F418989

General Info

Members Datasets Scaffolds Average Seq Length
352 214 704 240

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10008801|Ga0105240_1000880116
Length 243
Sequence MTSGITAKSLKDNDILSRIDWKTAAGELDLRGCVVLPGLLSPAVCRALAALYCEDSRFRSRVIMGRHGFGRGEYRYFAYPLPRVIAELRAKLYPHLASIANEWSRRLGGDERYPSTFDAFLARCHAAGQVKPTPLLLQYGPGDYNCLHQDLYGECVFPLQLTVLLSQPGDFTGGEFVLTEQRPRMQSRAEVVPLQQGDGVVFAVHHRPVRGTRGDYRVNLRHGVSRVRSGQRHTLGVIFHDAG

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
53 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
54 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
89 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
90 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
91 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
103 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
104 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
105 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
106 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
107 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
108 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
109 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
110 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
111 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
115 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
124 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
127 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
134 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
138 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
161 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
162 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
170 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
189 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
190 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
191 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
192 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
193 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
194 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
195 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
196 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
197 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
200 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
201 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
202 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
203 2643221638 Duganella sp. Root336D2 Isolate Unclassified
204 2643221645 Massilia sp. Root351 Isolate Unclassified
205 2643221664 Massilia sp. Root418 Isolate Unclassified
206 2738541280 Massilia sp. GV090 Isolate Unclassified
207 2738541300 Massilia sp. GV016 Isolate Unclassified
208 2738543018 Massilia sp. GV045 Isolate Unclassified
209 2738543030 Massilia sp. GV097 Isolate Unclassified
210 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
211 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
212 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
213 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
214 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.74
Metatranscriptomes 0
Isolates 4.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.85
Nodule 0.57
Rhizoplane 1.14
Rhizosphere 66.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10008801 3300009093 Bacteria 14379
2 ARCol0yngRDRAFT_1000600 3300000652 Bacteria 3878
3 JGI25158J39367_1001135 3300002739 Bacteria 4831
4 JGI25150J39212_1001108 3300002774 Bacteria 8120
5 JGI25159J45721_1025814 3300002987 Bacteria 1024
6 JGI25153J46596_10000746 3300003215 Bacteria 19890
7 JGI25153J46596_10010341 3300003215 Bacteria 4230
8 Ga0055526_1000197 3300003771 Bacteria 52057
9 Ga0055526_1002657 3300003771 Bacteria 11931
10 Ga0055526_1005375 3300003771 Bacteria 7378
11 Ga0055526_1028488 3300003771 Bacteria 1688
12 Ga0055537_1000151 3300003773 Bacteria 52057
13 Ga0055537_1001371 3300003773 Bacteria 9775
14 Ga0055537_1006423 3300003773 Bacteria 2986
15 Ga0055524_1000027 3300003775 Bacteria 213655
16 Ga0055524_1000133 3300003775 Bacteria 87720
17 Ga0055524_1000269 3300003775 Bacteria 52057
18 Ga0055524_1001535 3300003775 Bacteria 13057
19 Ga0055534_1000148 3300003784 Bacteria 52057
20 Ga0055534_1001531 3300003784 Bacteria 9027
21 Ga0055534_1005684 3300003784 Bacteria 3285
22 Ga0055528_1000192 3300003790 Bacteria 52057
23 Ga0055528_1030043 3300003790 Bacteria 1453
24 Ga0055530_10004683 3300003791 Bacteria 6937
25 Ga0055530_10013624 3300003791 Bacteria 2763
26 Ga0055530_10024028 3300003791 Bacteria 1739
27 Ga0055531_10004138 3300003794 Bacteria 8960
28 Ga0055531_10022358 3300003794 Bacteria 2412
29 Ga0055531_10022574 3300003794 Bacteria 2393
30 Ga0055543_1006906 3300004625 Bacteria 2685
31 Ga0055543_1023342 3300004625 Bacteria 1117
32 Ga0065165_1000187 3300005262 Bacteria 108694
33 Ga0065165_1001427 3300005262 Bacteria 25946
34 Ga0065165_1005369 3300005262 Bacteria 7252
35 Ga0070658_10002346 3300005327 Bacteria 15873
36 Ga0070673_100271462 3300005364 Bacteria 1485
37 Ga0070688_100310720 3300005365 Bacteria 1142
38 Ga0070662_100231880 3300005457 Bacteria 1477
39 Ga0068867_100526545 3300005459 Bacteria 1020
40 Ga0070706_100049434 3300005467 Bacteria 3881
41 Ga0070707_100006940 3300005468 Bacteria 10499
42 Ga0070707_100041113 3300005468 Bacteria 4424
43 Ga0070707_100042978 3300005468 Bacteria 4326
44 Ga0070698_100050367 3300005471 Bacteria 4247
45 Ga0070698_100238029 3300005471 Bacteria 1754
46 Ga0070698_100493188 3300005471 Bacteria 1162
47 Ga0070698_100570348 3300005471 Bacteria 1071
48 Ga0070699_100099354 3300005518 Bacteria 2550
49 Ga0070679_100269998 3300005530 Bacteria 1655
50 Ga0068856_100655691 3300005614 Bacteria 1070
51 Ga0068856_100667422 3300005614 Bacteria 1060
52 Ga0068852_100174130 3300005616 Bacteria 2019
53 Ga0068860_100328274 3300005843 Bacteria 1502
54 Ga0081455_10095831 3300005937 Bacteria 2394
55 Ga0075365_10119647 3300006038 Bacteria 1816
56 Ga0075362_10131900 3300006177 Bacteria 1189
57 Ga0075367_10013314 3300006178 Bacteria 4417
58 Ga0075366_10004994 3300006195 Bacteria 7158
59 Ga0075428_100414959 3300006844 Bacteria 1442
60 Ga0075428_100561675 3300006844 Bacteria 1220
61 Ga0075430_100046956 3300006846 Bacteria 3646
62 Ga0075431_100014422 3300006847 Bacteria 7994
63 Ga0075431_100187452 3300006847 Bacteria 2121
64 Ga0075433_10001207 3300006852 Bacteria 18832
65 Ga0075433_10138809 3300006852 Bacteria 2161
66 Ga0075434_100000021 3300006871 Bacteria 71555
67 Ga0075434_100206334 3300006871 Bacteria 1986
68 Ga0075429_100609933 3300006880 Bacteria 956
69 Ga0099826_10000003 3300006948 Bacteria 1067817
70 Ga0075435_100015275 3300007076 Bacteria 5768
71 Ga0105240_10011294 3300009093 Bacteria 12445
72 Ga0111539_10036332 3300009094 Bacteria 5958
73 Ga0114129_10027901 3300009147 Bacteria 7995
74 Ga0114129_10089136 3300009147 Bacteria 4276
75 Ga0114129_10147488 3300009147 Bacteria 3222
76 Ga0157370_10072421 3300013104 Bacteria 3251
77 Ga0157369_10012024 3300013105 Bacteria 9831
78 Ga0157375_10500305 3300013308 Bacteria 1379
79 Ga0157380_10103002 3300014326 Bacteria 2381
80 Ga0157380_10119489 3300014326 Bacteria 2230
81 Ga0157380_10790129 3300014326 Bacteria 965
82 Ga0182007_10102610 3300015262 Bacteria 948
83 Ga0163161_10061450 3300017792 Bacteria 2735
84 Ga0213876_10000441 3300021384 Bacteria 33761
85 Ga0209436_110533 3300025208 Bacteria 1685
86 Ga0207425_1000062 3300025245 Bacteria 136118
87 Ga0207425_1006950 3300025245 Bacteria 3046
88 Ga0209129_1006987 3300025258 Bacteria 3478
89 Ga0209565_1000002 3300025263 Bacteria 1423083
90 Ga0209565_1000007 3300025263 Bacteria 784361
91 Ga0209565_1007221 3300025263 Bacteria 3020
92 Ga0209565_1011572 3300025263 Bacteria 2140
93 Ga0209673_1000002 3300025273 Bacteria 1423083
94 Ga0209673_1006546 3300025273 Bacteria 5591
95 Ga0209673_1028823 3300025273 Bacteria 1780
96 Ga0209130_1000261 3300025284 Bacteria 66000
97 Ga0209675_1000002 3300025291 Bacteria 1423083
98 Ga0209675_1000342 3300025291 Bacteria 40665
99 Ga0209675_1001706 3300025291 Bacteria 12140
100 Ga0209675_1017726 3300025291 Bacteria 2023
101 Ga0209675_1017894 3300025291 Bacteria 2004
102 Ga0209564_1000004 3300025295 Bacteria 1424639
103 Ga0209564_1000087 3300025295 Bacteria 250787
104 Ga0209564_1005606 3300025295 Bacteria 7071
105 Ga0209564_1014504 3300025295 Bacteria 3273
106 Ga0209564_1017289 3300025295 Bacteria 2820
107 Ga0209758_1000294 3300025297 Bacteria 98618
108 Ga0209758_1003873 3300025297 Bacteria 13105
109 Ga0209050_1000064 3300025298 Bacteria 314803
110 Ga0209050_1000131 3300025298 Bacteria 186028
111 Ga0209050_1005612 3300025298 Bacteria 7785
112 Ga0209050_1006898 3300025298 Bacteria 6574
113 Ga0209256_1000004 3300025299 Bacteria 1424643
114 Ga0209256_1000008 3300025299 Bacteria 975723
115 Ga0209256_1000013 3300025299 Bacteria 689442
116 Ga0209256_1000581 3300025299 Bacteria 51616
117 Ga0209256_1002215 3300025299 Bacteria 16612
118 Ga0207426_1002154 3300025302 Bacteria 13391
119 Ga0209051_1000354 3300025303 Bacteria 68119
120 Ga0209257_1000010 3300025304 Bacteria 1158682
121 Ga0209257_1000028 3300025304 Bacteria 699493
122 Ga0209257_1003003 3300025304 Bacteria 15298
123 Ga0207645_10222868 3300025907 Bacteria 1243
124 Ga0207645_10230561 3300025907 Bacteria 1222
125 Ga0207705_10000910 3300025909 Bacteria 24222
126 Ga0207684_10003976 3300025910 Bacteria 14148
127 Ga0207707_10360815 3300025912 Bacteria 1251
128 Ga0207662_10182170 3300025918 Bacteria 1352
129 Ga0207652_10364133 3300025921 Bacteria 1305
130 Ga0207646_10003673 3300025922 Bacteria 17136
131 Ga0207694_10219500 3300025924 Bacteria 1550
132 Ga0207659_10000738 3300025926 Bacteria 19350
133 Ga0207659_10206040 3300025926 Bacteria 1573
134 Ga0207700_10573637 3300025928 Bacteria 1003
135 Ga0207704_10600834 3300025938 Bacteria 901
136 Ga0207711_10025991 3300025941 Bacteria 4911
137 Ga0207661_10517582 3300025944 Bacteria 1091
138 Ga0207677_10239401 3300026023 Bacteria 1467
139 Ga0207702_10046652 3300026078 Bacteria 3648
140 Ga0207702_10392645 3300026078 Bacteria 1336
141 Ga0207648_10520387 3300026089 Bacteria 1090
142 Ga0207674_10047479 3300026116 Bacteria 4400
143 Ga0207683_10149409 3300026121 Bacteria 2108
144 Ga0209282_1000002 3300027666 Bacteria 1067825
145 Ga0207428_10000306 3300027907 Bacteria 65012
146 Ga0307408_100002046 3300031548 Bacteria 14512
147 Ga0307408_100007281 3300031548 Bacteria 7320
148 Ga0307408_100022513 3300031548 Bacteria 4283
149 Ga0307516_10035864 3300031730 Bacteria 4970
150 Ga0307516_10208488 3300031730 Bacteria 1670
151 Ga0307405_10197011 3300031731 Bacteria 1460
152 Ga0373940_0026682 3300035088 Bacteria 1513
153 Ga0373949_0000340 3300035090 Bacteria 16571
154 Ga0373941_0067700 3300035115 Bacteria 1178
155 Ga0373961_0036711 3300035241 Bacteria 1397
156 Ga0373935_0077682 3300035692 Bacteria 2152
157 Ga0373933_0124930 3300035724 Bacteria 1614
158 Ga0373925_0030973 3300037068 Bacteria 3929
159 Ga0395898_0360164 3300037466 Bacteria 1387
160 Ga0395905_0506851 3300037471 Bacteria 1107
161 Ga0436364_1205439 3300037853 Bacteria 3227
162 Ga0395901_0000039 3300038443 Bacteria 206143
163 Ga0395901_0048091 3300038443 Bacteria 4430
164 Ga0436365_0811302 3300039437 Bacteria 1211
165 Ga0436365_1797404 3300039437 Bacteria 129057
166 Ga0436363_0702030 3300039450 Bacteria 1704
167 Ga0436362_0388180 3300039453 Bacteria 6824
168 Ga0436362_1121876 3300039453 Bacteria 1840
169 Ga0439465_0006609 3300041413 Bacteria 3683
170 Ga0439432_045407 3300042006 Bacteria 1382
171 Ga0439449_0043669 3300042007 Bacteria 1664
172 Ga0439452_026256 3300042010 Bacteria 1471
173 Ga0439457_003946 3300042014 Bacteria 3957
174 Ga0439462_0007571 3300042015 Bacteria 2721
175 Ga0450894_009404 3300042131 Bacteria 1268
176 Ga0450909_011829 3300042185 Bacteria 1278
177 Ga0439434_0010318 3300042435 Bacteria 2754
178 Ga0466981_0184680 3300044669 Bacteria 1404
179 Ga0466970_0008012 3300044765 Bacteria 5304
180 Ga0451576_0251707 3300045051 Bacteria 1846
181 Ga0495617_000769 3300046452 Bacteria 15687
182 Ga0495617_053065 3300046452 Bacteria 1346
183 Ga0495617_065223 3300046452 Bacteria 1201
184 Ga0495617_069231 3300046452 Bacteria 1161
185 Ga0495590_0001534 3300046457 Bacteria 9937
186 Ga0495629_0034039 3300046459 Bacteria 3602
187 Ga0495629_0052511 3300046459 Bacteria 2852
188 Ga0495638_0000012 3300046460 Bacteria 435577
189 Ga0495638_0010058 3300046460 Bacteria 6594
190 Ga0495638_0020188 3300046460 Bacteria 4402
191 Ga0495638_0317992 3300046460 Bacteria 833
192 Ga0495651_0441840 3300046462 Bacteria 842
193 Ga0495580_0006349 3300046472 Bacteria 9643
194 Ga0495605_0006553 3300046474 Bacteria 6679
195 Ga0495605_0177469 3300046474 Bacteria 938
196 Ga0495584_0001320 3300046491 Bacteria 15063
197 Ga0495584_0002129 3300046491 Bacteria 11336
198 Ga0495584_0007180 3300046491 Bacteria 5818
199 Ga0495584_0165644 3300046491 Bacteria 1123
200 Ga0495585_0008320 3300046492 Bacteria 6292
201 Ga0495585_0048705 3300046492 Bacteria 2355
202 Ga0495585_0081366 3300046492 Bacteria 1754
203 Ga0495585_0124148 3300046492 Bacteria 1363
204 Ga0495607_0040637 3300046501 Bacteria 2768
205 Ga0495583_0000004 3300046506 Bacteria 655287
206 Ga0495583_0000110 3300046506 Bacteria 138380
207 Ga0495583_0000193 3300046506 Bacteria 101909
208 Ga0495606_0003353 3300046507 Bacteria 17077
209 Ga0495606_0024568 3300046507 Bacteria 4338
210 Ga0495606_0065125 3300046507 Bacteria 2316
211 Ga0495610_0012277 3300046512 Bacteria 5170
212 Ga0495616_0023233 3300046513 Bacteria 3337
213 Ga0495616_0060221 3300046513 Bacteria 1865
214 Ga0495620_0088449 3300046515 Bacteria 1245
215 Ga0495630_0493666 3300046517 Bacteria 939
216 Ga0495632_0000612 3300046519 Bacteria 32954
217 Ga0495644_0005113 3300046523 Bacteria 5135
218 Ga0495648_0000038 3300046524 Bacteria 191612
219 Ga0495648_0009118 3300046524 Bacteria 7737
220 Ga0495642_0215363 3300046528 Bacteria 838
221 Ga0495654_0067099 3300046530 Bacteria 1709
222 Ga0495587_0057489 3300046536 Bacteria 2286
223 Ga0495609_0006336 3300046538 Bacteria 6047
224 Ga0495609_0006913 3300046538 Bacteria 5727
225 Ga0495609_0014366 3300046538 Bacteria 3723
226 Ga0495609_0074494 3300046538 Bacteria 1488
227 Ga0495609_0086819 3300046538 Bacteria 1363
228 Ga0495621_0007140 3300046539 Bacteria 3295
229 Ga0495597_0004311 3300046542 Bacteria 7862
230 Ga0495597_0024165 3300046542 Bacteria 2806
231 Ga0495633_0005119 3300046558 Bacteria 8133
232 Ga0495633_0013093 3300046558 Bacteria 4385
233 Ga0495633_0013422 3300046558 Bacteria 4318
234 Ga0495633_0088111 3300046558 Bacteria 1443
235 Ga0495656_0227630 3300046615 Bacteria 934
236 Ga0495668_0012146 3300046616 Bacteria 5120
237 Ga0495611_0003811 3300046648 Bacteria 6577
238 Ga0495611_0076764 3300046648 Bacteria 1531
239 Ga0495625_0005984 3300046660 Bacteria 10931
240 Ga0495625_0045728 3300046660 Bacteria 3162
241 Ga0495625_0279991 3300046660 Bacteria 1073
242 Ga0495659_0000029 3300046664 Bacteria 66600
243 Ga0495659_0001149 3300046664 Bacteria 9188
244 Ga0495659_0017406 3300046664 Bacteria 2381
245 Ga0495659_0035448 3300046664 Bacteria 1759
246 Ga0495661_0061283 3300046665 Bacteria 2233
247 Ga0495588_0175174 3300046674 Bacteria 1134
248 Ga0495669_0108952 3300046684 Bacteria 1292
249 Ga0495670_0000016 3300046691 Bacteria 128045
250 Ga0495670_0005895 3300046691 Bacteria 6002
251 Ga0495670_0007250 3300046691 Bacteria 5453
252 Ga0495670_0018510 3300046691 Bacteria 3428
253 Ga0495670_0150520 3300046691 Bacteria 1220
254 Ga0495671_0000034 3300046692 Bacteria 195385
255 Ga0495671_0000211 3300046692 Bacteria 51024
256 Ga0495671_0125500 3300046692 Bacteria 1251
257 Ga0495649_0137625 3300046694 Bacteria 1286
258 Ga0495649_0303414 3300046694 Bacteria 812
259 Ga0495660_0022123 3300046810 Bacteria 3633
260 Ga0495660_0037923 3300046810 Bacteria 2683
261 Ga0495604_0369555 3300047317 Bacteria 949
262 Ga0495636_0001354 3300047318 Bacteria 9306
263 Ga0495636_0001767 3300047318 Bacteria 8241
264 Ga0495636_0027220 3300047318 Bacteria 2329
265 Ga0495674_0008551 3300047319 Bacteria 9741
266 Ga0495674_0145767 3300047319 Bacteria 1988
267 Ga0495672_0000035 3300047320 Bacteria 290329
268 Ga0495672_0024016 3300047320 Bacteria 3934
269 Ga0495672_0024618 3300047320 Bacteria 3873
270 Ga0495672_0025289 3300047320 Bacteria 3804
271 Ga0495676_0069616 3300047321 Bacteria 2714
272 Ga0495687_001367 3300047443 Bacteria 22540
273 Ga0495687_143766 3300047443 Bacteria 825
274 Ga0495687_143771 3300047443 Bacteria 825
275 Ga0495675_0029653 3300047444 Bacteria 3490
276 Ga0495677_0002536 3300047445 Bacteria 7137
277 Ga0495677_0041708 3300047445 Bacteria 1679
278 Ga0495679_024347 3300047446 Bacteria 2040
279 Ga0495685_000041 3300047447 Bacteria 52191
280 Ga0495685_111211 3300047447 Bacteria 901
281 Ga0495673_0000013 3300047469 Bacteria 612902
282 Ga0495673_0006340 3300047469 Bacteria 6967
283 Ga0495686_0023861 3300047472 Bacteria 4025
284 Ga0495686_0025316 3300047472 Bacteria 3891
285 Ga0495593_0016036 3300047673 Bacteria 4229
286 Ga0496104_0084921 3300048907 Bacteria 3021
287 Ga0496105_0109256 3300048908 Bacteria 2283
288 Ga0496115_0022689 3300048918 Bacteria 4866
289 Ga0496124_0220692 3300048927 Bacteria 1426
290 Ga0496124_0369202 3300048927 Bacteria 1008
291 Ga0495678_001986 3300049459 Bacteria 14727
292 Ga0495682_0000197 3300049460 Bacteria 48575
293 Ga0495682_0001082 3300049460 Bacteria 15989
294 Ga0495682_0045856 3300049460 Bacteria 1596
295 Ga0501047_0332493 3300049581 Bacteria 1358
296 Ga0501075_0198754 3300049591 Bacteria 1529
297 Ga0501076_0051832 3300049592 Bacteria 3249
298 Ga0501238_006390 3300049671 Bacteria 1517
299 Ga0501080_0129275 3300049742 Bacteria 2338
300 Ga0501081_0250132 3300049743 Bacteria 1294
301 nmdc:mga0k408_8406_c1 3300050493 Bacteria 4896
302 nmdc:mga04h51_17728_c1 3300050495 Bacteria 2088
303 nmdc:mga07m45_186572_c1 3300050496 Bacteria 1206
304 nmdc:mga05p37_198914_c1 3300050507 Bacteria 2428
305 nmdc:mga05p37_47198_c1 3300050507 Bacteria 5296
306 nmdc:mga05p37_8441_c1 3300050507 Bacteria 12184
307 nmdc:mga09592_28581_c1 3300050508 Bacteria 4633
308 nmdc:mga09592_288985_c1 3300050508 Bacteria 1422
309 nmdc:mga09592_564721_c1 3300050508 Bacteria 977
310 nmdc:mga0qj67_122404_c1 3300050509 Bacteria 2105
311 nmdc:mga06r32_40404_c1 3300050510 Bacteria 4428
312 nmdc:mga06r32_86979_c1 3300050510 Bacteria 3049
313 nmdc:mga08y16_10199_c1 3300050511 Bacteria 9868
314 nmdc:mga0n895_128203_c1 3300050512 Bacteria 2562
315 nmdc:mga0n895_399315_c1 3300050512 Bacteria 1390
316 nmdc:mga0rr50_110437_c1 3300050513 Bacteria 2175
317 nmdc:mga0rr50_3154_c1 3300050513 Bacteria 9422
318 nmdc:mga0a205_18395_c1 3300050515 Bacteria 4962
319 nmdc:mga0a205_19858_c1 3300050515 Bacteria 6339
320 nmdc:mga0a205_22438_c1 3300050515 Bacteria 5979
321 nmdc:mga0a205_6783_c1 3300050515 Bacteria 10357
322 nmdc:mga0sz30_1727_c2 3300050516 Bacteria 6750
323 Ga0500635_0000646 3300053080 Bacteria 8946
324 Ga0500644_0014996 3300053088 Bacteria 2199
325 Ga0500647_0070458 3300053091 Bacteria 1681
326 Ga0500647_0070676 3300053091 Bacteria 1678
327 Ga0500641_0024445 3300053096 Bacteria 2330
328 Ga0500562_035357 3300053108 Bacteria 1323
329 Ga0500652_020092 3300053131 Bacteria 2493
330 Ga0500559_0025880 3300053136 Bacteria 2498
331 Ga0500559_0061716 3300053136 Bacteria 1672
332 Ga0500604_0020627 3300053151 Bacteria 1857
333 Ga0500622_0007422 3300053156 Bacteria 6228
334 Ga0500622_0033498 3300053156 Bacteria 2693
335 Ga0500622_0165859 3300053156 Bacteria 1032
336 Ga0501084_0163137 3300054114 Bacteria 1880
337 Ga0530510_0007715 3300061734 Bacteria 7495
338 2585152394 2582581280 Bacteria 5994497
339 2585199012 2582581293 Bacteria 5907401
340 2644127609 2643221622 Bacteria 4212502
341 2644214836 2643221638 Bacteria 6579467
342 2644249497 2643221645 Bacteria 7207331
343 2644359597 2643221664 Bacteria 7272945
344 2738740912 2738541280 Bacteria 6630198
345 2738845233 2738541300 Bacteria 6675882
346 2739274828 2738543018 Bacteria 6718814
347 2739343872 2738543030 Bacteria 6719714
348 2770195331 2767802442 Bacteria 5747986
349 2776270721 2775506902 Bacteria 6208009
350 2776280456 2775506904 Bacteria 5954060
351 2840767520 2840764183 Bacteria 6358399
352 2946009651 2946006987 Bacteria 6705746
353 Ga0105240_10008801
354 ARCol0yngRDRAFT_1000600
355 JGI25158J39367_1001135
356 JGI25150J39212_1001108
357 JGI25159J45721_1025814
358 JGI25153J46596_10000746
359 JGI25153J46596_10010341
360 Ga0055526_1000197
361 Ga0055526_1002657
362 Ga0055526_1005375
363 Ga0055526_1028488
364 Ga0055537_1000151
365 Ga0055537_1001371
366 Ga0055537_1006423
367 Ga0055524_1000027
368 Ga0055524_1000133
369 Ga0055524_1000269
370 Ga0055524_1001535
371 Ga0055534_1000148
372 Ga0055534_1001531
373 Ga0055534_1005684
374 Ga0055528_1000192
375 Ga0055528_1030043
376 Ga0055530_10004683
377 Ga0055530_10013624
378 Ga0055530_10024028
379 Ga0055531_10004138
380 Ga0055531_10022358
381 Ga0055531_10022574
382 Ga0055543_1006906
383 Ga0055543_1023342
384 Ga0065165_1000187
385 Ga0065165_1001427
386 Ga0065165_1005369
387 Ga0070658_10002346
388 Ga0070673_100271462
389 Ga0070688_100310720
390 Ga0070662_100231880
391 Ga0068867_100526545
392 Ga0070706_100049434
393 Ga0070707_100006940
394 Ga0070707_100041113
395 Ga0070707_100042978
396 Ga0070698_100050367
397 Ga0070698_100238029
398 Ga0070698_100493188
399 Ga0070698_100570348
400 Ga0070699_100099354
401 Ga0070679_100269998
402 Ga0068856_100655691
403 Ga0068856_100667422
404 Ga0068852_100174130
405 Ga0068860_100328274
406 Ga0081455_10095831
407 Ga0075365_10119647
408 Ga0075362_10131900
409 Ga0075367_10013314
410 Ga0075366_10004994
411 Ga0075428_100414959
412 Ga0075428_100561675
413 Ga0075430_100046956
414 Ga0075431_100014422
415 Ga0075431_100187452
416 Ga0075433_10001207
417 Ga0075433_10138809
418 Ga0075434_100000021
419 Ga0075434_100206334
420 Ga0075429_100609933
421 Ga0099826_10000003
422 Ga0075435_100015275
423 Ga0105240_10011294
424 Ga0111539_10036332
425 Ga0114129_10027901
426 Ga0114129_10089136
427 Ga0114129_10147488
428 Ga0157370_10072421
429 Ga0157369_10012024
430 Ga0157375_10500305
431 Ga0157380_10103002
432 Ga0157380_10119489
433 Ga0157380_10790129
434 Ga0182007_10102610
435 Ga0163161_10061450
436 Ga0213876_10000441
437 Ga0209436_110533
438 Ga0207425_1000062
439 Ga0207425_1006950
440 Ga0209129_1006987
441 Ga0209565_1000002
442 Ga0209565_1000007
443 Ga0209565_1007221
444 Ga0209565_1011572
445 Ga0209673_1000002
446 Ga0209673_1006546
447 Ga0209673_1028823
448 Ga0209130_1000261
449 Ga0209675_1000002
450 Ga0209675_1000342
451 Ga0209675_1001706
452 Ga0209675_1017726
453 Ga0209675_1017894
454 Ga0209564_1000004
455 Ga0209564_1000087
456 Ga0209564_1005606
457 Ga0209564_1014504
458 Ga0209564_1017289
459 Ga0209758_1000294
460 Ga0209758_1003873
461 Ga0209050_1000064
462 Ga0209050_1000131
463 Ga0209050_1005612
464 Ga0209050_1006898
465 Ga0209256_1000004
466 Ga0209256_1000008
467 Ga0209256_1000013
468 Ga0209256_1000581
469 Ga0209256_1002215
470 Ga0207426_1002154
471 Ga0209051_1000354
472 Ga0209257_1000010
473 Ga0209257_1000028
474 Ga0209257_1003003
475 Ga0207645_10222868
476 Ga0207645_10230561
477 Ga0207705_10000910
478 Ga0207684_10003976
479 Ga0207707_10360815
480 Ga0207662_10182170
481 Ga0207652_10364133
482 Ga0207646_10003673
483 Ga0207694_10219500
484 Ga0207659_10000738
485 Ga0207659_10206040
486 Ga0207700_10573637
487 Ga0207704_10600834
488 Ga0207711_10025991
489 Ga0207661_10517582
490 Ga0207677_10239401
491 Ga0207702_10046652
492 Ga0207702_10392645
493 Ga0207648_10520387
494 Ga0207674_10047479
495 Ga0207683_10149409
496 Ga0209282_1000002
497 Ga0207428_10000306
498 Ga0307408_100002046
499 Ga0307408_100007281
500 Ga0307408_100022513
501 Ga0307516_10035864
502 Ga0307516_10208488
503 Ga0307405_10197011
504 Ga0373940_0026682
505 Ga0373949_0000340
506 Ga0373941_0067700
507 Ga0373961_0036711
508 Ga0373935_0077682
509 Ga0373933_0124930
510 Ga0373925_0030973
511 Ga0395898_0360164
512 Ga0395905_0506851
513 Ga0436364_1205439
514 Ga0395901_0000039
515 Ga0395901_0048091
516 Ga0436365_0811302
517 Ga0436365_1797404
518 Ga0436363_0702030
519 Ga0436362_0388180
520 Ga0436362_1121876
521 Ga0439465_0006609
522 Ga0439432_045407
523 Ga0439449_0043669
524 Ga0439452_026256
525 Ga0439457_003946
526 Ga0439462_0007571
527 Ga0450894_009404
528 Ga0450909_011829
529 Ga0439434_0010318
530 Ga0466981_0184680
531 Ga0466970_0008012
532 Ga0451576_0251707
533 Ga0495617_000769
534 Ga0495617_053065
535 Ga0495617_065223
536 Ga0495617_069231
537 Ga0495590_0001534
538 Ga0495629_0034039
539 Ga0495629_0052511
540 Ga0495638_0000012
541 Ga0495638_0010058
542 Ga0495638_0020188
543 Ga0495638_0317992
544 Ga0495651_0441840
545 Ga0495580_0006349
546 Ga0495605_0006553
547 Ga0495605_0177469
548 Ga0495584_0001320
549 Ga0495584_0002129
550 Ga0495584_0007180
551 Ga0495584_0165644
552 Ga0495585_0008320
553 Ga0495585_0048705
554 Ga0495585_0081366
555 Ga0495585_0124148
556 Ga0495607_0040637
557 Ga0495583_0000004
558 Ga0495583_0000110
559 Ga0495583_0000193
560 Ga0495606_0003353
561 Ga0495606_0024568
562 Ga0495606_0065125
563 Ga0495610_0012277
564 Ga0495616_0023233
565 Ga0495616_0060221
566 Ga0495620_0088449
567 Ga0495630_0493666
568 Ga0495632_0000612
569 Ga0495644_0005113
570 Ga0495648_0000038
571 Ga0495648_0009118
572 Ga0495642_0215363
573 Ga0495654_0067099
574 Ga0495587_0057489
575 Ga0495609_0006336
576 Ga0495609_0006913
577 Ga0495609_0014366
578 Ga0495609_0074494
579 Ga0495609_0086819
580 Ga0495621_0007140
581 Ga0495597_0004311
582 Ga0495597_0024165
583 Ga0495633_0005119
584 Ga0495633_0013093
585 Ga0495633_0013422
586 Ga0495633_0088111
587 Ga0495656_0227630
588 Ga0495668_0012146
589 Ga0495611_0003811
590 Ga0495611_0076764
591 Ga0495625_0005984
592 Ga0495625_0045728
593 Ga0495625_0279991
594 Ga0495659_0000029
595 Ga0495659_0001149
596 Ga0495659_0017406
597 Ga0495659_0035448
598 Ga0495661_0061283
599 Ga0495588_0175174
600 Ga0495669_0108952
601 Ga0495670_0000016
602 Ga0495670_0005895
603 Ga0495670_0007250
604 Ga0495670_0018510
605 Ga0495670_0150520
606 Ga0495671_0000034
607 Ga0495671_0000211
608 Ga0495671_0125500
609 Ga0495649_0137625
610 Ga0495649_0303414
611 Ga0495660_0022123
612 Ga0495660_0037923
613 Ga0495604_0369555
614 Ga0495636_0001354
615 Ga0495636_0001767
616 Ga0495636_0027220
617 Ga0495674_0008551
618 Ga0495674_0145767
619 Ga0495672_0000035
620 Ga0495672_0024016
621 Ga0495672_0024618
622 Ga0495672_0025289
623 Ga0495676_0069616
624 Ga0495687_001367
625 Ga0495687_143766
626 Ga0495687_143771
627 Ga0495675_0029653
628 Ga0495677_0002536
629 Ga0495677_0041708
630 Ga0495679_024347
631 Ga0495685_000041
632 Ga0495685_111211
633 Ga0495673_0000013
634 Ga0495673_0006340
635 Ga0495686_0023861
636 Ga0495686_0025316
637 Ga0495593_0016036
638 Ga0496104_0084921
639 Ga0496105_0109256
640 Ga0496115_0022689
641 Ga0496124_0220692
642 Ga0496124_0369202
643 Ga0495678_001986
644 Ga0495682_0000197
645 Ga0495682_0001082
646 Ga0495682_0045856
647 Ga0501047_0332493
648 Ga0501075_0198754
649 Ga0501076_0051832
650 Ga0501238_006390
651 Ga0501080_0129275
652 Ga0501081_0250132
653 nmdc:mga0k408_8406_c1
654 nmdc:mga04h51_17728_c1
655 nmdc:mga07m45_186572_c1
656 nmdc:mga05p37_198914_c1
657 nmdc:mga05p37_47198_c1
658 nmdc:mga05p37_8441_c1
659 nmdc:mga09592_28581_c1
660 nmdc:mga09592_288985_c1
661 nmdc:mga09592_564721_c1
662 nmdc:mga0qj67_122404_c1
663 nmdc:mga06r32_40404_c1
664 nmdc:mga06r32_86979_c1
665 nmdc:mga08y16_10199_c1
666 nmdc:mga0n895_128203_c1
667 nmdc:mga0n895_399315_c1
668 nmdc:mga0rr50_110437_c1
669 nmdc:mga0rr50_3154_c1
670 nmdc:mga0a205_18395_c1
671 nmdc:mga0a205_19858_c1
672 nmdc:mga0a205_22438_c1
673 nmdc:mga0a205_6783_c1
674 nmdc:mga0sz30_1727_c2
675 Ga0500635_0000646
676 Ga0500644_0014996
677 Ga0500647_0070458
678 Ga0500647_0070676
679 Ga0500641_0024445
680 Ga0500562_035357
681 Ga0500652_020092
682 Ga0500559_0025880
683 Ga0500559_0061716
684 Ga0500604_0020627
685 Ga0500622_0007422
686 Ga0500622_0033498
687 Ga0500622_0165859
688 Ga0501084_0163137
689 Ga0530510_0007715
690 2585152394
691 2585199012
692 2644127609
693 2644214836
694 2644249497
695 2644359597
696 2738740912
697 2738845233
698 2739274828
699 2739343872
700 2770195331
701 2776270721
702 2776280456
703 2840767520
704 2946009651

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09859

Oxygenase-NA

Oxygenase, catalysing oxidative methylation of damaged DNA

72

242

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
3smh-assembly2.cif.gz_F crystal structure of major peanut allergen ara h 1 0.7438 120 223
6l9i-assembly1.cif.gz_A crystal structure of lactobacillus farciminis oxalate decarboxylase formate complex 0.7379 119 228
6orm-assembly1.cif.gz_A crystal structure of peruvianin-i (cysteine peptidase from thevetia peruviana latex) 0.7333 119 223
3smh-assembly1.cif.gz_D crystal structure of major peanut allergen ara h 1 0.7332 120 223
6zbo-assembly4.cif.gz_D hif prolyl hydroxylase 2 (phd2/egln1) in complex with 1-(6-morpholinopyrimidin-4-yl)-4-(1h-1,2,3-triazol-1-yl)-1h-pyrazol-5-ol (molidustat) 0.7217 11 225
ID Description Score Start End Superfamily
af_P9WLH7_61_232_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9614 63 229 2.60.120.590
af_P9WLH7_61_232_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9288 63 229 2.60.120.590
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7274 119 230 2.60.120.10
af_O86372_11_115_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7233 119 225 2.60.120.10
af_Q652P9_24_210_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7129 119 226 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A017TEZ0-F1-model_v4 Fe2OG dioxygenase domain-containing protein 1 5 230
AF-A0A2V2ANZ7-F1-model_v4 Fe2OG dioxygenase domain-containing protein 1 11 230
AF-A0A193GFQ4-F1-model_v4 Proline hydroxylase 1 6 230 GO:0016491
GO:0046872
AF-A0A0A7PC52-F1-model_v4 Fe2OG dioxygenase domain-containing protein 1 22 230 GO:0016491
GO:0046872
AF-A0A261UDX6-F1-model_v4 Proline hydroxylase 0.9999 5 230

Map