F418795

General Info

Members Datasets Scaffolds Average Seq Length
351 248 702 407

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0003287|Ga0501032_0003287_5675_7075
Length 466
Sequence MMPFRVVICGFQPFESPGVRLPASTPTTIDGEQIMPKPPPASLSDRTIALSFCAGGFRGWLGVVTDSTTCAIVGGGPAGMMLGLILARCGVDVTVLEKHADFLRDFRGDTVHPSTMRLLDELGLLQKFDEIPYSKVEKGDFTVDGQAITMVDFRRLRQPHPYVAMVPQWDFLDLLADAGKSEPHFTLRMQTEVTGLLRDGDRITGVRYESPDGPGELRADLTVGCDGRWSVTRRESGLSVREYPVPFDVWWLRVPRTNDGDYSLIPRTAPGKALIMIPRRGYFQIAYLIPKGSDTGLRSRGLDRFKSELAELIPESDVDSLNSWDDVKFLDVRLNRLHTWHRDGLLCIGDAAHAMSPAGGVGVNVAIQDAVAASRLLHAPLREHRLTETNLAAVQRQRTVPTVVTQGFQRIVHRQVLAPAMAGKEIIPPPALRNLLHRLPRLATVPGYIIGTGVRPEHVPTIARRR

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
124 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
125 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
223 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
224 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
227 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
228 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
229 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
230 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
231 2867475112 Streptomyces sp. TM32 Isolate Unclassified
232 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
233 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
234 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
235 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
236 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
237 2920879853 Kocuria salina CV6 Isolate Unclassified
238 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
239 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
240 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
241 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
242 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
243 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
244 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
245 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
246 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
247 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
248 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.16
Metatranscriptomes 0
Isolates 6.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.41
Nodule 0
Rhizoplane 10.26
Rhizosphere 72.65
Stem 0
Stem Tuber 0
Unclassified 1.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0003287 3300049569 Bacteria 12437
2 LJQas_1000922 3300000549 Bacteria 4575
3 JGI25152J39213_1001193 3300002773 Bacteria 11954
4 JGI25160J50197_1006844 3300003354 Bacteria 4558
5 Ga0065714_10084548 3300005288 Bacteria 2192
6 Ga0070683_100007206 3300005329 Bacteria 9382
7 Ga0068869_100077600 3300005334 Bacteria 2472
8 Ga0070666_10001964 3300005335 Bacteria 12522
9 Ga0070666_10058193 3300005335 Bacteria 2613
10 Ga0070666_10097735 3300005335 Bacteria 2021
11 Ga0070682_100019825 3300005337 Bacteria 3949
12 Ga0068868_100021443 3300005338 Bacteria 4864
13 Ga0068868_100078789 3300005338 Bacteria 2638
14 Ga0070689_100057050 3300005340 Bacteria 3030
15 Ga0070668_100007768 3300005347 Bacteria 7963
16 Ga0070668_100026917 3300005347 Bacteria 4365
17 Ga0070668_100087866 3300005347 Bacteria 2446
18 Ga0070668_100092456 3300005347 Bacteria 2386
19 Ga0070659_100037689 3300005366 Bacteria 3770
20 Ga0070659_100168022 3300005366 Bacteria 1795
21 Ga0070659_100234879 3300005366 Bacteria 1516
22 Ga0070667_100004728 3300005367 Bacteria 11414
23 Ga0070667_100064299 3300005367 Bacteria 3113
24 Ga0070709_10015462 3300005434 Bacteria 4343
25 Ga0070714_100002102 3300005435 Bacteria 14607
26 Ga0070714_100007490 3300005435 Bacteria 8495
27 Ga0070714_100038593 3300005435 Bacteria 4016
28 Ga0070710_10088015 3300005437 Bacteria 1826
29 Ga0070710_10133392 3300005437 Bacteria 1516
30 Ga0070711_100006031 3300005439 Bacteria 7276
31 Ga0070711_100037446 3300005439 Bacteria 3255
32 Ga0070700_100007486 3300005441 Bacteria 5901
33 Ga0070700_100156636 3300005441 Bacteria 1564
34 Ga0070678_100118736 3300005456 Bacteria 2082
35 Ga0070678_100168278 3300005456 Bacteria 1782
36 Ga0068867_100001731 3300005459 Bacteria 15202
37 Ga0070685_10022773 3300005466 Bacteria 3420
38 Ga0070685_10041499 3300005466 Bacteria 2622
39 Ga0070706_100001197 3300005467 Bacteria 27787
40 Ga0068853_100039145 3300005539 Bacteria 4043
41 Ga0068853_100173744 3300005539 Bacteria 1950
42 Ga0070672_100213407 3300005543 Bacteria 1617
43 Ga0070695_100021598 3300005545 Bacteria 3942
44 Ga0070695_100146374 3300005545 Bacteria 1644
45 Ga0070693_100055870 3300005547 Bacteria 2276
46 Ga0070665_100000137 3300005548 Bacteria 137413
47 Ga0070665_100022107 3300005548 Bacteria 6398
48 Ga0070665_100083366 3300005548 Bacteria 3202
49 Ga0070704_100000886 3300005549 Bacteria 14990
50 Ga0068855_100002492 3300005563 Bacteria 22681
51 Ga0068854_100048220 3300005578 Bacteria 3038
52 Ga0068856_100005684 3300005614 Bacteria 12283
53 Ga0068866_10000844 3300005718 Bacteria 13608
54 Ga0068861_100028159 3300005719 Bacteria 4099
55 Ga0068863_100006453 3300005841 Bacteria 11503
56 Ga0068858_100105616 3300005842 Bacteria 2628
57 Ga0068860_100009685 3300005843 Bacteria 9570
58 Ga0068862_100021725 3300005844 Bacteria 5368
59 Ga0081455_10004855 3300005937 Bacteria 14918
60 Ga0081455_10029502 3300005937 Bacteria 5001
61 Ga0081455_10034160 3300005937 Bacteria 4559
62 Ga0081455_10067238 3300005937 Bacteria 2987
63 Ga0070717_10018143 3300006028 Bacteria 5491
64 Ga0075365_10017771 3300006038 Bacteria 4360
65 Ga0075363_100006824 3300006048 Bacteria 5218
66 Ga0075364_10014930 3300006051 Bacteria 4808
67 Ga0075432_10033292 3300006058 Bacteria 1787
68 Ga0070716_100024412 3300006173 Bacteria 3217
69 Ga0070712_100008363 3300006175 Bacteria 6506
70 Ga0070712_100104784 3300006175 Bacteria 2099
71 Ga0097621_100093475 3300006237 Bacteria 2520
72 Ga0075431_100020408 3300006847 Bacteria 6770
73 Ga0075434_100072294 3300006871 Bacteria 3441
74 Ga0075429_100285720 3300006880 Bacteria 1445
75 Ga0068865_100015011 3300006881 Bacteria 4933
76 Ga0068865_100025367 3300006881 Bacteria 3899
77 Ga0068865_100084416 3300006881 Bacteria 2288
78 Ga0105251_10041520 3300009011 Bacteria 2238
79 Ga0105240_10054459 3300009093 Bacteria 5013
80 Ga0105240_10085272 3300009093 Bacteria 3870
81 Ga0111539_10024117 3300009094 Bacteria 7471
82 Ga0111539_10152556 3300009094 Bacteria 2704
83 Ga0111539_10229017 3300009094 Bacteria 2164
84 Ga0105245_10001126 3300009098 Bacteria 24176
85 Ga0105247_10000094 3300009101 Bacteria 96396
86 Ga0105247_10013750 3300009101 Bacteria 4853
87 Ga0105243_10003000 3300009148 Bacteria 13943
88 Ga0105242_10199604 3300009176 Bacteria 1776
89 Ga0105248_10023984 3300009177 Bacteria 6782
90 Ga0105248_10032542 3300009177 Bacteria 5828
91 Ga0105237_10217108 3300009545 Bacteria 1912
92 Ga0105238_10051348 3300009551 Bacteria 4147
93 Ga0105238_10106509 3300009551 Bacteria 2785
94 Ga0105249_10009623 3300009553 Bacteria 8468
95 Ga0105246_10024904 3300011119 Bacteria 3895
96 Ga0157371_10094569 3300013102 Bacteria 2118
97 Ga0157369_10062806 3300013105 Bacteria 4002
98 Ga0157378_10003396 3300013297 Bacteria 14157
99 Ga0163162_10210211 3300013306 Bacteria 2075
100 Ga0157372_10100364 3300013307 Bacteria 3303
101 Ga0157372_10189058 3300013307 Bacteria 2385
102 Ga0157375_10048444 3300013308 Bacteria 4157
103 Ga0157380_10078540 3300014326 Bacteria 2693
104 Ga0182008_10041605 3300014497 Bacteria 2292
105 Ga0157379_10001866 3300014968 Bacteria 17433
106 Ga0157379_10021091 3300014968 Bacteria 5766
107 Ga0157379_10176588 3300014968 Bacteria 1929
108 Ga0157376_10085082 3300014969 Bacteria 2724
109 Ga0157376_10134485 3300014969 Bacteria 2211
110 Ga0213872_10000239 3300021361 Bacteria 48382
111 Ga0213876_10000795 3300021384 Bacteria 21427
112 Ga0213876_10021200 3300021384 Bacteria 3436
113 Ga0213876_10022522 3300021384 Bacteria 3330
114 Ga0213875_10020060 3300021388 Unclassified 3208
115 Ga0209148_1004078 3300025254 Bacteria 3703
116 Ga0209129_1000052 3300025258 Bacteria 265251
117 Ga0209025_1001043 3300025294 Bacteria 40722
118 Ga0207426_1000625 3300025302 Bacteria 44906
119 Ga0207426_1002131 3300025302 Bacteria 13542
120 Ga0209051_1013890 3300025303 Bacteria 3797
121 Ga0207697_10008811 3300025315 Bacteria 4390
122 Ga0207682_10003807 3300025893 Bacteria 6473
123 Ga0207692_10004545 3300025898 Bacteria 5504
124 Ga0207692_10044147 3300025898 Bacteria 2222
125 Ga0207710_10000119 3300025900 Bacteria 97053
126 Ga0207710_10078808 3300025900 Bacteria 1525
127 Ga0207688_10004649 3300025901 Bacteria 7481
128 Ga0207688_10034936 3300025901 Bacteria 2784
129 Ga0207680_10000837 3300025903 Bacteria 14529
130 Ga0207680_10063516 3300025903 Bacteria 2260
131 Ga0207685_10023165 3300025905 Bacteria 2110
132 Ga0207699_10169682 3300025906 Bacteria 1459
133 Ga0207645_10023752 3300025907 Bacteria 3981
134 Ga0207645_10034831 3300025907 Bacteria 3234
135 Ga0207684_10005097 3300025910 Bacteria 12246
136 Ga0207695_10002853 3300025913 Bacteria 25128
137 Ga0207695_10025397 3300025913 Bacteria 6632
138 Ga0207671_10238015 3300025914 Bacteria 1429
139 Ga0207693_10002096 3300025915 Bacteria 17406
140 Ga0207693_10060160 3300025915 Bacteria 2975
141 Ga0207663_10089734 3300025916 Bacteria 2036
142 Ga0207662_10036962 3300025918 Bacteria 2856
143 Ga0207681_10162869 3300025923 Bacteria 1683
144 Ga0207687_10005249 3300025927 Bacteria 8591
145 Ga0207700_10247575 3300025928 Bacteria 1521
146 Ga0207664_10036345 3300025929 Bacteria 3807
147 Ga0207664_10061927 3300025929 Bacteria 2987
148 Ga0207706_10012282 3300025933 Bacteria 7804
149 Ga0207704_10014204 3300025938 Bacteria 4014
150 Ga0207691_10058223 3300025940 Bacteria 3514
151 Ga0207711_10010465 3300025941 Bacteria 7702
152 Ga0207689_10052266 3300025942 Bacteria 3367
153 Ga0207661_10097076 3300025944 Bacteria 2467
154 Ga0207667_10001408 3300025949 Bacteria 30168
155 Ga0207712_10087253 3300025961 Bacteria 2288
156 Ga0207668_10092945 3300025972 Bacteria 2221
157 Ga0207668_10175397 3300025972 Bacteria 1685
158 Ga0207658_10021152 3300025986 Bacteria 4512
159 Ga0207677_10087485 3300026023 Bacteria 2256
160 Ga0207703_10213415 3300026035 Bacteria 1722
161 Ga0207639_10015169 3300026041 Bacteria 5429
162 Ga0207708_10004969 3300026075 Bacteria 9794
163 Ga0207708_10086698 3300026075 Bacteria 2409
164 Ga0207702_10045441 3300026078 Bacteria 3694
165 Ga0207641_10081715 3300026088 Bacteria 2806
166 Ga0207641_10338703 3300026088 Bacteria 1431
167 Ga0207648_10006698 3300026089 Bacteria 11426
168 Ga0207648_10064552 3300026089 Bacteria 3191
169 Ga0207676_10038354 3300026095 Bacteria 3656
170 Ga0207683_10092436 3300026121 Bacteria 2696
171 Ga0207683_10141440 3300026121 Bacteria 2168
172 Ga0268266_10086881 3300028379 Bacteria 2735
173 Ga0268265_10036882 3300028380 Bacteria 3584
174 Ga0268264_10104095 3300028381 Bacteria 2473
175 Ga0265337_1002501 3300028556 Bacteria 8380
176 Ga0265319_1013504 3300028563 Bacteria 3243
177 Ga0316181_1100278 3300030744 Bacteria 1729
178 Ga0265320_10001483 3300031240 Bacteria 17128
179 Ga0265331_10004294 3300031250 Bacteria 8926
180 Ga0265327_10000069 3300031251 Bacteria 217784
181 Ga0307513_10021495 3300031456 Bacteria 7616
182 Ga0307408_100021066 3300031548 Bacteria 4407
183 Ga0307408_100220453 3300031548 Bacteria 1547
184 Ga0265313_10000469 3300031595 Bacteria 42166
185 Ga0307405_10032897 3300031731 Bacteria 3070
186 Ga0307413_10156943 3300031824 Bacteria 1593
187 Ga0307518_10057853 3300031838 Bacteria 2816
188 Ga0307410_10134912 3300031852 Bacteria 1818
189 Ga0307507_10019620 3300033179 Bacteria 7608
190 Ga0307510_10017084 3300033180 Bacteria 8560
191 Ga0316584_0045222 3300036712 Bacteria 3286
192 Ga0395898_0197177 3300037466 Bacteria 1923
193 Ga0436364_0019204 3300037853 Bacteria 6670
194 Ga0436364_0897743 3300037853 Unclassified 3474
195 Ga0436364_1003317 3300037853 Unclassified 2966
196 Ga0395901_0199069 3300038443 Bacteria 2100
197 Ga0436365_0123721 3300039437 Bacteria 18265
198 Ga0436365_0928916 3300039437 Bacteria 34395
199 Ga0436365_1051189 3300039437 Unclassified 2169
200 Ga0436365_1296534 3300039437 Bacteria 12430
201 Ga0436361_0863641 3300039447 Bacteria 83672
202 Ga0436363_0097909 3300039450 Bacteria 7261
203 Ga0436363_0114223 3300039450 Bacteria 3096
204 Ga0466966_0134347 3300044684 Bacteria 1513
205 Ga0466961_0001979 3300044693 Bacteria 12749
206 Ga0466957_0006258 3300044842 Bacteria 6717
207 Ga0466959_0001681 3300045049 Bacteria 13712
208 Ga0466958_0002563 3300045836 Bacteria 9173
209 Ga0466967_0012846 3300045976 Bacteria 6436
210 Ga0466967_0036273 3300045976 Bacteria 4207
211 Ga0466967_0087793 3300045976 Bacteria 2820
212 Ga0466967_0127613 3300045976 Bacteria 2358
213 Ga0495629_0125983 3300046459 Bacteria 1784
214 Ga0495653_0001613 3300046463 Bacteria 17714
215 Ga0495580_0041011 3300046472 Bacteria 3303
216 Ga0495582_0079323 3300046473 Bacteria 1822
217 Ga0495662_0002270 3300046476 Bacteria 9692
218 Ga0495664_0004073 3300046477 Bacteria 7972
219 Ga0495642_0033948 3300046528 Bacteria 2053
220 Ga0495654_0102478 3300046530 Bacteria 1316
221 Ga0495665_0000402 3300046531 Bacteria 21980
222 Ga0495665_0034074 3300046531 Bacteria 2723
223 Ga0495586_0001126 3300046535 Bacteria 15044
224 Ga0495586_0003775 3300046535 Bacteria 8117
225 Ga0495587_0003592 3300046536 Bacteria 10325
226 Ga0495645_0000495 3300046543 Bacteria 27241
227 Ga0495667_0000098 3300046559 Bacteria 62781
228 Ga0495635_0166415 3300046663 Bacteria 1500
229 Ga0495659_0007297 3300046664 Bacteria 3504
230 Ga0495588_0003836 3300046674 Bacteria 6588
231 Ga0495588_0017268 3300046674 Bacteria 3500
232 Ga0495670_0004291 3300046691 Bacteria 6984
233 Ga0495671_0055974 3300046692 Bacteria 1953
234 Ga0495581_0099217 3300047315 Bacteria 1692
235 Ga0495581_0107888 3300047315 Bacteria 1618
236 Ga0495604_0062271 3300047317 Bacteria 2851
237 Ga0495636_0003754 3300047318 Bacteria 5910
238 Ga0495672_0016470 3300047320 Bacteria 4979
239 Ga0495680_0015578 3300047322 Bacteria 6557
240 Ga0495675_0008849 3300047444 Bacteria 6250
241 Ga0495681_0038174 3300047470 Bacteria 2357
242 Ga0496100_0000836 3300048903 Bacteria 14772
243 Ga0496100_0002912 3300048903 Bacteria 8786
244 Ga0496101_0000056 3300048904 Bacteria 135446
245 Ga0496101_0001135 3300048904 Bacteria 15897
246 Ga0496101_0195314 3300048904 Bacteria 1563
247 Ga0496102_0000177 3300048905 Bacteria 86724
248 Ga0496102_0008169 3300048905 Bacteria 8957
249 Ga0496102_0009865 3300048905 Bacteria 8209
250 Ga0496102_0011501 3300048905 Bacteria 7632
251 Ga0496103_0000003 3300048906 Bacteria 603967
252 Ga0496103_0006151 3300048906 Bacteria 7174
253 Ga0496103_0006434 3300048906 Bacteria 7013
254 Ga0496103_0052351 3300048906 Bacteria 2529
255 Ga0496104_0005253 3300048907 Bacteria 11319
256 Ga0496105_0045825 3300048908 Bacteria 3608
257 Ga0496105_0107657 3300048908 Bacteria 2301
258 Ga0496106_0005204 3300048909 Bacteria 9633
259 Ga0496106_0025658 3300048909 Bacteria 4387
260 Ga0496106_0027381 3300048909 Bacteria 4245
261 Ga0496107_0006291 3300048910 Bacteria 8160
262 Ga0496107_0035308 3300048910 Bacteria 3584
263 Ga0496107_0057452 3300048910 Bacteria 2812
264 Ga0496108_0093557 3300048911 Bacteria 2557
265 Ga0496108_0200105 3300048911 Bacteria 1733
266 Ga0496109_0000029 3300048912 Bacteria 164675
267 Ga0496109_0001405 3300048912 Bacteria 19963
268 Ga0496109_0150052 3300048912 Bacteria 2182
269 Ga0496110_0094704 3300048913 Bacteria 2674
270 Ga0496111_0103237 3300048914 Bacteria 2096
271 Ga0496111_0138573 3300048914 Bacteria 1803
272 Ga0496112_0056982 3300048915 Bacteria 3847
273 Ga0496112_0061222 3300048915 Bacteria 3710
274 Ga0496112_0097118 3300048915 Bacteria 2917
275 Ga0496113_0150474 3300048916 Bacteria 1836
276 Ga0496114_0026019 3300048917 Bacteria 4787
277 Ga0496115_0210662 3300048918 Bacteria 1605
278 Ga0496116_0000013 3300048919 Bacteria 603993
279 Ga0496117_0000013 3300048920 Bacteria 603995
280 Ga0496118_0000011 3300048921 Bacteria 603995
281 Ga0496118_0104010 3300048921 Bacteria 1908
282 Ga0496119_0000946 3300048922 Bacteria 37374
283 Ga0496119_0007186 3300048922 Bacteria 10087
284 Ga0496120_0000224 3300048923 Bacteria 97511
285 Ga0496121_0000060 3300048924 Bacteria 276682
286 Ga0496125_0113398 3300048928 Bacteria 1956
287 Ga0496126_0001987 3300048929 Bacteria 28983
288 Ga0496126_0005424 3300048929 Bacteria 14548
289 Ga0501032_0002021 3300049569 Bacteria 15995
290 Ga0501034_0000960 3300049571 Bacteria 41575
291 Ga0501034_0006815 3300049571 Bacteria 12219
292 Ga0501034_0041644 3300049571 Bacteria 4647
293 Ga0501036_0002271 3300049572 Bacteria 15022
294 Ga0501036_0050944 3300049572 Bacteria 3506
295 Ga0501037_0002160 3300049573 Bacteria 14235
296 Ga0501039_0000903 3300049575 Bacteria 21630
297 Ga0501043_0001683 3300049579 Bacteria 19186
298 Ga0501046_0007491 3300049580 Bacteria 9581
299 Ga0501047_0005226 3300049581 Bacteria 12188
300 Ga0501047_0115878 3300049581 Bacteria 2561
301 Ga0501047_0117395 3300049581 Bacteria 2542
302 Ga0501048_0001799 3300049582 Bacteria 16297
303 Ga0501067_0013088 3300049583 Bacteria 4592
304 Ga0501068_0090188 3300049584 Bacteria 1891
305 Ga0501069_0111777 3300049585 Bacteria 1556
306 Ga0501070_0007399 3300049586 Bacteria 9329
307 Ga0501070_0052794 3300049586 Bacteria 3374
308 Ga0501080_0064551 3300049742 Bacteria 3405
309 Ga0501035_0051345 3300049822 Bacteria 3692
310 Ga0501035_0283825 3300049822 Bacteria 1399
311 Ga0501044_0005851 3300049823 Bacteria 13619
312 Ga0501044_0006114 3300049823 Bacteria 13282
313 nmdc:mga00v17_17813_c1 3300050491 Bacteria 4029
314 nmdc:mga0yw44_10272_c1 3300050492 Bacteria 4774
315 nmdc:mga06r32_12530_c1 3300050510 Bacteria 7654
316 nmdc:mga06r32_72434_c1 3300050510 Bacteria 3336
317 nmdc:mga08y16_153790_c1 3300050511 Bacteria 2391
318 nmdc:mga08y16_192281_c1 3300050511 Bacteria 2116
319 nmdc:mga08x19_33097_c1 3300050514 Bacteria 3261
320 nmdc:mga0sz30_23899_c1 3300050516 Bacteria 2491
321 nmdc:mga0sz30_7251_c1 3300050516 Bacteria 4154
322 Ga0495619_0072451 3300053085 Bacteria 2307
323 Ga0500652_030572 3300053131 Bacteria 2107
324 Ga0500559_0023216 3300053136 Bacteria 2633
325 Ga0500645_000055 3300053730 Bacteria 92181
326 Ga0500645_036617 3300053730 Bacteria 1460
327 Ga0501084_0018544 3300054114 Bacteria 5792
328 2537900390 2537561592 Bacteria 4348607
329 2738708541 2738541274 Bacteria 6909446
330 2739334980 2738543028 Bacteria 6917070
331 2852649430 2852646457 Bacteria 3408613
332 2862184232 2862178590 Bacteria 8583590
333 2867481346 2867475112 Bacteria 6909112
334 2895434358 2895427314 Bacteria 13147766
335 2902802224 2902799365 Bacteria 5419524
336 2917743412 2917736166 Bacteria 9690793
337 2917744660 2917736166 Bacteria 9690793
338 2919391860 2919391150 Bacteria 4884741
339 2919719843 2919713450 Bacteria 7431245
340 2920879997 2920879853 Bacteria 4216831
341 2929219402 2929212328 Bacteria 7708288
342 2945957044 2945956166 Bacteria 5110334
343 2946035424 2946033335 Bacteria 3835514
344 2946060077 2946059875 Bacteria 4386623
345 2946082723 2946080515 Bacteria 4310960
346 2974295383 2974294766 Bacteria 3767688
347 2974324814 2974324384 Bacteria 3750535
348 8025482463 8025478263 Bacteria 8209203
349 8054164272 8054160619 Bacteria 7783213
350 8056065294 8056060235 Bacteria 7259403
351 8056672050 8056667051 Bacteria 6953971
352 Ga0501032_0003287
353 LJQas_1000922
354 JGI25152J39213_1001193
355 JGI25160J50197_1006844
356 Ga0065714_10084548
357 Ga0070683_100007206
358 Ga0068869_100077600
359 Ga0070666_10001964
360 Ga0070666_10058193
361 Ga0070666_10097735
362 Ga0070682_100019825
363 Ga0068868_100021443
364 Ga0068868_100078789
365 Ga0070689_100057050
366 Ga0070668_100007768
367 Ga0070668_100026917
368 Ga0070668_100087866
369 Ga0070668_100092456
370 Ga0070659_100037689
371 Ga0070659_100168022
372 Ga0070659_100234879
373 Ga0070667_100004728
374 Ga0070667_100064299
375 Ga0070709_10015462
376 Ga0070714_100002102
377 Ga0070714_100007490
378 Ga0070714_100038593
379 Ga0070710_10088015
380 Ga0070710_10133392
381 Ga0070711_100006031
382 Ga0070711_100037446
383 Ga0070700_100007486
384 Ga0070700_100156636
385 Ga0070678_100118736
386 Ga0070678_100168278
387 Ga0068867_100001731
388 Ga0070685_10022773
389 Ga0070685_10041499
390 Ga0070706_100001197
391 Ga0068853_100039145
392 Ga0068853_100173744
393 Ga0070672_100213407
394 Ga0070695_100021598
395 Ga0070695_100146374
396 Ga0070693_100055870
397 Ga0070665_100000137
398 Ga0070665_100022107
399 Ga0070665_100083366
400 Ga0070704_100000886
401 Ga0068855_100002492
402 Ga0068854_100048220
403 Ga0068856_100005684
404 Ga0068866_10000844
405 Ga0068861_100028159
406 Ga0068863_100006453
407 Ga0068858_100105616
408 Ga0068860_100009685
409 Ga0068862_100021725
410 Ga0081455_10004855
411 Ga0081455_10029502
412 Ga0081455_10034160
413 Ga0081455_10067238
414 Ga0070717_10018143
415 Ga0075365_10017771
416 Ga0075363_100006824
417 Ga0075364_10014930
418 Ga0075432_10033292
419 Ga0070716_100024412
420 Ga0070712_100008363
421 Ga0070712_100104784
422 Ga0097621_100093475
423 Ga0075431_100020408
424 Ga0075434_100072294
425 Ga0075429_100285720
426 Ga0068865_100015011
427 Ga0068865_100025367
428 Ga0068865_100084416
429 Ga0105251_10041520
430 Ga0105240_10054459
431 Ga0105240_10085272
432 Ga0111539_10024117
433 Ga0111539_10152556
434 Ga0111539_10229017
435 Ga0105245_10001126
436 Ga0105247_10000094
437 Ga0105247_10013750
438 Ga0105243_10003000
439 Ga0105242_10199604
440 Ga0105248_10023984
441 Ga0105248_10032542
442 Ga0105237_10217108
443 Ga0105238_10051348
444 Ga0105238_10106509
445 Ga0105249_10009623
446 Ga0105246_10024904
447 Ga0157371_10094569
448 Ga0157369_10062806
449 Ga0157378_10003396
450 Ga0163162_10210211
451 Ga0157372_10100364
452 Ga0157372_10189058
453 Ga0157375_10048444
454 Ga0157380_10078540
455 Ga0182008_10041605
456 Ga0157379_10001866
457 Ga0157379_10021091
458 Ga0157379_10176588
459 Ga0157376_10085082
460 Ga0157376_10134485
461 Ga0213872_10000239
462 Ga0213876_10000795
463 Ga0213876_10021200
464 Ga0213876_10022522
465 Ga0213875_10020060
466 Ga0209148_1004078
467 Ga0209129_1000052
468 Ga0209025_1001043
469 Ga0207426_1000625
470 Ga0207426_1002131
471 Ga0209051_1013890
472 Ga0207697_10008811
473 Ga0207682_10003807
474 Ga0207692_10004545
475 Ga0207692_10044147
476 Ga0207710_10000119
477 Ga0207710_10078808
478 Ga0207688_10004649
479 Ga0207688_10034936
480 Ga0207680_10000837
481 Ga0207680_10063516
482 Ga0207685_10023165
483 Ga0207699_10169682
484 Ga0207645_10023752
485 Ga0207645_10034831
486 Ga0207684_10005097
487 Ga0207695_10002853
488 Ga0207695_10025397
489 Ga0207671_10238015
490 Ga0207693_10002096
491 Ga0207693_10060160
492 Ga0207663_10089734
493 Ga0207662_10036962
494 Ga0207681_10162869
495 Ga0207687_10005249
496 Ga0207700_10247575
497 Ga0207664_10036345
498 Ga0207664_10061927
499 Ga0207706_10012282
500 Ga0207704_10014204
501 Ga0207691_10058223
502 Ga0207711_10010465
503 Ga0207689_10052266
504 Ga0207661_10097076
505 Ga0207667_10001408
506 Ga0207712_10087253
507 Ga0207668_10092945
508 Ga0207668_10175397
509 Ga0207658_10021152
510 Ga0207677_10087485
511 Ga0207703_10213415
512 Ga0207639_10015169
513 Ga0207708_10004969
514 Ga0207708_10086698
515 Ga0207702_10045441
516 Ga0207641_10081715
517 Ga0207641_10338703
518 Ga0207648_10006698
519 Ga0207648_10064552
520 Ga0207676_10038354
521 Ga0207683_10092436
522 Ga0207683_10141440
523 Ga0268266_10086881
524 Ga0268265_10036882
525 Ga0268264_10104095
526 Ga0265337_1002501
527 Ga0265319_1013504
528 Ga0316181_1100278
529 Ga0265320_10001483
530 Ga0265331_10004294
531 Ga0265327_10000069
532 Ga0307513_10021495
533 Ga0307408_100021066
534 Ga0307408_100220453
535 Ga0265313_10000469
536 Ga0307405_10032897
537 Ga0307413_10156943
538 Ga0307518_10057853
539 Ga0307410_10134912
540 Ga0307507_10019620
541 Ga0307510_10017084
542 Ga0316584_0045222
543 Ga0395898_0197177
544 Ga0436364_0019204
545 Ga0436364_0897743
546 Ga0436364_1003317
547 Ga0395901_0199069
548 Ga0436365_0123721
549 Ga0436365_0928916
550 Ga0436365_1051189
551 Ga0436365_1296534
552 Ga0436361_0863641
553 Ga0436363_0097909
554 Ga0436363_0114223
555 Ga0466966_0134347
556 Ga0466961_0001979
557 Ga0466957_0006258
558 Ga0466959_0001681
559 Ga0466958_0002563
560 Ga0466967_0012846
561 Ga0466967_0036273
562 Ga0466967_0087793
563 Ga0466967_0127613
564 Ga0495629_0125983
565 Ga0495653_0001613
566 Ga0495580_0041011
567 Ga0495582_0079323
568 Ga0495662_0002270
569 Ga0495664_0004073
570 Ga0495642_0033948
571 Ga0495654_0102478
572 Ga0495665_0000402
573 Ga0495665_0034074
574 Ga0495586_0001126
575 Ga0495586_0003775
576 Ga0495587_0003592
577 Ga0495645_0000495
578 Ga0495667_0000098
579 Ga0495635_0166415
580 Ga0495659_0007297
581 Ga0495588_0003836
582 Ga0495588_0017268
583 Ga0495670_0004291
584 Ga0495671_0055974
585 Ga0495581_0099217
586 Ga0495581_0107888
587 Ga0495604_0062271
588 Ga0495636_0003754
589 Ga0495672_0016470
590 Ga0495680_0015578
591 Ga0495675_0008849
592 Ga0495681_0038174
593 Ga0496100_0000836
594 Ga0496100_0002912
595 Ga0496101_0000056
596 Ga0496101_0001135
597 Ga0496101_0195314
598 Ga0496102_0000177
599 Ga0496102_0008169
600 Ga0496102_0009865
601 Ga0496102_0011501
602 Ga0496103_0000003
603 Ga0496103_0006151
604 Ga0496103_0006434
605 Ga0496103_0052351
606 Ga0496104_0005253
607 Ga0496105_0045825
608 Ga0496105_0107657
609 Ga0496106_0005204
610 Ga0496106_0025658
611 Ga0496106_0027381
612 Ga0496107_0006291
613 Ga0496107_0035308
614 Ga0496107_0057452
615 Ga0496108_0093557
616 Ga0496108_0200105
617 Ga0496109_0000029
618 Ga0496109_0001405
619 Ga0496109_0150052
620 Ga0496110_0094704
621 Ga0496111_0103237
622 Ga0496111_0138573
623 Ga0496112_0056982
624 Ga0496112_0061222
625 Ga0496112_0097118
626 Ga0496113_0150474
627 Ga0496114_0026019
628 Ga0496115_0210662
629 Ga0496116_0000013
630 Ga0496117_0000013
631 Ga0496118_0000011
632 Ga0496118_0104010
633 Ga0496119_0000946
634 Ga0496119_0007186
635 Ga0496120_0000224
636 Ga0496121_0000060
637 Ga0496125_0113398
638 Ga0496126_0001987
639 Ga0496126_0005424
640 Ga0501032_0002021
641 Ga0501034_0000960
642 Ga0501034_0006815
643 Ga0501034_0041644
644 Ga0501036_0002271
645 Ga0501036_0050944
646 Ga0501037_0002160
647 Ga0501039_0000903
648 Ga0501043_0001683
649 Ga0501046_0007491
650 Ga0501047_0005226
651 Ga0501047_0115878
652 Ga0501047_0117395
653 Ga0501048_0001799
654 Ga0501067_0013088
655 Ga0501068_0090188
656 Ga0501069_0111777
657 Ga0501070_0007399
658 Ga0501070_0052794
659 Ga0501080_0064551
660 Ga0501035_0051345
661 Ga0501035_0283825
662 Ga0501044_0005851
663 Ga0501044_0006114
664 nmdc:mga00v17_17813_c1
665 nmdc:mga0yw44_10272_c1
666 nmdc:mga06r32_12530_c1
667 nmdc:mga06r32_72434_c1
668 nmdc:mga08y16_153790_c1
669 nmdc:mga08y16_192281_c1
670 nmdc:mga08x19_33097_c1
671 nmdc:mga0sz30_23899_c1
672 nmdc:mga0sz30_7251_c1
673 Ga0495619_0072451
674 Ga0500652_030572
675 Ga0500559_0023216
676 Ga0500645_000055
677 Ga0500645_036617
678 Ga0501084_0018544
679 2537900390
680 2738708541
681 2739334980
682 2852649430
683 2862184232
684 2867481346
685 2895434358
686 2902802224
687 2917743412
688 2917744660
689 2919391860
690 2919719843
691 2920879997
692 2929219402
693 2945957044
694 2946035424
695 2946060077
696 2946082723
697 2974295383
698 2974324814
699 8025482463
700 8054164272
701 8056065294
702 8056672050

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01494

FAD_binding_3

FAD binding domain

67

407

0.93

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

69

124

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c79-assembly1.cif.gz_B crystal structure of leishmania donovani 6-phosphogluconate dehydrogenase complexed with nadph 0.9244 6 34
6fqz-assembly1.cif.gz_B plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor nadp+ and in complex with its substrate 6-phosphogluconate 0.9069 6 36
6eod-assembly3.cif.gz_C structure of reductive aminase from aspergillus terreus in complex with nadph 0.9028 6 34
6eod-assembly2.cif.gz_B structure of reductive aminase from aspergillus terreus in complex with nadph 0.9017 6 34
6eod-assembly1.cif.gz_A structure of reductive aminase from aspergillus terreus in complex with nadph 0.8983 6 34
ID Description Score Start End Superfamily
af_O65936_274_405_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9877 232 362 3.50.50.60
af_O65936_274_405_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.973 232 362 3.50.50.60
af_O65936_46_234_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9614 1 185 3.50.50.60
af_O69721_5_180_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9489 6 38 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9392 7 34 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1I7AVI2-F1-model_v4 2-polyprenyl-6-methoxyphenol hydroxylase 0.9898 3 417 GO:0016491
GO:0071949
AF-A0A1I7AVI2-F1-model_v4 2-polyprenyl-6-methoxyphenol hydroxylase 0.9828 3 417 GO:0016491
GO:0071949
AF-A0A166KPL1-F1-model_v4 Monooxygenase 0.9633 21 406 GO:0004497
GO:0071949
AF-A0A166KPL1-F1-model_v4 Monooxygenase 0.9583 21 406 GO:0004497
GO:0071949
AF-A0A370I8C1-F1-model_v4 2-polyprenyl-6-methoxyphenol hydroxylase-like FAD-dependent oxidoreductase 0.9578 19 410 GO:0016491
GO:0071949

Map