F418754

General Info

Members Datasets Scaffolds Average Seq Length
351 208 702 223

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0001288|Ga0495629_0001288_15998_16735
Length 245
Sequence MLADEKLVSPAAQFGLDSRIGGVNGPRAASAPELKAQIEAERAGRPFLVFRDGADEQRIVTIAEGAAELWVGRGESADVRLGWDEEVSGLHAQIAVVRGEATLVDDGLSRNGSYVNEVRVHGRRHLRDGDAIRFGRTTVVYRRPGDTAPEATVVATDAPAAASVSPAQRKVLVALCRPYKDGGSFATPATNQQIGAELHLSVDAVKTHMRALFEKLGVGDLPQNQTRVALGERALQMGVVKSHEL

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
123 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
124 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
125 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
126 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
127 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
128 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
129 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
130 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
131 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
132 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
199 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.99
Nodule 0
Rhizoplane 12.82
Rhizosphere 82.62
Stem 0
Stem Tuber 0
Unclassified 6.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0001288 3300046459 Bacteria 19721
2 Ga0070658_10064065 3300005327 Archaea 2998
3 Ga0070658_10076887 3300005327 Bacteria 2738
4 Ga0070683_100335996 3300005329 Bacteria 1438
5 Ga0068869_100280796 3300005334 Bacteria 1339
6 Ga0068869_100330035 3300005334 Bacteria 1239
7 Ga0070682_100000100 3300005337 Bacteria 77054
8 Ga0068868_100005092 3300005338 Bacteria 9224
9 Ga0068868_100079803 3300005338 Bacteria 2622
10 Ga0070660_100000656 3300005339 Bacteria 22861
11 Ga0070689_100435667 3300005340 Bacteria 1113
12 Ga0070689_100676979 3300005340 Bacteria 899
13 Ga0070691_10187728 3300005341 Bacteria 1079
14 Ga0070687_100023376 3300005343 Bacteria 2937
15 Ga0070687_100025361 3300005343 Bacteria 2844
16 Ga0070661_100000031 3300005344 Bacteria 113816
17 Ga0070661_100082241 3300005344 Bacteria 2378
18 Ga0070661_100401890 3300005344 Bacteria 1083
19 Ga0070692_10091107 3300005345 Bacteria 1657
20 Ga0070668_100405632 3300005347 Bacteria 1164
21 Ga0070669_100047762 3300005353 Bacteria 3123
22 Ga0070675_100010455 3300005354 Bacteria 7250
23 Ga0070674_100030008 3300005356 Bacteria 3590
24 Ga0070674_100239351 3300005356 Bacteria 1420
25 Ga0070673_100317911 3300005364 Bacteria 1374
26 Ga0070688_100000064 3300005365 Bacteria 52662
27 Ga0070659_100005040 3300005366 Bacteria 9469
28 Ga0070659_101002817 3300005366 Bacteria 733
29 Ga0070710_10152510 3300005437 Bacteria 1426
30 Ga0070701_10063178 3300005438 Bacteria 1958
31 Ga0070711_100011048 3300005439 Bacteria 5601
32 Ga0070700_100072410 3300005441 Bacteria 2203
33 Ga0070700_100137244 3300005441 Bacteria 1658
34 Ga0070700_100230170 3300005441 Bacteria 1319
35 Ga0070700_100506240 3300005441 Bacteria 930
36 Ga0070694_100400546 3300005444 Bacteria 1074
37 Ga0070663_100001885 3300005455 Bacteria 11713
38 Ga0070678_100048315 3300005456 Bacteria 3063
39 Ga0070678_100393669 3300005456 Bacteria 1202
40 Ga0070662_100127825 3300005457 Bacteria 1955
41 Ga0068867_100014807 3300005459 Bacteria 5530
42 Ga0070685_10000154 3300005466 Bacteria 45505
43 Ga0070685_10048487 3300005466 Bacteria 2446
44 Ga0070685_10197719 3300005466 Bacteria 1305
45 Ga0070707_100369080 3300005468 Bacteria 1394
46 Ga0070707_100374203 3300005468 Bacteria 1384
47 Ga0070698_100908247 3300005471 Bacteria 826
48 Ga0070679_100175711 3300005530 Bacteria 2114
49 Ga0070684_100021366 3300005535 Bacteria 5384
50 Ga0070684_100440867 3300005535 Bacteria 1203
51 Ga0068853_100015153 3300005539 Bacteria 6338
52 Ga0068853_100260461 3300005539 Bacteria 1594
53 Ga0070672_100000023 3300005543 Bacteria 68631
54 Ga0070672_100003065 3300005543 Bacteria 10774
55 Ga0070686_100032308 3300005544 Bacteria 3208
56 Ga0070665_100210998 3300005548 Bacteria 1943
57 Ga0070704_100482912 3300005549 Unclassified 1072
58 Ga0070664_100354215 3300005564 Bacteria 1336
59 Ga0068854_100000107 3300005578 Bacteria 57836
60 Ga0068854_100002182 3300005578 Bacteria 12036
61 Ga0068854_100025912 3300005578 Bacteria 4025
62 Ga0068856_100364854 3300005614 Bacteria 1463
63 Ga0068856_100602556 3300005614 Unclassified 1119
64 Ga0068856_100794527 3300005614 Unclassified 966
65 Ga0070702_100008335 3300005615 Bacteria 5015
66 Ga0068852_100055949 3300005616 Bacteria 3407
67 Ga0068859_100223772 3300005617 Bacteria 1970
68 Ga0068864_100066795 3300005618 Bacteria 3122
69 Ga0068864_100233487 3300005618 Bacteria 1702
70 Ga0068864_101056580 3300005618 Bacteria 807
71 Ga0068866_10022083 3300005718 Bacteria 2941
72 Ga0068861_100049005 3300005719 Bacteria 3196
73 Ga0068861_100272810 3300005719 Bacteria 1453
74 Ga0068851_10000287 3300005834 Bacteria 23180
75 Ga0068870_10407552 3300005840 Bacteria 886
76 Ga0068858_100063007 3300005842 Bacteria 3430
77 Ga0068858_100363816 3300005842 Bacteria 1387
78 Ga0068860_100463641 3300005843 Unclassified 1261
79 Ga0068860_100616055 3300005843 Bacteria 1092
80 Ga0068862_100023207 3300005844 Bacteria 5196
81 Ga0081455_10049976 3300005937 Bacteria 3600
82 Ga0081455_10076420 3300005937 Bacteria 2759
83 Ga0081455_10284158 3300005937 Unclassified 1194
84 Ga0081538_10020878 3300005981 Bacteria 4804
85 Ga0081540_1000735 3300005983 Bacteria 30170
86 Ga0081539_10003289 3300005985 Bacteria 20230
87 Ga0081539_10017154 3300005985 Bacteria 5103
88 Ga0075365_10002695 3300006038 Bacteria 8843
89 Ga0075365_10124354 3300006038 Bacteria 1781
90 Ga0075363_100021935 3300006048 Bacteria 3224
91 Ga0075363_100028188 3300006048 Bacteria 2886
92 Ga0075364_10038282 3300006051 Bacteria 3107
93 Ga0075364_10078136 3300006051 Bacteria 2185
94 Ga0070712_100087763 3300006175 Bacteria 2270
95 Ga0070712_100514006 3300006175 Bacteria 1005
96 Ga0075428_100062614 3300006844 Bacteria 4073
97 Ga0075428_101211216 3300006844 Bacteria 796
98 Ga0075430_100331592 3300006846 Bacteria 1257
99 Ga0068865_100030533 3300006881 Bacteria 3586
100 Ga0068865_100039812 3300006881 Bacteria 3190
101 Ga0068865_100149821 3300006881 Bacteria 1769
102 Ga0097620_100223775 3300006931 Bacteria 1970
103 Ga0111539_10061015 3300009094 Bacteria 4468
104 Ga0111539_10090413 3300009094 Bacteria 3598
105 Ga0111539_10562252 3300009094 Bacteria 1328
106 Ga0111539_10748908 3300009094 Bacteria 1137
107 Ga0105245_10008945 3300009098 Bacteria 8732
108 Ga0105245_10051216 3300009098 Bacteria 3702
109 Ga0105245_10117062 3300009098 Bacteria 2485
110 Ga0105245_10720448 3300009098 Bacteria 1032
111 Ga0105247_10000407 3300009101 Bacteria 36488
112 Ga0105247_10119100 3300009101 Bacteria 1708
113 Ga0105243_10009463 3300009148 Bacteria 7422
114 Ga0105243_10271933 3300009148 Bacteria 1522
115 Ga0105242_10000245 3300009176 Bacteria 42792
116 Ga0105242_10054859 3300009176 Bacteria 3259
117 Ga0105242_10320497 3300009176 Bacteria 1421
118 Ga0105248_10083374 3300009177 Bacteria 3596
119 Ga0105237_10458230 3300009545 Bacteria 1281
120 Ga0105249_10024810 3300009553 Bacteria 5392
121 Ga0105249_10220425 3300009553 Unclassified 1866
122 Ga0105249_10242643 3300009553 Bacteria 1782
123 Ga0105249_10787975 3300009553 Bacteria 1014
124 Ga0105239_10017268 3300010375 Bacteria 7979
125 Ga0105239_10028278 3300010375 Bacteria 6167
126 Ga0105239_10581004 3300010375 Unclassified 1277
127 Ga0157378_10018044 3300013297 Bacteria 6196
128 Ga0157378_10081842 3300013297 Bacteria 2919
129 Ga0157375_10006986 3300013308 Bacteria 9856
130 Ga0157375_10023086 3300013308 Bacteria 5734
131 Ga0157375_10242869 3300013308 Bacteria 1960
132 Ga0157380_10000017 3300014326 Bacteria 119468
133 Ga0157380_10067655 3300014326 Bacteria 2877
134 Ga0157380_10183220 3300014326 Bacteria 1842
135 Ga0157380_10335504 3300014326 Bacteria 1408
136 Ga0182008_10023572 3300014497 Bacteria 3142
137 Ga0157377_10006545 3300014745 Bacteria 5563
138 Ga0157377_10023193 3300014745 Bacteria 3287
139 Ga0157377_10392185 3300014745 Bacteria 943
140 Ga0157377_10437043 3300014745 Bacteria 900
141 Ga0157379_10321171 3300014968 Bacteria 1414
142 Ga0207656_10000576 3300025321 Bacteria 12145
143 Ga0207692_10127965 3300025898 Bacteria 1431
144 Ga0207710_10000817 3300025900 Bacteria 16819
145 Ga0207688_10015276 3300025901 Bacteria 4167
146 Ga0207643_10436853 3300025908 Bacteria 831
147 Ga0207705_10019233 3300025909 Bacteria 4885
148 Ga0207705_10268492 3300025909 Bacteria 1304
149 Ga0207654_10026894 3300025911 Bacteria 3121
150 Ga0207693_10005718 3300025915 Bacteria 10328
151 Ga0207693_10436710 3300025915 Bacteria 1023
152 Ga0207663_10021419 3300025916 Bacteria 3680
153 Ga0207662_10114485 3300025918 Bacteria 1685
154 Ga0207657_10004970 3300025919 Bacteria 13991
155 Ga0207649_10000021 3300025920 Bacteria 209660
156 Ga0207649_10087707 3300025920 Bacteria 2030
157 Ga0207652_10164266 3300025921 Bacteria 1991
158 Ga0207659_10192566 3300025926 Bacteria 1624
159 Ga0207687_10031396 3300025927 Bacteria 3589
160 Ga0207687_10037625 3300025927 Bacteria 3303
161 Ga0207687_10159104 3300025927 Bacteria 1731
162 Ga0207690_10018371 3300025932 Bacteria 4289
163 Ga0207690_10201071 3300025932 Bacteria 1513
164 Ga0207706_10009875 3300025933 Bacteria 8756
165 Ga0207686_10000042 3300025934 Bacteria 122852
166 Ga0207686_10043002 3300025934 Bacteria 2765
167 Ga0207686_10263025 3300025934 Bacteria 1266
168 Ga0207709_10109564 3300025935 Bacteria 1844
169 Ga0207669_10168220 3300025937 Bacteria 1557
170 Ga0207704_10008145 3300025938 Bacteria 4992
171 Ga0207704_10019866 3300025938 Bacteria 3540
172 Ga0207665_10164634 3300025939 Bacteria 1598
173 Ga0207691_10000172 3300025940 Bacteria 60310
174 Ga0207691_10006847 3300025940 Bacteria 11000
175 Ga0207661_10055514 3300025944 Bacteria 3178
176 Ga0207661_10242225 3300025944 Bacteria 1601
177 Ga0207679_10278471 3300025945 Bacteria 1434
178 Ga0207679_10418838 3300025945 Bacteria 1182
179 Ga0207651_10114202 3300025960 Bacteria 2034
180 Ga0207712_10098399 3300025961 Unclassified 2169
181 Ga0207712_10543057 3300025961 Bacteria 999
182 Ga0207668_10159665 3300025972 Bacteria 1755
183 Ga0207668_10610628 3300025972 Bacteria 951
184 Ga0207640_10000026 3300025981 Bacteria 142343
185 Ga0207640_10008058 3300025981 Bacteria 5827
186 Ga0207640_10199220 3300025981 Bacteria 1516
187 Ga0207677_10177771 3300026023 Bacteria 1671
188 Ga0207703_10288247 3300026035 Bacteria 1493
189 Ga0207639_10025145 3300026041 Bacteria 4317
190 Ga0207639_10206421 3300026041 Bacteria 1688
191 Ga0207678_10000994 3300026067 Bacteria 25831
192 Ga0207708_10002088 3300026075 Bacteria 14696
193 Ga0207708_10032670 3300026075 Bacteria 3951
194 Ga0207708_10053970 3300026075 Bacteria 3063
195 Ga0207708_10399324 3300026075 Bacteria 1136
196 Ga0207648_10022910 3300026089 Bacteria 5602
197 Ga0207676_10032160 3300026095 Bacteria 3951
198 Ga0207674_10037977 3300026116 Bacteria 5003
199 Ga0207675_100015728 3300026118 Bacteria 7055
200 Ga0207675_100022882 3300026118 Bacteria 5813
201 Ga0207675_100509837 3300026118 Bacteria 1198
202 Ga0207683_10102102 3300026121 Bacteria 2561
203 Ga0207683_10105569 3300026121 Unclassified 2518
204 Ga0207698_10469667 3300026142 Bacteria 1218
205 Ga0207428_10159447 3300027907 Bacteria 1714
206 Ga0207428_10281922 3300027907 Bacteria 1233
207 Ga0268264_10167818 3300028381 Bacteria 1983
208 Ga0268264_10252772 3300028381 Bacteria 1638
209 Ga0268264_10309014 3300028381 Bacteria 1491
210 Ga0265337_1001302 3300028556 Bacteria 12454
211 Ga0265326_10000027 3300028558 Bacteria 110843
212 Ga0265334_10020312 3300028573 Bacteria 2721
213 Ga0265318_10057933 3300028577 Bacteria 1447
214 Ga0265322_10000003 3300028654 Bacteria 468671
215 Ga0265336_10004126 3300028666 Bacteria 5535
216 Ga0265324_10000074 3300029957 Bacteria 78102
217 Ga0265330_10089744 3300031235 Bacteria 1320
218 Ga0265328_10003810 3300031239 Bacteria 6627
219 Ga0265320_10000001 3300031240 Bacteria 847191
220 Ga0265329_10005849 3300031242 Bacteria 4935
221 Ga0265339_10126264 3300031249 Bacteria 1311
222 Ga0265331_10002908 3300031250 Bacteria 11321
223 Ga0265327_10000003 3300031251 Bacteria 852750
224 Ga0265314_10000222 3300031711 Bacteria 84593
225 Ga0265342_10096729 3300031712 Bacteria 1687
226 Ga0307405_10077507 3300031731 Bacteria 2160
227 Ga0307405_10226276 3300031731 Bacteria 1376
228 Ga0307413_10012785 3300031824 Bacteria 4191
229 Ga0307413_10126033 3300031824 Bacteria 1744
230 Ga0307410_10022403 3300031852 Bacteria 3904
231 Ga0307410_10196109 3300031852 Bacteria 1539
232 Ga0307406_10048859 3300031901 Bacteria 2675
233 Ga0307406_10499208 3300031901 Bacteria 986
234 Ga0307412_10032281 3300031911 Bacteria 3316
235 Ga0307409_100003819 3300031995 Bacteria 8311
236 Ga0307416_100351884 3300032002 Unclassified 1491
237 Ga0307415_100074112 3300032126 Bacteria 2404
238 Ga0373960_0146023 3300035121 Unclassified 805
239 Ga0316582_0402175 3300036647 Bacteria 943
240 Ga0436365_1156738 3300039437 Bacteria 4263
241 Ga0436363_1313926 3300039450 Bacteria 2734
242 Ga0466963_0402528 3300044694 Bacteria 965
243 Ga0466960_0047712 3300044901 Bacteria 2055
244 Ga0466960_0174131 3300044901 Unclassified 1163
245 Ga0466958_0336549 3300045836 Bacteria 971
246 Ga0466967_0028746 3300045976 Bacteria 4645
247 Ga0466967_0217118 3300045976 Bacteria 1816
248 Ga0466967_0299961 3300045976 Bacteria 1546
249 Ga0466967_0887442 3300045976 Bacteria 886
250 Ga0495603_0000044 3300046455 Bacteria 53548
251 Ga0495629_0288709 3300046459 Bacteria 1125
252 Ga0495638_0014624 3300046460 Bacteria 5296
253 Ga0495641_0015395 3300046461 Bacteria 4086
254 Ga0495662_0003766 3300046476 Bacteria 7650
255 Ga0495664_0137618 3300046477 Bacteria 1480
256 Ga0495608_0388762 3300046511 Bacteria 854
257 Ga0495630_0000007 3300046517 Bacteria 376915
258 Ga0495630_0150407 3300046517 Bacteria 1771
259 Ga0495652_0000003 3300046529 Bacteria 597094
260 Ga0495640_0015217 3300046533 Bacteria 5793
261 Ga0495625_0000204 3300046660 Bacteria 94356
262 Ga0495647_0000297 3300046681 Bacteria 13902
263 Ga0495647_0123585 3300046681 Bacteria 1091
264 Ga0495624_0000177 3300046690 Bacteria 47322
265 Ga0495674_0000027 3300047319 Bacteria 132744
266 Ga0495674_0430254 3300047319 Bacteria 1062
267 Ga0495676_0027288 3300047321 Bacteria 4898
268 Ga0495676_0069254 3300047321 Bacteria 2723
269 Ga0495680_0087265 3300047322 Bacteria 2347
270 Ga0495675_0041416 3300047444 Bacteria 2936
271 Ga0495686_0054066 3300047472 Bacteria 2515
272 Ga0496100_0006091 3300048903 Bacteria 6555
273 Ga0496100_0372124 3300048903 Unclassified 1084
274 Ga0496101_0276889 3300048904 Unclassified 1311
275 Ga0496101_0286290 3300048904 Unclassified 1289
276 Ga0496101_0321264 3300048904 Bacteria 1214
277 Ga0496102_0066757 3300048905 Bacteria 3298
278 Ga0496103_0066470 3300048906 Unclassified 2250
279 Ga0496104_0007798 3300048907 Bacteria 9490
280 Ga0496105_0041699 3300048908 Bacteria 3782
281 Ga0496106_0002210 3300048909 Bacteria 14512
282 Ga0496106_0060538 3300048909 Bacteria 2870
283 Ga0496106_0091718 3300048909 Bacteria 2346
284 Ga0496106_0373799 3300048909 Unclassified 1145
285 Ga0496107_0104521 3300048910 Unclassified 2078
286 Ga0496107_0255771 3300048910 Bacteria 1303
287 Ga0496107_0391173 3300048910 Unclassified 1034
288 Ga0496108_0000806 3300048911 Bacteria 24332
289 Ga0496108_0012129 3300048911 Bacteria 7008
290 Ga0496108_0294783 3300048911 Bacteria 1412
291 Ga0496108_0597501 3300048911 Bacteria 962
292 Ga0496108_0656246 3300048911 Bacteria 912
293 Ga0496109_0021702 3300048912 Bacteria 5682
294 Ga0496109_0195232 3300048912 Unclassified 1902
295 Ga0496109_0259860 3300048912 Bacteria 1636
296 Ga0496109_0990432 3300048912 Bacteria 778
297 Ga0496110_0000004 3300048913 Bacteria 122867
298 Ga0496110_0033461 3300048913 Bacteria 4446
299 Ga0496110_0034617 3300048913 Bacteria 4377
300 Ga0496110_0037058 3300048913 Bacteria 4237
301 Ga0496110_0182905 3300048913 Bacteria 1903
302 Ga0496110_0827470 3300048913 Bacteria 831
303 Ga0496111_0000007 3300048914 Bacteria 103885
304 Ga0496111_0044224 3300048914 Bacteria 3201
305 Ga0496111_0124999 3300048914 Bacteria 1901
306 Ga0496112_0036245 3300048915 Bacteria 4811
307 Ga0496112_0042722 3300048915 Bacteria 4436
308 Ga0496112_0089922 3300048915 Bacteria 3039
309 Ga0496113_0000460 3300048916 Bacteria 19823
310 Ga0496113_0003255 3300048916 Bacteria 9686
311 Ga0496113_0057938 3300048916 Bacteria 2913
312 Ga0496113_0434694 3300048916 Bacteria 1054
313 Ga0496114_0028557 3300048917 Bacteria 4578
314 Ga0496114_0060722 3300048917 Bacteria 3160
315 Ga0496114_0346499 3300048917 Unclassified 1314
316 Ga0496114_0478461 3300048917 Bacteria 1102
317 Ga0501039_0106480 3300049575 Bacteria 2190
318 Ga0501040_0301716 3300049576 Bacteria 1145
319 Ga0501042_0028926 3300049578 Bacteria 3908
320 Ga0501042_0055077 3300049578 Bacteria 2837
321 Ga0501068_0121160 3300049584 Bacteria 1631
322 Ga0501070_0054073 3300049586 Bacteria 3329
323 Ga0501071_0029090 3300049587 Bacteria 3897
324 Ga0501071_0135079 3300049587 Bacteria 1835
325 Ga0501071_0567465 3300049587 Unclassified 872
326 Ga0501072_0172934 3300049588 Bacteria 1723
327 Ga0501072_0275323 3300049588 Bacteria 1339
328 Ga0501072_0317806 3300049588 Bacteria 1237
329 Ga0501073_0054974 3300049589 Bacteria 2786
330 Ga0501074_0040303 3300049590 Bacteria 3383
331 Ga0501075_0250722 3300049591 Bacteria 1349
332 Ga0501076_0082200 3300049592 Bacteria 2586
333 Ga0501076_0300305 3300049592 Bacteria 1316
334 Ga0501077_0294935 3300049593 Bacteria 1033
335 nmdc:mga03n38_31630_c1 3300050490 Bacteria 2235
336 nmdc:mga03n38_7537_c1 3300050490 Bacteria 3855
337 nmdc:mga00v17_30140_c1 3300050491 Bacteria 3190
338 nmdc:mga00v17_37435_c1 3300050491 Bacteria 2073
339 nmdc:mga0yw44_398838_c1 3300050492 Unclassified 930
340 nmdc:mga0yw44_6426_c1 3300050492 Bacteria 5679
341 nmdc:mga0yw44_700_c1 3300050492 Bacteria 12279
342 nmdc:mga0qj67_302088_c1 3300050509 Bacteria 1297
343 nmdc:mga06r32_554887_c1 3300050510 Bacteria 1122
344 nmdc:mga08y16_130857_c1 3300050511 Bacteria 2609
345 nmdc:mga08y16_389571_c1 3300050511 Bacteria 1428
346 nmdc:mga08y16_580948_c1 3300050511 Bacteria 1131
347 Ga0495655_0000765 3300053083 Bacteria 5048
348 Ga0495619_0000038 3300053085 Bacteria 121365
349 Ga0500641_0006502 3300053096 Bacteria 4146
350 Ga0501082_0471282 3300060353 Bacteria 1097
351 Ga0466962_0039967 3300061719 Bacteria 2246
352 Ga0495629_0001288
353 Ga0070658_10064065
354 Ga0070658_10076887
355 Ga0070683_100335996
356 Ga0068869_100280796
357 Ga0068869_100330035
358 Ga0070682_100000100
359 Ga0068868_100005092
360 Ga0068868_100079803
361 Ga0070660_100000656
362 Ga0070689_100435667
363 Ga0070689_100676979
364 Ga0070691_10187728
365 Ga0070687_100023376
366 Ga0070687_100025361
367 Ga0070661_100000031
368 Ga0070661_100082241
369 Ga0070661_100401890
370 Ga0070692_10091107
371 Ga0070668_100405632
372 Ga0070669_100047762
373 Ga0070675_100010455
374 Ga0070674_100030008
375 Ga0070674_100239351
376 Ga0070673_100317911
377 Ga0070688_100000064
378 Ga0070659_100005040
379 Ga0070659_101002817
380 Ga0070710_10152510
381 Ga0070701_10063178
382 Ga0070711_100011048
383 Ga0070700_100072410
384 Ga0070700_100137244
385 Ga0070700_100230170
386 Ga0070700_100506240
387 Ga0070694_100400546
388 Ga0070663_100001885
389 Ga0070678_100048315
390 Ga0070678_100393669
391 Ga0070662_100127825
392 Ga0068867_100014807
393 Ga0070685_10000154
394 Ga0070685_10048487
395 Ga0070685_10197719
396 Ga0070707_100369080
397 Ga0070707_100374203
398 Ga0070698_100908247
399 Ga0070679_100175711
400 Ga0070684_100021366
401 Ga0070684_100440867
402 Ga0068853_100015153
403 Ga0068853_100260461
404 Ga0070672_100000023
405 Ga0070672_100003065
406 Ga0070686_100032308
407 Ga0070665_100210998
408 Ga0070704_100482912
409 Ga0070664_100354215
410 Ga0068854_100000107
411 Ga0068854_100002182
412 Ga0068854_100025912
413 Ga0068856_100364854
414 Ga0068856_100602556
415 Ga0068856_100794527
416 Ga0070702_100008335
417 Ga0068852_100055949
418 Ga0068859_100223772
419 Ga0068864_100066795
420 Ga0068864_100233487
421 Ga0068864_101056580
422 Ga0068866_10022083
423 Ga0068861_100049005
424 Ga0068861_100272810
425 Ga0068851_10000287
426 Ga0068870_10407552
427 Ga0068858_100063007
428 Ga0068858_100363816
429 Ga0068860_100463641
430 Ga0068860_100616055
431 Ga0068862_100023207
432 Ga0081455_10049976
433 Ga0081455_10076420
434 Ga0081455_10284158
435 Ga0081538_10020878
436 Ga0081540_1000735
437 Ga0081539_10003289
438 Ga0081539_10017154
439 Ga0075365_10002695
440 Ga0075365_10124354
441 Ga0075363_100021935
442 Ga0075363_100028188
443 Ga0075364_10038282
444 Ga0075364_10078136
445 Ga0070712_100087763
446 Ga0070712_100514006
447 Ga0075428_100062614
448 Ga0075428_101211216
449 Ga0075430_100331592
450 Ga0068865_100030533
451 Ga0068865_100039812
452 Ga0068865_100149821
453 Ga0097620_100223775
454 Ga0111539_10061015
455 Ga0111539_10090413
456 Ga0111539_10562252
457 Ga0111539_10748908
458 Ga0105245_10008945
459 Ga0105245_10051216
460 Ga0105245_10117062
461 Ga0105245_10720448
462 Ga0105247_10000407
463 Ga0105247_10119100
464 Ga0105243_10009463
465 Ga0105243_10271933
466 Ga0105242_10000245
467 Ga0105242_10054859
468 Ga0105242_10320497
469 Ga0105248_10083374
470 Ga0105237_10458230
471 Ga0105249_10024810
472 Ga0105249_10220425
473 Ga0105249_10242643
474 Ga0105249_10787975
475 Ga0105239_10017268
476 Ga0105239_10028278
477 Ga0105239_10581004
478 Ga0157378_10018044
479 Ga0157378_10081842
480 Ga0157375_10006986
481 Ga0157375_10023086
482 Ga0157375_10242869
483 Ga0157380_10000017
484 Ga0157380_10067655
485 Ga0157380_10183220
486 Ga0157380_10335504
487 Ga0182008_10023572
488 Ga0157377_10006545
489 Ga0157377_10023193
490 Ga0157377_10392185
491 Ga0157377_10437043
492 Ga0157379_10321171
493 Ga0207656_10000576
494 Ga0207692_10127965
495 Ga0207710_10000817
496 Ga0207688_10015276
497 Ga0207643_10436853
498 Ga0207705_10019233
499 Ga0207705_10268492
500 Ga0207654_10026894
501 Ga0207693_10005718
502 Ga0207693_10436710
503 Ga0207663_10021419
504 Ga0207662_10114485
505 Ga0207657_10004970
506 Ga0207649_10000021
507 Ga0207649_10087707
508 Ga0207652_10164266
509 Ga0207659_10192566
510 Ga0207687_10031396
511 Ga0207687_10037625
512 Ga0207687_10159104
513 Ga0207690_10018371
514 Ga0207690_10201071
515 Ga0207706_10009875
516 Ga0207686_10000042
517 Ga0207686_10043002
518 Ga0207686_10263025
519 Ga0207709_10109564
520 Ga0207669_10168220
521 Ga0207704_10008145
522 Ga0207704_10019866
523 Ga0207665_10164634
524 Ga0207691_10000172
525 Ga0207691_10006847
526 Ga0207661_10055514
527 Ga0207661_10242225
528 Ga0207679_10278471
529 Ga0207679_10418838
530 Ga0207651_10114202
531 Ga0207712_10098399
532 Ga0207712_10543057
533 Ga0207668_10159665
534 Ga0207668_10610628
535 Ga0207640_10000026
536 Ga0207640_10008058
537 Ga0207640_10199220
538 Ga0207677_10177771
539 Ga0207703_10288247
540 Ga0207639_10025145
541 Ga0207639_10206421
542 Ga0207678_10000994
543 Ga0207708_10002088
544 Ga0207708_10032670
545 Ga0207708_10053970
546 Ga0207708_10399324
547 Ga0207648_10022910
548 Ga0207676_10032160
549 Ga0207674_10037977
550 Ga0207675_100015728
551 Ga0207675_100022882
552 Ga0207675_100509837
553 Ga0207683_10102102
554 Ga0207683_10105569
555 Ga0207698_10469667
556 Ga0207428_10159447
557 Ga0207428_10281922
558 Ga0268264_10167818
559 Ga0268264_10252772
560 Ga0268264_10309014
561 Ga0265337_1001302
562 Ga0265326_10000027
563 Ga0265334_10020312
564 Ga0265318_10057933
565 Ga0265322_10000003
566 Ga0265336_10004126
567 Ga0265324_10000074
568 Ga0265330_10089744
569 Ga0265328_10003810
570 Ga0265320_10000001
571 Ga0265329_10005849
572 Ga0265339_10126264
573 Ga0265331_10002908
574 Ga0265327_10000003
575 Ga0265314_10000222
576 Ga0265342_10096729
577 Ga0307405_10077507
578 Ga0307405_10226276
579 Ga0307413_10012785
580 Ga0307413_10126033
581 Ga0307410_10022403
582 Ga0307410_10196109
583 Ga0307406_10048859
584 Ga0307406_10499208
585 Ga0307412_10032281
586 Ga0307409_100003819
587 Ga0307416_100351884
588 Ga0307415_100074112
589 Ga0373960_0146023
590 Ga0316582_0402175
591 Ga0436365_1156738
592 Ga0436363_1313926
593 Ga0466963_0402528
594 Ga0466960_0047712
595 Ga0466960_0174131
596 Ga0466958_0336549
597 Ga0466967_0028746
598 Ga0466967_0217118
599 Ga0466967_0299961
600 Ga0466967_0887442
601 Ga0495603_0000044
602 Ga0495629_0288709
603 Ga0495638_0014624
604 Ga0495641_0015395
605 Ga0495662_0003766
606 Ga0495664_0137618
607 Ga0495608_0388762
608 Ga0495630_0000007
609 Ga0495630_0150407
610 Ga0495652_0000003
611 Ga0495640_0015217
612 Ga0495625_0000204
613 Ga0495647_0000297
614 Ga0495647_0123585
615 Ga0495624_0000177
616 Ga0495674_0000027
617 Ga0495674_0430254
618 Ga0495676_0027288
619 Ga0495676_0069254
620 Ga0495680_0087265
621 Ga0495675_0041416
622 Ga0495686_0054066
623 Ga0496100_0006091
624 Ga0496100_0372124
625 Ga0496101_0276889
626 Ga0496101_0286290
627 Ga0496101_0321264
628 Ga0496102_0066757
629 Ga0496103_0066470
630 Ga0496104_0007798
631 Ga0496105_0041699
632 Ga0496106_0002210
633 Ga0496106_0060538
634 Ga0496106_0091718
635 Ga0496106_0373799
636 Ga0496107_0104521
637 Ga0496107_0255771
638 Ga0496107_0391173
639 Ga0496108_0000806
640 Ga0496108_0012129
641 Ga0496108_0294783
642 Ga0496108_0597501
643 Ga0496108_0656246
644 Ga0496109_0021702
645 Ga0496109_0195232
646 Ga0496109_0259860
647 Ga0496109_0990432
648 Ga0496110_0000004
649 Ga0496110_0033461
650 Ga0496110_0034617
651 Ga0496110_0037058
652 Ga0496110_0182905
653 Ga0496110_0827470
654 Ga0496111_0000007
655 Ga0496111_0044224
656 Ga0496111_0124999
657 Ga0496112_0036245
658 Ga0496112_0042722
659 Ga0496112_0089922
660 Ga0496113_0000460
661 Ga0496113_0003255
662 Ga0496113_0057938
663 Ga0496113_0434694
664 Ga0496114_0028557
665 Ga0496114_0060722
666 Ga0496114_0346499
667 Ga0496114_0478461
668 Ga0501039_0106480
669 Ga0501040_0301716
670 Ga0501042_0028926
671 Ga0501042_0055077
672 Ga0501068_0121160
673 Ga0501070_0054073
674 Ga0501071_0029090
675 Ga0501071_0135079
676 Ga0501071_0567465
677 Ga0501072_0172934
678 Ga0501072_0275323
679 Ga0501072_0317806
680 Ga0501073_0054974
681 Ga0501074_0040303
682 Ga0501075_0250722
683 Ga0501076_0082200
684 Ga0501076_0300305
685 Ga0501077_0294935
686 nmdc:mga03n38_31630_c1
687 nmdc:mga03n38_7537_c1
688 nmdc:mga00v17_30140_c1
689 nmdc:mga00v17_37435_c1
690 nmdc:mga0yw44_398838_c1
691 nmdc:mga0yw44_6426_c1
692 nmdc:mga0yw44_700_c1
693 nmdc:mga0qj67_302088_c1
694 nmdc:mga06r32_554887_c1
695 nmdc:mga08y16_130857_c1
696 nmdc:mga08y16_389571_c1
697 nmdc:mga08y16_580948_c1
698 Ga0495655_0000765
699 Ga0495619_0000038
700 Ga0500641_0006502
701 Ga0501082_0471282
702 Ga0466962_0039967

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

185

226

0.93

PF00498

FHA

FHA domain

69

135

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gqs-assembly2.cif.gz_B crystal structure of the fha domain of ct664 protein from chlamydia trachomatis 0.914 22 118
8p5r-assembly1.cif.gz_H crystal structure of full-length, homohexameric 2-oxoglutarate dehydrogenase kgd from mycobacterium smegmatis in complex with gara 0.9091 21 118
6i2r-assembly1.cif.gz_D crystal structure of the suca domain of mycobacterium smegmatis kgd (alpha-ketoglutarate decarboxylase), mutant r802a, in complex with gara 0.9015 25 118
4gvp-assembly1.cif.gz_A crystal structure of the response regulator protein vrar from staphylococcus aureus 0.8954 135 217
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.89 136 216
ID Description Score Start End Superfamily
af_O65934_209_307_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9347 43 120 2.60.200.20
4if4B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9043 134 217 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9037 139 208 1.10.10.10
4gvpA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9024 135 216 3.40.50.2300
4ijaA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8966 143 191 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1V5GUZ6-F1-model_v4 FHA domain protein 0.94 23 121
AF-A0A1M3BG64-F1-model_v4 HTH luxR-type domain-containing protein 0.9222 133 217 GO:0003677
GO:0006355
GO:0016020
AF-A0A0D8HKH1-F1-model_v4 FHA domain-containing protein FhaB 0.9188 21 117 GO:0016020
AF-A0A7X7T7C9-F1-model_v4 FHA domain-containing protein 0.9177 22 118 GO:0016020
AF-A0A7V8YDA2-F1-model_v4 FHA domain-containing protein 0.9147 22 119

Map