bacteria 1662
47 Ga0070712_100177372 3300006175 Bacteria 1658
48 Ga0097621_100049964 3300006237 Bacteria 3400
49 Ga0099822_1002198 3300006943 Bacteria 24094
50 Ga0099794_10044662 3300007265 Bacteria 2118
51 Ga0099794_10097633 3300007265 Bacteria 1464
52 Ga0099795_10040951 3300007788 Bacteria 1648
53 Ga0105240_10077632 3300009093 Bacteria 4091
54 Ga0105240_10127591 3300009093 Bacteria 3055
55 Ga0105237_10011285 3300009545 Bacteria 9453
56 Ga0105238_10003129 3300009551 Bacteria 16514
57 Ga0105238_10119500 3300009551 Bacteria 2615
58 Ga0105238_10307098 3300009551 Bacteria 1571
59 Ga0105239_10008965 3300010375 Bacteria 11320
60 Ga0105239_10017421 3300010375 Bacteria 7945
61 Ga0105239_10144944 3300010375 Bacteria 2648
62 Ga0105239_10463553 3300010375 Bacteria 1438
63 Ga0105246_10149257 3300011119 Bacteria 1767
64 Ga0157373_10044092 3300013100 Bacteria 3184
65 Ga0157370_10067708 3300013104 Bacteria 3375
66 Ga0157369_10004501 3300013105 Bacteria 16421
67 Ga0157369_10165492 3300013105 Bacteria 2333
68 Ga0157378_10037649 3300013297 Bacteria 4286
69 Ga0157372_10283022 3300013307 Bacteria 1928
70 Ga0213876_10083569 3300021384 Bacteria 1689
71 Ga0209677_101241 3300025253 Bacteria 11522
72 Ga0209233_1002461 3300025261 Bacteria 6797
73 Ga0209233_1003268 3300025261 Bacteria 5748
74 Ga0209564_1002300 3300025295 Bacteria 15530
75 Ga0209758_1001983 3300025297 Bacteria 22130
76 Ga0207426_1000466 3300025302 Bacteria 62533
77 Ga0207426_1001739 3300025302 Bacteria 16577
78 Ga0207647_10095833 3300025904 Bacteria 1766
79 Ga0207707_10002025 3300025912 Bacteria 18400
80 Ga0207707_10016326 3300025912 Bacteria 6477
81 Ga0207707_10095312 3300025912 Bacteria 2601
82 Ga0207695_10084929 3300025913 Bacteria 3195
83 Ga0207695_10228309 3300025913 Bacteria 1767
84 Ga0207671_10025519 3300025914 Bacteria 4439
85 Ga0207663_10007113 3300025916 Bacteria 5780
86 Ga0207657_10009869 3300025919 Bacteria 9560
87 Ga0207652_10002138 3300025921 Bacteria 16939
88 Ga0207694_10101107 3300025924 Bacteria 2284
89 Ga0207665_10129883 3300025939 Bacteria 1787
90 Ga0207711_10204615 3300025941 Bacteria 1802
91 Ga0207661_10009379 3300025944 Bacteria 7016
92 Ga0207661_10017331 3300025944 Bacteria 5326
93 Ga0207667_10008468 3300025949 Bacteria 12214
94 Ga0207667_10045729 3300025949 Bacteria 4635
95 Ga0207703_10060914 3300026035 Bacteria 3088
96 Ga0207639_10145272 3300026041 Bacteria 1981
97 Ga0207678_10065922 3300026067 Bacteria 3109
98 Ga0207678_10161072 3300026067 Bacteria 1916
99 Ga0207702_10001399 3300026078 Bacteria 24061
100 Ga0207702_10153226 3300026078 Bacteria 2099
101 Ga0207641_10066110 3300026088 Bacteria 3095
102 Ga0207674_10010829 3300026116 Bacteria 10282
103 Ga0207698_10036991 3300026142 Bacteria 3590
104 Ga0207698_10084775 3300026142 Bacteria 2570
105 Ga0209589_1000018 3300027357 Bacteria 192614
106 Ga0209489_100026 3300027361 Bacteria 192614
107 Ga0209700_100035 3300027363 Bacteria 192614
108 Ga0209179_1001264 3300027512 Bacteria 3033
109 Ga0209588_1007968 3300027671 Bacteria 3132
110 Ga0268266_10098933 3300028379 Bacteria 2567
111 Ga0268264_10000035 3300028381 Bacteria 398196
112 Ga0265337_1002402 3300028556 Bacteria 8620
113 Ga0265326_10003557 3300028558 Bacteria 5095
114 Ga0265319_1002432 3300028563 Bacteria 10179
115 Ga0265334_10002131 3300028573 Bacteria 9344
116 Ga0265318_10003684 3300028577 Bacteria 7655
117 Ga0265323_10001287 3300028653 Bacteria 12515
118 Ga0265322_10005293 3300028654 Bacteria 3819
119 Ga0265336_10000128 3300028666 Bacteria 55655
120 Ga0265338_10000119 3300028800 Bacteria 146599
121 Ga0265324_10003823 3300029957 Bacteria 7036
122 Ga0265330_10021112 3300031235 Bacteria 2974
123 Ga0265330_10040036 3300031235 Bacteria 2081
124 Ga0265325_10006257 3300031241 Bacteria 7251
125 Ga0307509_10056729 3300031507 Bacteria 4156
126 Ga0307509_10149210 3300031507 Bacteria 2257
127 Ga0307509_10205331 3300031507 Bacteria 1801
128 Ga0307508_10017864 3300031616 Bacteria 6448
129 Ga0307508_10022171 3300031616 Bacteria 5772
130 Ga0265314_10011778 3300031711 Bacteria 7193
131 Ga0307507_10046738 3300033179 Bacteria 4239
132 Ga0307510_10143982 3300033180 Bacteria 2020
133 Ga0373934_0026418 3300035086 Bacteria 2252
134 Ga0373923_0007439 3300035111 Bacteria 3851
135 Ga0373954_0009425 3300035118 Bacteria 4294
136 Ga0373956_0088950 3300035119 Bacteria 1423
137 Ga0373957_0018778 3300035120 Bacteria 2425
138 Ga0373931_0007686 3300035691 Bacteria 5088
139 Ga0373927_0028407 3300035695 Bacteria 3648
140 Ga0373927_0043988 3300035695 Bacteria 2890
141 Ga0373927_0046255 3300035695 Bacteria 2816
142 Ga0373933_0002970 3300035724 Bacteria 9455
143 Ga0373933_0068497 3300035724 Bacteria 2155
144 Ga0373925_0106821 3300037068 Bacteria 2159
145 Ga0395900_0291393 3300037418 Bacteria 1621
146 Ga0395898_0002649 3300037466 Bacteria 20818
147 Ga0395898_0180452 3300037466 Bacteria 2018
148 Ga0395898_0225175 3300037466 Bacteria 1789
149 Ga0436365_0032113 3300039437 Bacteria 6905
150 Ga0436363_0481135 3300039450 Bacteria 4988
151 Ga0466971_0023411 3300044719 Bacteria 2753
152 Ga0466959_0030102 3300045049 Bacteria 4020
153 Ga0466967_0112736 3300045976 Bacteria 2500
154 Ga0466967_0151666 3300045976 Bacteria 2167
155 Ga0495592_0001015 3300046454 Bacteria 19460
156 Ga0495603_0011089 3300046455 Bacteria 5464
157 Ga0495603_0034338 3300046455 Bacteria 3049
158 Ga0495629_0005467 3300046459 Bacteria 9480
159 Ga0495653_0001070 3300046463 Bacteria 21097
160 Ga0495606_0092365 3300046507 Bacteria 1859
161 Ga0495628_0052343 3300046516 Bacteria 3225
162 Ga0495628_0055970 3300046516 Bacteria 3106
163 Ga0495648_0008834 3300046524 Bacteria 7884
164 Ga0495640_0022481 3300046533 Bacteria 4608
165 Ga0495645_0002189 3300046543 Bacteria 13283
166 Ga0495645_0005223 3300046543 Bacteria 8897
167 Ga0495635_0001667 3300046663 Bacteria 14944
168 Ga0495657_0004150 3300046675 Bacteria 11599
169 Ga0495599_0003132 3300046678 Bacteria 9642
170 Ga0495599_0059560 3300046678 Bacteria 2389
171 Ga0495623_0064928 3300046679 Bacteria 2283
172 Ga0495646_0097782 3300046680 Bacteria 1686
173 Ga0495613_0044365 3300046689 Bacteria 3290
174 Ga0495624_0096644 3300046690 Bacteria 1820
175 Ga0495600_0003617 3300046809 Bacteria 9112
176 Ga0495674_0047719 3300047319 Bacteria 3795
177 Ga0495674_0090398 3300047319 Bacteria 2616
178 Ga0495680_0207246 3300047322 Bacteria 1405
179 Ga0495684_0019374 3300047471 Bacteria 5238
180 Ga0495593_0000953 3300047673 Bacteria 16903
181 Ga0496100_0068920 3300048903 Bacteria 2354
182 Ga0496101_0032891 3300048904 Bacteria 3654
183 Ga0496102_0190590 3300048905 Bacteria 1932
184 Ga0496104_0013413 3300048907 Bacteria 7383
185 Ga0496104_0104556 3300048907 Bacteria 2713
186 Ga0496105_0006080 3300048908 Bacteria 9238
187 Ga0496106_0000116 3300048909 Bacteria 61237
188 Ga0496106_0002853 3300048909 Bacteria 12840
189 Ga0496106_0025828 3300048909 Bacteria 4370
190 Ga0496107_0016392 3300048910 Bacteria 5201
191 Ga0496107_0022024 3300048910 Bacteria 4501
192 Ga0496108_0000523 3300048911 Bacteria 30064
193 Ga0496108_0204419 3300048911 Bacteria 1714
194 Ga0496109_0001407 3300048912 Bacteria 19953
195 Ga0496109_0060991 3300048912 Bacteria 3447
196 Ga0496109_0195060 3300048912 Bacteria 1903
197 Ga0496110_0037615 3300048913 Bacteria 4207
198 Ga0496110_0096746 3300048913 Bacteria 2645
199 Ga0496111_0049473 3300048914 Bacteria 3031
200 Ga0496111_0086126 3300048914 Bacteria 2298
201 Ga0496112_0014449 3300048915 Bacteria 7327
202 Ga0496112_0086493 3300048915 Bacteria 3101
203 Ga0496114_0002764 3300048917 Bacteria 13432
204 Ga0496115_0099697 3300048918 Bacteria 2381
205 Ga0496115_0118607 3300048918 Bacteria 2176
206 Ga0496117_0025638 3300048920 Bacteria 4631
207 Ga0496118_0006091 3300048921 Bacteria 13407
208 Ga0496118_0040326 3300048921 Bacteria 3714
209 Ga0496119_0099025 3300048922 Bacteria 1641
210 Ga0496121_0018786 3300048924 Bacteria 6945
211 Ga0496124_0016465 3300048927 Bacteria 7024
212 Ga0496126_0006291 3300048929 Bacteria 13257
213 Ga0496126_0118311 3300048929 Bacteria 2300
214 Ga0496126_0252328 3300048929 Bacteria 1470
215 Ga0501031_0003360 3300049568 Bacteria 10278
216 Ga0501031_0005038 3300049568 Bacteria 8590
217 Ga0501032_0000046 3300049569 Bacteria 109405
218 Ga0501032_0005402 3300049569 Bacteria 9503
219 Ga0501033_0000514 3300049570 Bacteria 36256
220 Ga0501033_0012307 3300049570 Bacteria 6530
221 Ga0501034_0000061 3300049571 Bacteria 195178
222 Ga0501034_0002794 3300049571 Bacteria 20423
223 Ga0501036_0000027 3300049572 Bacteria 99799
224 Ga0501036_0000183 3300049572 Bacteria 41503
225 Ga0501037_0000104 3300049573 Bacteria 80204
226 Ga0501037_0000210 3300049573 Bacteria 51992
227 Ga0501038_0000340 3300049574 Bacteria 40348
228 Ga0501038_0000415 3300049574 Bacteria 36967
229 Ga0501039_0000121 3300049575 Bacteria 54152
230 Ga0501043_0000135 3300049579 Bacteria 68762
231 Ga0501043_0001636 3300049579 Bacteria 19475
232 Ga0501046_0001575 3300049580 Bacteria 21813
233 Ga0501047_0000101 3300049581 Bacteria 104950
234 Ga0501048_0000060 3300049582 Bacteria 54898
235 Ga0501048_0002792 3300049582 Bacteria 13334
236 Ga0501067_0002365 3300049583 Bacteria 10443
237 Ga0501067_0029676 3300049583 Bacteria 3031
238 Ga0501070_0000702 3300049586 Bacteria 30762
239 Ga0501070_0009854 3300049586 Bacteria 8078
240 Ga0501071_0008844 3300049587 Bacteria 6677
241 Ga0501072_0007262 3300049588 Bacteria 8406
242 Ga0501073_0000014 3300049589 Bacteria 159719
243 Ga0501073_0012830 3300049589 Bacteria 6107
244 Ga0501074_0028391 3300049590 Bacteria 4055
245 Ga0501080_0000121 3300049742 Bacteria 54804
246 Ga0501080_0003911 3300049742 Bacteria 13195
247 Ga0501083_0010027 3300049744 Bacteria 6684
248 Ga0501035_0000560 3300049822 Bacteria 41183
249 Ga0501035_0005432 3300049822 Bacteria 12049
250 Ga0501044_0000703 3300049823 Bacteria 40390
251 Ga0501045_0128763 3300049824 Bacteria 1881
252 Ga0500557_000039 3300053105 Bacteria 66862
253 Ga0500562_015385 3300053108 Bacteria 1961
254 Ga0500569_002549 3300053109 Bacteria 3607
255 Ga0500658_0076387 3300053134 Bacteria 1424
256 Ga0500559_0009317 3300053136 Bacteria 4254
257 Ga0500573_0028222 3300053140 Bacteria 3231
258 Ga0500603_001850 3300053150 Bacteria 4735
259 Ga0500616_0009727 3300053153 Bacteria 5814
260 Ga0500638_085466 3300053162 Bacteria 1493
261 Ga0500636_0000194 3300053177 Bacteria 32748
262 Ga0500636_0071232 3300053177 Bacteria 2016
263 Ga0500601_000497 3300053737 Bacteria 6065
264 Ga0501084_0001955 3300054114 Bacteria 16459
265 Ga0501082_0056821 3300060353 Bacteria 3371

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0151666 Ga0466967_0151666_1093_2154 340
2 3300031711 Ga0265314_10011778 Ga0265314_100117787 352
3 3300053109 Ga0500569_002549 Ga0500569_002549_2135_3322 361
4 iso_pu_bacteria 2513237102 2513705412 361
5 iso_pu_bacteria 2824617872 2824622774 361
6 iso_pu_bacteria 2824626560 2824632393 361
7 iso_pu_bacteria 2824635225 2824640412 361
8 iso_pu_bacteria 2824644064 2824647401 361
9 iso_pu_bacteria 2824714736 2824720379 361
10 iso_pu_bacteria 2824723954 2824728708 361
11 iso_pu_bacteria 2881364244 2881365732 361
12 3300005843 Ga0068860_100000317 Ga0068860_10000031768 362
13 3300028381 Ga0268264_10000035 Ga0268264_1000003540 362
14 iso_pu_bacteria 2508501042 2508697968 363
15 3300010375 Ga0105239_10008965 Ga0105239_1000896511 366
16 3300005578 Ga0068854_100189379 Ga0068854_1001893791 367
17 3300011119 Ga0105246_10149257 Ga0105246_101492572 367
18 3300026035 Ga0207703_10060914 Ga0207703_100609142 367
19 3300026088 Ga0207641_10066110 Ga0207641_100661105 367
20 3300028558 Ga0265326_10003557 Ga0265326_100035575 370
21 3300053162 Ga0500638_085466 Ga0500638_085466_29_1189 371
22 3300053177 Ga0500636_0000194 Ga0500636_0000194_28893_30053 371
23 3300031616 Ga0307508_10022171 Ga0307508_100221715 372
24 3300048929 Ga0496126_0006291 Ga0496126_0006291_6642_7805 372
25 3300048907 Ga0496104_0104556 Ga0496104_0104556_157_1320 373
26 iso_pu_bacteria 2507262055 2507510090 375
27 iso_pu_bacteria 2508501009 2508544092 375
28 iso_pu_bacteria 2515154112 2515629404 375
29 iso_pu_bacteria 2874590934 2874593292 375
30 iso_pu_bacteria 2874645413 2874652933 375
31 iso_pu_bacteria 2876771140 2876773332 375
32 iso_pu_bacteria 2876818435 2876821285 375
33 iso_pu_bacteria 2879074833 2879077248 375
34 iso_pu_bacteria 2879127579 2879130195 375
35 iso_pu_bacteria 2879142872 2879146710 375
36 iso_pu_bacteria 2935608549 2935611005 375
37 iso_pu_bacteria 2935648319 2935648436 375
38 iso_pu_bacteria 2935656913 2935657576 375
39 iso_pu_bacteria 2935769743 2935771419 375
40 iso_pu_bacteria 2935777560 2935779108 375
41 iso_pu_bacteria 2935785616 2935788312 375
42 iso_pu_bacteria 2935793552 2935796923 375
43 iso_pu_bacteria 2935819856 2935820490 375
44 iso_pu_bacteria 2935847175 2935849501 375
45 iso_pu_bacteria 2935908558 2935911725 375
46 iso_pu_bacteria 2935926038 2935928754 375
47 iso_pu_bacteria 2935934488 2935938399 375
48 iso_pu_bacteria 2935942939 2935945709 375
49 iso_pu_bacteria 2935951376 2935954684 375
50 iso_pu_bacteria 2935967501 2935970571 375
51 iso_pu_bacteria 2935975950 2935979193 375
52 iso_pu_bacteria 2935984226 2935987795 375
53 iso_pu_bacteria 2936011229 2936011346 375
54 iso_pu_bacteria 2936019824 2936019941 375
55 iso_pu_bacteria 2936028420 2936028537 375
56 iso_pu_bacteria 2936046547 2936046664 375
57 iso_pu_bacteria 2936055302 2936062357 375
58 iso_pu_bacteria 8016603502 8016612299 375
59 iso_pu_bacteria 8016613128 8016621510 375
60 iso_pu_bacteria 8016622563 8016628451 375
61 iso_pu_bacteria 8016630954 8016632650 375
62 iso_pu_bacteria 8019547302 8019555534 375
63 iso_pu_bacteria 8019619141 8019626446 375
64 iso_pu_bacteria 8019629233 8019636045 375
65 iso_pu_bacteria 8019638758 8019643619 375
66 iso_pu_bacteria 8019668869 8019673442 375
67 iso_pu_bacteria 8019678201 8019682687 375
68 iso_pu_bacteria 8019687851 8019688370 375
69 iso_pu_bacteria 2513237096 2513660037 376
70 iso_pu_bacteria 2513237098 2513676476 376
71 iso_pu_bacteria 2513237104 2513720618 376
72 iso_pu_bacteria 2513237137 2513858214 376
73 iso_pu_bacteria 2513237141 2513892014 376
74 iso_pu_bacteria 2513237145 2513922153 376
75 iso_pu_bacteria 2517572143 2517893897 376
76 iso_pu_bacteria 2524023210 2524467051 376
77 iso_pu_bacteria 2667528175 2671122889 376
78 iso_pu_bacteria 2728368998 2728748022 376
79 iso_pu_bacteria 2824704595 2824708363 376
80 iso_pu_bacteria 2824753945 2824758928 376
81 iso_pu_bacteria 2824763712 2824766104 376
82 iso_pu_bacteria 2874628541 2874636107 376
83 iso_pu_bacteria 2885383462 2885390043 376
84 iso_pu_bacteria 2903768456 2903771721 376
85 iso_pu_bacteria 2904690495 2904693455 376
86 iso_pu_bacteria 2904711408 2904718544 376
87 iso_pu_bacteria 2906635258 2906635941 376
88 iso_pu_bacteria 2906660503 2906663961 376
89 iso_pu_bacteria 2908756301 2908761780 376
90 iso_pu_bacteria 2932784394 2932787028 376
91 iso_pu_bacteria 2932828146 2932832382 376
92 iso_pu_bacteria 2935630451 2935634519 376
93 iso_pu_bacteria 2935959822 2935963284 376
94 iso_pu_bacteria 2941507105 2941509005 376
95 iso_pu_bacteria 2941515067 2941516834 376
96 iso_pu_bacteria 2941523033 2941525071 376
97 iso_pu_bacteria 3005474847 3005478670 376
98 iso_pu_bacteria 3005710791 3005713434 376
99 iso_pu_bacteria 8016511872 8016515180 376
100 iso_pu_bacteria 8017057580 8017061274 376
101 iso_pu_bacteria 8056681323 8056685060 376
102 iso_pu_bacteria 8056689827 8056691854 376
103 3300053737 Ga0500601_000497 Ga0500601_000497_2809_3987 377
104 3300028556 Ga0265337_1002402 Ga0265337_10024027 378
105 3300028563 Ga0265319_1002432 Ga0265319_10024325 378
106 3300028573 Ga0265334_10002131 Ga0265334_100021318 378
107 3300028577 Ga0265318_10003684 Ga0265318_100036847 378
108 3300028653 Ga0265323_10001287 Ga0265323_1000128712 378
109 3300028654 Ga0265322_10005293 Ga0265322_100052931 378
110 3300028666 Ga0265336_10000128 Ga0265336_1000012834 378
111 3300028800 Ga0265338_10000119 Ga0265338_1000011934 378
112 3300029957 Ga0265324_10003823 Ga0265324_100038235 378
113 3300048918 Ga0496115_0099697 Ga0496115_0099697_660_1838 378
114 3300003215 JGI25153J46596_10001533 JGI25153J46596_1000153315 379
115 3300003354 JGI25160J50197_1001294 JGI25160J50197_100129414 379
116 3300005290 Ga0065712_10110763 Ga0065712_101107632 379
117 3300005327 Ga0070658_10225725 Ga0070658_102257251 379
118 3300005336 Ga0070680_100111539 Ga0070680_1001115392 379
119 3300005436 Ga0070713_100185101 Ga0070713_1001851012 379
120 3300005458 Ga0070681_10028949 Ga0070681_100289492 379
121 3300005563 Ga0068855_100021003 Ga0068855_1000210035 379
122 3300005614 Ga0068856_100004479 Ga0068856_1000044793 379
123 3300006038 Ga0075365_10077598 Ga0075365_100775983 379
124 3300006237 Ga0097621_100049964 Ga0097621_1000499642 379
125 3300009093 Ga0105240_10077632 Ga0105240_100776322 379
126 3300010375 Ga0105239_10017421 Ga0105239_100174212 379
127 3300010375 Ga0105239_10463553 Ga0105239_104635531 379
128 3300013104 Ga0157370_10067708 Ga0157370_100677083 379
129 3300013297 Ga0157378_10037649 Ga0157378_100376494 379
130 3300025295 Ga0209564_1002300 Ga0209564_10023007 379
131 3300025297 Ga0209758_1001983 Ga0209758_100198320 379
132 3300025302 Ga0207426_1000466 Ga0207426_100046660 379
133 3300025912 Ga0207707_10095312 Ga0207707_100953124 379
134 3300025941 Ga0207711_10204615 Ga0207711_102046152 379
135 3300025949 Ga0207667_10045729 Ga0207667_100457295 379
136 3300026067 Ga0207678_10065922 Ga0207678_100659222 379
137 3300026067 Ga0207678_10161072 Ga0207678_101610722 379
138 3300026078 Ga0207702_10001399 Ga0207702_1000139912 379
139 3300026142 Ga0207698_10084775 Ga0207698_100847751 379
140 3300031616 Ga0307508_10017864 Ga0307508_100178642 379
141 3300035691 Ga0373931_0007686 Ga0373931_0007686_3465_4685 379
142 3300037068 Ga0373925_0106821 Ga0373925_0106821_199_1419 379
143 3300048904 Ga0496101_0032891 Ga0496101_0032891_2049_3230 379
144 3300048905 Ga0496102_0190590 Ga0496102_0190590_601_1839 379
145 3300048907 Ga0496104_0013413 Ga0496104_0013413_207_1427 379
146 3300048908 Ga0496105_0006080 Ga0496105_0006080_1384_2604 379
147 3300048909 Ga0496106_0000116 Ga0496106_0000116_3591_4772 379
148 3300048909 Ga0496106_0025828 Ga0496106_0025828_2229_3449 379
149 3300048910 Ga0496107_0016392 Ga0496107_0016392_3106_4287 379
150 3300048910 Ga0496107_0022024 Ga0496107_0022024_2061_3281 379
151 3300048911 Ga0496108_0000523 Ga0496108_0000523_6988_8169 379
152 3300048912 Ga0496109_0001407 Ga0496109_0001407_11713_12894 379
153 3300048912 Ga0496109_0195060 Ga0496109_0195060_563_1783 379
154 3300048913 Ga0496110_0096746 Ga0496110_0096746_31_1251 379
155 3300048914 Ga0496111_0086126 Ga0496111_0086126_350_1570 379
156 3300048915 Ga0496112_0014449 Ga0496112_0014449_2447_3628 379
157 3300048915 Ga0496112_0086493 Ga0496112_0086493_459_1679 379
158 3300048917 Ga0496114_0002764 Ga0496114_0002764_4679_5899 379
159 3300048918 Ga0496115_0118607 Ga0496115_0118607_286_1506 379
160 3300048929 Ga0496126_0252328 Ga0496126_0252328_32_1276 379
161 3300053105 Ga0500557_000039 Ga0500557_000039_51604_52788 379
162 3300053177 Ga0500636_0071232 Ga0500636_0071232_408_1589 379
163 3300003203 JGI25406J46586_10000141 JGI25406J46586_1000014118 380
164 3300004625 Ga0055543_1003754 Ga0055543_10037543 380
165 3300005262 Ga0065165_1002974 Ga0065165_10029742 380
166 3300005262 Ga0065165_1003005 Ga0065165_10030052 380
167 3300005327 Ga0070658_10107279 Ga0070658_101072793 380
168 3300005329 Ga0070683_100054825 Ga0070683_1000548253 380
169 3300005329 Ga0070683_100085836 Ga0070683_1000858362 380
170 3300005329 Ga0070683_100148009 Ga0070683_1001480093 380
171 3300005336 Ga0070680_100003306 Ga0070680_1000033062 380
172 3300005336 Ga0070680_100075298 Ga0070680_1000752984 380
173 3300005339 Ga0070660_100053294 Ga0070660_1000532942 380
174 3300005341 Ga0070691_10022461 Ga0070691_100224614 380
175 3300005366 Ga0070659_100066547 Ga0070659_1000665471 380
176 3300005437 Ga0070710_10081825 Ga0070710_100818252 380
177 3300005439 Ga0070711_100047871 Ga0070711_1000478712 380
178 3300005458 Ga0070681_10052193 Ga0070681_100521933 380
179 3300005458 Ga0070681_10064419 Ga0070681_100644192 380
180 3300005458 Ga0070681_10087176 Ga0070681_100871761 380
181 3300005530 Ga0070679_100027061 Ga0070679_1000270615 380
182 3300005530 Ga0070679_100044585 Ga0070679_1000445856 380
183 3300005530 Ga0070679_100046319 Ga0070679_1000463195 380
184 3300005535 Ga0070684_100014121 Ga0070684_1000141218 380
185 3300005535 Ga0070684_100028313 Ga0070684_1000283132 380
186 3300005536 Ga0070697_100147482 Ga0070697_1001474821 380
187 3300005539 Ga0068853_100005359 Ga0068853_1000053597 380
188 3300005539 Ga0068853_100068588 Ga0068853_1000685884 380
189 3300005539 Ga0068853_100091017 Ga0068853_1000910173 380
190 3300005548 Ga0070665_100098678 Ga0070665_1000986783 380
191 3300005563 Ga0068855_100010147 Ga0068855_1000101473 380
192 3300005577 Ga0068857_100089229 Ga0068857_1000892292 380
193 3300005616 Ga0068852_100027430 Ga0068852_1000274303 380
194 3300005985 Ga0081539_10000008 Ga0081539_10000008471 380
195 3300006028 Ga0070717_10006275 Ga0070717_100062758 380
196 3300006173 Ga0070716_100116924 Ga0070716_1001169242 380
197 3300006175 Ga0070712_100177372 Ga0070712_1001773722 380
198 3300006943 Ga0099822_1002198 Ga0099822_100219824 380
199 3300007265 Ga0099794_10044662 Ga0099794_100446622 380
200 3300007265 Ga0099794_10097633 Ga0099794_100976332 380
201 3300007788 Ga0099795_10040951 Ga0099795_100409511 380
202 3300009093 Ga0105240_10127591 Ga0105240_101275911 380
203 3300009545 Ga0105237_10011285 Ga0105237_100112853 380
204 3300009551 Ga0105238_10003129 Ga0105238_1000312915 380
205 3300009551 Ga0105238_10119500 Ga0105238_101195002 380
206 3300009551 Ga0105238_10307098 Ga0105238_103070982 380
207 3300010375 Ga0105239_10144944 Ga0105239_101449442 380
208 3300013100 Ga0157373_10044092 Ga0157373_100440922 380
209 3300013105 Ga0157369_10004501 Ga0157369_100045016 380
210 3300013105 Ga0157369_10165492 Ga0157369_101654922 380
211 3300013307 Ga0157372_10283022 Ga0157372_102830222 380
212 3300021384 Ga0213876_10083569 Ga0213876_100835692 380
213 3300025253 Ga0209677_101241 Ga0209677_10124114 380
214 3300025261 Ga0209233_1002461 Ga0209233_10024615 380
215 3300025261 Ga0209233_1003268 Ga0209233_10032682 380
216 3300025302 Ga0207426_1001739 Ga0207426_10017396 380
217 3300025904 Ga0207647_10095833 Ga0207647_100958331 380
218 3300025912 Ga0207707_10002025 Ga0207707_1000202515 380
219 3300025912 Ga0207707_10016326 Ga0207707_100163263 380
220 3300025913 Ga0207695_10084929 Ga0207695_100849291 380
221 3300025913 Ga0207695_10228309 Ga0207695_102283091 380
222 3300025914 Ga0207671_10025519 Ga0207671_100255195 380
223 3300025916 Ga0207663_10007113 Ga0207663_100071137 380
224 3300025919 Ga0207657_10009869 Ga0207657_1000986911 380
225 3300025921 Ga0207652_10002138 Ga0207652_1000213818 380
226 3300025924 Ga0207694_10101107 Ga0207694_101011071 380
227 3300025939 Ga0207665_10129883 Ga0207665_101298831 380
228 3300025944 Ga0207661_10009379 Ga0207661_100093795 380
229 3300025944 Ga0207661_10017331 Ga0207661_100173312 380
230 3300025949 Ga0207667_10008468 Ga0207667_100084683 380
231 3300026041 Ga0207639_10145272 Ga0207639_101452722 380
232 3300026078 Ga0207702_10153226 Ga0207702_101532262 380
233 3300026116 Ga0207674_10010829 Ga0207674_100108292 380
234 3300026142 Ga0207698_10036991 Ga0207698_100369915 380
235 3300027357 Ga0209589_1000018 Ga0209589_100001874 380
236 3300027361 Ga0209489_100026 Ga0209489_10002674 380
237 3300027363 Ga0209700_100035 Ga0209700_10003574 380
238 3300027512 Ga0209179_1001264 Ga0209179_10012644 380
239 3300027671 Ga0209588_1007968 Ga0209588_10079683 380
240 3300028379 Ga0268266_10098933 Ga0268266_100989333 380
241 3300031235 Ga0265330_10021112 Ga0265330_100211122 380
242 3300031235 Ga0265330_10040036 Ga0265330_100400362 380
243 3300031241 Ga0265325_10006257 Ga0265325_100062578 380
244 3300031507 Ga0307509_10056729 Ga0307509_100567296 380
245 3300031507 Ga0307509_10149210 Ga0307509_101492102 380
246 3300031507 Ga0307509_10205331 Ga0307509_102053312 380
247 3300033179 Ga0307507_10046738 Ga0307507_100467382 380
248 3300033180 Ga0307510_10143982 Ga0307510_101439823 380
249 3300035086 Ga0373934_0026418 Ga0373934_0026418_124_1308 380
250 3300035111 Ga0373923_0007439 Ga0373923_0007439_1740_2924 380
251 3300035118 Ga0373954_0009425 Ga0373954_0009425_2832_4016 380
252 3300035119 Ga0373956_0088950 Ga0373956_0088950_191_1375 380
253 3300035120 Ga0373957_0018778 Ga0373957_0018778_1140_2324 380
254 3300035695 Ga0373927_0028407 Ga0373927_0028407_1905_3089 380
255 3300035695 Ga0373927_0043988 Ga0373927_0043988_16_1200 380
256 3300035695 Ga0373927_0046255 Ga0373927_0046255_1255_2538 380
257 3300035724 Ga0373933_0002970 Ga0373933_0002970_3938_5122 380
258 3300035724 Ga0373933_0068497 Ga0373933_0068497_702_1886 380
259 3300037418 Ga0395900_0291393 Ga0395900_0291393_387_1574 380
260 3300037466 Ga0395898_0002649 Ga0395898_0002649_10092_11372 380
261 3300037466 Ga0395898_0180452 Ga0395898_0180452_36_1220 380
262 3300037466 Ga0395898_0225175 Ga0395898_0225175_482_1666 380
263 3300039437 Ga0436365_0032113 Ga0436365_0032113_417_1601 380
264 3300039450 Ga0436363_0481135 Ga0436363_0481135_2494_3678 380
265 3300044719 Ga0466971_0023411 Ga0466971_0023411_354_1538 380
266 3300045049 Ga0466959_0030102 Ga0466959_0030102_311_1495 380
267 3300045976 Ga0466967_0112736 Ga0466967_0112736_316_1500 380
268 3300046454 Ga0495592_0001015 Ga0495592_0001015_830_2014 380
269 3300046455 Ga0495603_0011089 Ga0495603_0011089_142_1326 380
270 3300046455 Ga0495603_0034338 Ga0495603_0034338_1642_2826 380
271 3300046459 Ga0495629_0005467 Ga0495629_0005467_5833_7017 380
272 3300046463 Ga0495653_0001070 Ga0495653_0001070_19644_20828 380
273 3300046507 Ga0495606_0092365 Ga0495606_0092365_13_1251 380
274 3300046516 Ga0495628_0052343 Ga0495628_0052343_179_1363 380
275 3300046516 Ga0495628_0055970 Ga0495628_0055970_1134_2321 380
276 3300046524 Ga0495648_0008834 Ga0495648_0008834_1690_3009 380
277 3300046533 Ga0495640_0022481 Ga0495640_0022481_664_1848 380
278 3300046543 Ga0495645_0002189 Ga0495645_0002189_49_1248 380
279 3300046543 Ga0495645_0005223 Ga0495645_0005223_4920_6104 380
280 3300046663 Ga0495635_0001667 Ga0495635_0001667_2766_3950 380
281 3300046675 Ga0495657_0004150 Ga0495657_0004150_2354_3541 380
282 3300046678 Ga0495599_0003132 Ga0495599_0003132_2649_3833 380
283 3300046678 Ga0495599_0059560 Ga0495599_0059560_1070_2257 380
284 3300046679 Ga0495623_0064928 Ga0495623_0064928_827_2014 380
285 3300046680 Ga0495646_0097782 Ga0495646_0097782_488_1675 380
286 3300046689 Ga0495613_0044365 Ga0495613_0044365_1463_2647 380
287 3300046690 Ga0495624_0096644 Ga0495624_0096644_367_1551 380
288 3300046809 Ga0495600_0003617 Ga0495600_0003617_6964_8148 380
289 3300047319 Ga0495674_0047719 Ga0495674_0047719_921_2108 380
290 3300047319 Ga0495674_0090398 Ga0495674_0090398_1323_2507 380
291 3300047322 Ga0495680_0207246 Ga0495680_0207246_45_1229 380
292 3300047471 Ga0495684_0019374 Ga0495684_0019374_1220_2404 380
293 3300047673 Ga0495593_0000953 Ga0495593_0000953_14823_16007 380
294 3300048903 Ga0496100_0068920 Ga0496100_0068920_785_1969 380
295 3300048909 Ga0496106_0002853 Ga0496106_0002853_3297_4481 380
296 3300048911 Ga0496108_0204419 Ga0496108_0204419_358_1542 380
297 3300048912 Ga0496109_0060991 Ga0496109_0060991_459_1643 380
298 3300048913 Ga0496110_0037615 Ga0496110_0037615_2390_3574 380
299 3300048914 Ga0496111_0049473 Ga0496111_0049473_794_1978 380
300 3300048920 Ga0496117_0025638 Ga0496117_0025638_1263_2447 380
301 3300048921 Ga0496118_0006091 Ga0496118_0006091_9735_10919 380
302 3300048921 Ga0496118_0040326 Ga0496118_0040326_1569_2756 380
303 3300048922 Ga0496119_0099025 Ga0496119_0099025_54_1241 380
304 3300048924 Ga0496121_0018786 Ga0496121_0018786_2264_3448 380
305 3300048927 Ga0496124_0016465 Ga0496124_0016465_4213_5397 380
306 3300048929 Ga0496126_0118311 Ga0496126_0118311_1061_2245 380
307 3300049568 Ga0501031_0003360 Ga0501031_0003360_8597_9781 380
308 3300049568 Ga0501031_0005038 Ga0501031_0005038_171_1355 380
309 3300049569 Ga0501032_0000046 Ga0501032_0000046_79443_80627 380
310 3300049569 Ga0501032_0005402 Ga0501032_0005402_157_1341 380
311 3300049570 Ga0501033_0000514 Ga0501033_0000514_27689_28873 380
312 3300049570 Ga0501033_0012307 Ga0501033_0012307_4629_5813 380
313 3300049571 Ga0501034_0000061 Ga0501034_0000061_173_1357 380
314 3300049571 Ga0501034_0002794 Ga0501034_0002794_2806_3990 380
315 3300049572 Ga0501036_0000027 Ga0501036_0000027_73385_74569 380
316 3300049572 Ga0501036_0000183 Ga0501036_0000183_12659_13843 380
317 3300049573 Ga0501037_0000104 Ga0501037_0000104_22830_24014 380
318 3300049573 Ga0501037_0000210 Ga0501037_0000210_8620_9804 380
319 3300049574 Ga0501038_0000340 Ga0501038_0000340_3818_5002 380
320 3300049574 Ga0501038_0000415 Ga0501038_0000415_662_1846 380
321 3300049575 Ga0501039_0000121 Ga0501039_0000121_34688_35872 380
322 3300049579 Ga0501043_0000135 Ga0501043_0000135_9500_10684 380
323 3300049579 Ga0501043_0001636 Ga0501043_0001636_103_1287 380
324 3300049580 Ga0501046_0001575 Ga0501046_0001575_118_1302 380
325 3300049581 Ga0501047_0000101 Ga0501047_0000101_27574_28758 380
326 3300049582 Ga0501048_0000060 Ga0501048_0000060_12791_13975 380
327 3300049582 Ga0501048_0002792 Ga0501048_0002792_8301_9485 380
328 3300049583 Ga0501067_0002365 Ga0501067_0002365_4603_5787 380
329 3300049583 Ga0501067_0029676 Ga0501067_0029676_1711_2895 380
330 3300049586 Ga0501070_0000702 Ga0501070_0000702_12676_13860 380
331 3300049586 Ga0501070_0009854 Ga0501070_0009854_6722_7906 380
332 3300049587 Ga0501071_0008844 Ga0501071_0008844_1675_2859 380
333 3300049588 Ga0501072_0007262 Ga0501072_0007262_7142_8326 380
334 3300049589 Ga0501073_0000014 Ga0501073_0000014_44197_45381 380
335 3300049589 Ga0501073_0012830 Ga0501073_0012830_2126_3310 380
336 3300049590 Ga0501074_0028391 Ga0501074_0028391_404_1588 380
337 3300049742 Ga0501080_0000121 Ga0501080_0000121_16169_17353 380
338 3300049742 Ga0501080_0003911 Ga0501080_0003911_4992_6176 380
339 3300049744 Ga0501083_0010027 Ga0501083_0010027_2547_3731 380
340 3300049822 Ga0501035_0000560 Ga0501035_0000560_12325_13509 380
341 3300049822 Ga0501035_0005432 Ga0501035_0005432_5594_6778 380
342 3300049823 Ga0501044_0000703 Ga0501044_0000703_20512_21696 380
343 3300049824 Ga0501045_0128763 Ga0501045_0128763_587_1771 380
344 3300053108 Ga0500562_015385 Ga0500562_015385_689_1876 380
345 3300053134 Ga0500658_0076387 Ga0500658_0076387_88_1275 380
346 3300053136 Ga0500559_0009317 Ga0500559_0009317_2336_3523 380
347 3300053140 Ga0500573_0028222 Ga0500573_0028222_1949_3133 380
348 3300053150 Ga0500603_001850 Ga0500603_001850_2244_3428 380
349 3300053153 Ga0500616_0009727 Ga0500616_0009727_1277_2464 380
350 3300054114 Ga0501084_0001955 Ga0501084_0001955_2503_3687 380
351 3300060353 Ga0501082_0056821 Ga0501082_0056821_2053_3237 380

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01757

Acyl_transf_3

Acyltransferase family

1

341

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z16-assembly1.cif.gz_b structure of the mrp antiporter complex 0.2756 101 241
6z16-assembly1.cif.gz_b structure of the mrp antiporter complex 0.2513 101 241
8jzr-assembly1.cif.gz_B outward_facing slc15a4 monomer 0.2387 19 379
8c03-assembly1.cif.gz_A structure of slc40/ferroportin in complex with vamifeport and synthetic nanobody sy12 in outward-facing conformation 0.2383 22 378
2z0o-assembly1.cif.gz_A-2 crystal structure of appl1-bar-ph domain 0.238 154 369
ID Description Score Start End Superfamily
af_Q8IIU4_1_132_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3874 190 319 1.20.140.150
af_Q8IIU4_1_132_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3568 190 319 1.20.140.150
af_A0A0R4IDZ8_482_655_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.3451 160 314 1.20.1420.10
af_A0A0R0KVV6_29_221_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3353 254 377 1.20.1250.20
af_Q57985_1_147_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3283 170 314 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A1H1TL33-F1-model_v4 Acyltransferase family protein 0.9066 20 380 GO:0016020
GO:0016747
AF-A0A4Q5PFA7-F1-model_v4 Acyltransferase 0.9061 20 380 GO:0016020
GO:0016747
AF-A0A0Q6ZCC3-F1-model_v4 Acyltransferase 0.9054 17 380 GO:0016020
GO:0016747
AF-A0A431P542-F1-model_v4 deleted 0.903 20 237
AF-I2QS17-F1-model_v4 Acyltransferase family protein 0.8862 8 380 GO:0016020
GO:0016747

Feature Viewer

pLDDT pTM Quality
81.48 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map