F419016

General Info

Members Datasets Scaffolds Average Seq Length
352 222 341 210

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10209438|Ga0157373_102094381
Length 243
Sequence MVASYKRSSFFLLAETKNRKQKYLSLYCNFILMLYLKKTPWILKKIFPERVWNIKTDGKILYLTFDDGPHPEATLFVLEELKKYNAKATFFCIGKNVKEHFPIYQRIIEEGHKPGNHTFHHLNGWKTGDKKYLNDISEAAKIIDSDLFRPPYGRITKFQSKAISGERLQLKTIMWDVLSGDFDASVTGENCYLNVVNNSEAGSIIVFHDSAKAFTVLQYALPRILKYYSEKGFQFQSLRKELF

Samples

Sample ID Description Type Environment
1 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
5 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
6 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
7 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
8 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
9 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
10 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
98 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
205 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
206 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
207 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
208 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
209 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
210 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
211 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
212 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
213 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
214 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
217 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
218 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
219 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
222 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.88
Metatranscriptomes 0
Isolates 3.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.36
Nodule 0
Rhizoplane 1.99
Rhizosphere 80.11
Stem 0
Stem Tuber 0
Unclassified 6.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10018924 3300001989 Bacteria 2470
2 JGI25154J39366_1000002 3300002738 Bacteria 466942
3 JGI25157J39369_1003470 3300002741 Bacteria 3204
4 JGI25406J46586_10019511 3300003203 Bacteria 2761
5 JGI25153J46596_10030539 3300003215 Bacteria 1831
6 rootH2_10076019 3300003320 Bacteria 7044
7 rootH2_10092063 3300003320 Bacteria 2881
8 rootL2_10337904 3300003322 Bacteria 1493
9 rootH1_10007323 3300003323 Bacteria 15190
10 rootH1_10086131 3300003323 Bacteria 4908
11 rootH1_10108487 3300003323 Bacteria 1815
12 Ga0055535_1006156 3300003761 Bacteria 2484
13 Ga0055542_1001676 3300003762 Bacteria 9824
14 Ga0055528_1000338 3300003790 Bacteria 39174
15 Ga0055530_10038760 3300003791 Bacteria 1182
16 Ga0055531_10024007 3300003794 Bacteria 2265
17 Ga0065165_1000100 3300005262 Bacteria 141963
18 Ga0065165_1004399 3300005262 Bacteria 8785
19 Ga0070658_10003542 3300005327 Bacteria 12813
20 Ga0070658_10243882 3300005327 Bacteria 1523
21 Ga0070658_10356007 3300005327 Bacteria 1253
22 Ga0070676_10014867 3300005328 Bacteria 4284
23 Ga0070676_10113286 3300005328 Bacteria 1692
24 Ga0070683_100054352 3300005329 Bacteria 3713
25 Ga0070670_100367468 3300005331 Bacteria 1266
26 Ga0070677_10355912 3300005333 Bacteria 760
27 Ga0068869_100046555 3300005334 Bacteria 3127
28 Ga0068869_100965087 3300005334 Bacteria 740
29 Ga0070666_10003892 3300005335 Bacteria 9069
30 Ga0070680_100000590 3300005336 Bacteria 25076
31 Ga0070680_100085411 3300005336 Bacteria 2608
32 Ga0070682_100007389 3300005337 Bacteria 6199
33 Ga0068868_100048550 3300005338 Bacteria 3329
34 Ga0068868_100173295 3300005338 Unclassified 1787
35 Ga0070660_100099579 3300005339 Bacteria 2302
36 Ga0070660_100364939 3300005339 Bacteria 1190
37 Ga0070691_10004283 3300005341 Bacteria 6479
38 Ga0070687_100011524 3300005343 Bacteria 3870
39 Ga0070668_100002414 3300005347 Bacteria 13757
40 Ga0070669_100227463 3300005353 Bacteria 1477
41 Ga0070671_100110593 3300005355 Bacteria 2308
42 Ga0070673_100000160 3300005364 Bacteria 32512
43 Ga0070688_100292238 3300005365 Bacteria 1175
44 Ga0070659_100057538 3300005366 Bacteria 3066
45 Ga0070659_100430599 3300005366 Bacteria 1117
46 Ga0070667_100000031 3300005367 Bacteria 177447
47 Ga0070663_100099356 3300005455 Bacteria 2169
48 Ga0070678_100101053 3300005456 Bacteria 2235
49 Ga0070662_100001909 3300005457 Bacteria 12799
50 Ga0070681_10061239 3300005458 Bacteria 3739
51 Ga0070681_10325113 3300005458 Bacteria 1448
52 Ga0068867_100037819 3300005459 Bacteria 3510
53 Ga0070679_100007518 3300005530 Bacteria 10191
54 Ga0070679_100010172 3300005530 Bacteria 8917
55 Ga0070679_100011558 3300005530 Bacteria 8414
56 Ga0070679_100277375 3300005530 Bacteria 1629
57 Ga0068853_100056085 3300005539 Bacteria 3396
58 Ga0068853_100087541 3300005539 Bacteria 2733
59 Ga0068853_100418993 3300005539 Bacteria 1255
60 Ga0070672_100600473 3300005543 Bacteria 958
61 Ga0070693_100021205 3300005547 Bacteria 3439
62 Ga0070665_100002650 3300005548 Bacteria 19467
63 Ga0068855_100001835 3300005563 Bacteria 26494
64 Ga0068855_100020524 3300005563 Bacteria 7922
65 Ga0068855_100022645 3300005563 Bacteria 7527
66 Ga0068855_100041367 3300005563 Bacteria 5462
67 Ga0068855_100664065 3300005563 Bacteria 1118
68 Ga0068855_100838619 3300005563 Bacteria 975
69 Ga0070664_100543387 3300005564 Bacteria 1074
70 Ga0070664_101134555 3300005564 Bacteria 737
71 Ga0068857_100384427 3300005577 Bacteria 1304
72 Ga0068856_100364601 3300005614 Bacteria 1463
73 Ga0068856_100448352 3300005614 Unclassified 1311
74 Ga0068852_100031279 3300005616 Bacteria 4390
75 Ga0068852_100191367 3300005616 Bacteria 1931
76 Ga0068852_100258323 3300005616 Bacteria 1672
77 Ga0068859_100927809 3300005617 Bacteria 955
78 Ga0068864_100053841 3300005618 Bacteria 3472
79 Ga0068864_100357381 3300005618 Bacteria 1380
80 Ga0068861_100034115 3300005719 Bacteria 3761
81 Ga0068851_10001096 3300005834 Bacteria 11756
82 Ga0068863_100012353 3300005841 Bacteria 8246
83 Ga0068858_100000391 3300005842 Bacteria 45896
84 Ga0068860_100011611 3300005843 Bacteria 8688
85 Ga0081539_10000382 3300005985 Bacteria 96235
86 Ga0081539_10121923 3300005985 Bacteria 1293
87 Ga0070715_10113679 3300006163 Bacteria 1281
88 Ga0075366_10022330 3300006195 Bacteria 3680
89 Ga0097621_100029042 3300006237 Bacteria 4364
90 Ga0097621_100056118 3300006237 Bacteria 3217
91 Ga0097621_100703368 3300006237 Bacteria 931
92 Ga0068871_100004482 3300006358 Bacteria 9721
93 Ga0068871_100007676 3300006358 Bacteria 7714
94 Ga0068865_100001228 3300006881 Bacteria 14914
95 Ga0097620_100927801 3300006931 Bacteria 955
96 Ga0105240_10003619 3300009093 Bacteria 23928
97 Ga0105240_10222848 3300009093 Bacteria 2196
98 Ga0105247_10112649 3300009101 Bacteria 1753
99 Ga0105241_10002270 3300009174 Bacteria 14447
100 Ga0105242_10051252 3300009176 Bacteria 3363
101 Ga0105248_10132290 3300009177 Bacteria 2815
102 Ga0105237_10242977 3300009545 Bacteria 1802
103 Ga0105249_10020717 3300009553 Bacteria 5879
104 Ga0105239_10019811 3300010375 Bacteria 7425
105 Ga0157373_10209438 3300013100 Bacteria 1375
106 Ga0157371_10000373 3300013102 Bacteria 56546
107 Ga0157371_10001416 3300013102 Bacteria 24929
108 Ga0157371_10003865 3300013102 Bacteria 13362
109 Ga0157371_10016268 3300013102 Bacteria 5556
110 Ga0157371_10093468 3300013102 Bacteria 2131
111 Ga0157371_10117198 3300013102 Bacteria 1893
112 Ga0157371_10160688 3300013102 Bacteria 1604
113 Ga0157371_10181606 3300013102 Bacteria 1505
114 Ga0157370_10000530 3300013104 Bacteria 47795
115 Ga0157370_10007937 3300013104 Bacteria 11494
116 Ga0157370_10013359 3300013104 Bacteria 8459
117 Ga0157370_10101786 3300013104 Bacteria 2690
118 Ga0157370_10278144 3300013104 Bacteria 1547
119 Ga0157369_10042815 3300013105 Bacteria 4939
120 Ga0157369_10074483 3300013105 Bacteria 3641
121 Ga0157369_10085423 3300013105 Bacteria 3372
122 Ga0157369_10191822 3300013105 Bacteria 2147
123 Ga0157369_10320228 3300013105 Bacteria 1612
124 Ga0157374_10000909 3300013296 Bacteria 25741
125 Ga0157374_10130010 3300013296 Bacteria 2436
126 Ga0157374_10230645 3300013296 Bacteria 1818
127 Ga0157374_10256138 3300013296 Unclassified 1723
128 Ga0157374_10341490 3300013296 Bacteria 1487
129 Ga0157378_10043428 3300013297 Bacteria 3991
130 Ga0157378_10097825 3300013297 Bacteria 2675
131 Ga0163162_10000029 3300013306 Bacteria 168510
132 Ga0163162_10028038 3300013306 Bacteria 5570
133 Ga0163162_10167359 3300013306 Bacteria 2322
134 Ga0163162_10543544 3300013306 Bacteria 1290
135 Ga0163162_11062573 3300013306 Bacteria 917
136 Ga0157372_10031944 3300013307 Bacteria 5768
137 Ga0157372_10032382 3300013307 Bacteria 5733
138 Ga0157372_10046399 3300013307 Bacteria 4823
139 Ga0157372_10150425 3300013307 Bacteria 2686
140 Ga0157372_10184881 3300013307 Bacteria 2413
141 Ga0157372_10213160 3300013307 Bacteria 2238
142 Ga0157372_10254784 3300013307 Bacteria 2037
143 Ga0157372_10876886 3300013307 Bacteria 1041
144 Ga0157372_11091830 3300013307 Unclassified 923
145 Ga0157375_10044559 3300013308 Bacteria 4311
146 Ga0157375_10228714 3300013308 Bacteria 2019
147 Ga0157375_10595951 3300013308 Bacteria 1265
148 Ga0157375_11170568 3300013308 Bacteria 901
149 Ga0163163_10000174 3300014325 Bacteria 67568
150 Ga0163163_10697195 3300014325 Bacteria 1079
151 Ga0157379_10000080 3300014968 Bacteria 63139
152 Ga0157379_10049654 3300014968 Bacteria 3746
153 Ga0157379_10299316 3300014968 Bacteria 1466
154 Ga0157376_10002129 3300014969 Bacteria 13332
155 Ga0157376_10119253 3300014969 Unclassified 2335
156 Ga0157376_10181271 3300014969 Bacteria 1925
157 Ga0157376_10248379 3300014969 Bacteria 1661
158 Ga0157376_11034008 3300014969 Bacteria 845
159 Ga0163161_10084194 3300017792 Bacteria 2345
160 Ga0213876_10015559 3300021384 Bacteria 4025
161 Ga0209258_100029 3300025242 Bacteria 490648
162 Ga0209646_1000005 3300025246 Bacteria 717627
163 Ga0209026_1000344 3300025250 Bacteria 44543
164 Ga0209148_1000089 3300025254 Bacteria 253548
165 Ga0209673_1000113 3300025273 Bacteria 179012
166 Ga0209130_1003558 3300025284 Bacteria 6519
167 Ga0209564_1017940 3300025295 Bacteria 2725
168 Ga0209758_1001350 3300025297 Bacteria 29547
169 Ga0209758_1029113 3300025297 Bacteria 2317
170 Ga0209050_1000907 3300025298 Bacteria 39185
171 Ga0207426_1000415 3300025302 Bacteria 70247
172 Ga0207426_1000536 3300025302 Bacteria 54323
173 Ga0207426_1000636 3300025302 Bacteria 44207
174 Ga0207426_1012070 3300025302 Bacteria 3262
175 Ga0209257_1004964 3300025304 Bacteria 9751
176 Ga0207697_10063039 3300025315 Bacteria 1545
177 Ga0207656_10017835 3300025321 Bacteria 2786
178 Ga0207710_10071523 3300025900 Unclassified 1591
179 Ga0207680_10024688 3300025903 Bacteria 3303
180 Ga0207647_10294208 3300025904 Bacteria 925
181 Ga0207645_10004351 3300025907 Bacteria 10489
182 Ga0207645_10206109 3300025907 Bacteria 1294
183 Ga0207705_10001332 3300025909 Bacteria 19775
184 Ga0207705_10007051 3300025909 Bacteria 8289
185 Ga0207705_10555759 3300025909 Unclassified 892
186 Ga0207654_10017740 3300025911 Bacteria 3726
187 Ga0207707_10013792 3300025912 Bacteria 7048
188 Ga0207707_10274434 3300025912 Bacteria 1461
189 Ga0207707_10285270 3300025912 Bacteria 1429
190 Ga0207660_10041548 3300025917 Bacteria 3223
191 Ga0207660_10161046 3300025917 Bacteria 1731
192 Ga0207657_10403888 3300025919 Bacteria 1074
193 Ga0207652_10000494 3300025921 Bacteria 40156
194 Ga0207652_10000633 3300025921 Bacteria 34817
195 Ga0207652_10014122 3300025921 Bacteria 6466
196 Ga0207652_10109240 3300025921 Bacteria 2451
197 Ga0207681_10235128 3300025923 Bacteria 1424
198 Ga0207650_10147343 3300025925 Bacteria 1855
199 Ga0207650_10324936 3300025925 Bacteria 1261
200 Ga0207659_10031954 3300025926 Bacteria 3609
201 Ga0207644_10240277 3300025931 Bacteria 1442
202 Ga0207690_10005079 3300025932 Bacteria 7773
203 Ga0207706_10004896 3300025933 Bacteria 12524
204 Ga0207704_10005003 3300025938 Bacteria 6097
205 Ga0207691_10000004 3300025940 Bacteria 168729
206 Ga0207691_10287253 3300025940 Bacteria 1415
207 Ga0207711_10102862 3300025941 Bacteria 2529
208 Ga0207689_10055497 3300025942 Bacteria 3260
209 Ga0207679_10491389 3300025945 Bacteria 1094
210 Ga0207679_10866441 3300025945 Bacteria 825
211 Ga0207667_10000936 3300025949 Bacteria 37241
212 Ga0207667_10049503 3300025949 Bacteria 4437
213 Ga0207667_10106906 3300025949 Bacteria 2886
214 Ga0207667_10741724 3300025949 Bacteria 982
215 Ga0207651_10016146 3300025960 Bacteria 4363
216 Ga0207712_10030998 3300025961 Bacteria 3599
217 Ga0207668_10000298 3300025972 Bacteria 32532
218 Ga0207658_10005678 3300025986 Bacteria 8530
219 Ga0207677_10248915 3300026023 Bacteria 1442
220 Ga0207703_10084588 3300026035 Bacteria 2653
221 Ga0207639_10204157 3300026041 Bacteria 1697
222 Ga0207639_10523219 3300026041 Bacteria 1086
223 Ga0207639_10703168 3300026041 Bacteria 938
224 Ga0207639_10715865 3300026041 Bacteria 929
225 Ga0207678_10146584 3300026067 Bacteria 2015
226 Ga0207702_10402216 3300026078 Bacteria 1321
227 Ga0207702_10869627 3300026078 Bacteria 893
228 Ga0207641_10010103 3300026088 Bacteria 7761
229 Ga0207648_10016863 3300026089 Bacteria 6660
230 Ga0207676_10003554 3300026095 Bacteria 11027
231 Ga0207676_10160921 3300026095 Bacteria 1945
232 Ga0207676_10311859 3300026095 Bacteria 1441
233 Ga0207675_100113208 3300026118 Bacteria 2562
234 Ga0207683_10102530 3300026121 Bacteria 2555
235 Ga0207698_10087631 3300026142 Bacteria 2536
236 Ga0207698_10137812 3300026142 Bacteria 2097
237 Ga0268266_10062872 3300028379 Bacteria 3204
238 Ga0268264_10003219 3300028381 Bacteria 14141
239 Ga0265338_10060287 3300028800 Bacteria 3336
240 Ga0265327_10054898 3300031251 Bacteria 2060
241 Ga0265316_10100086 3300031344 Bacteria 2204
242 Ga0307408_100171887 3300031548 Unclassified 1731
243 Ga0373943_0129459 3300035170 Bacteria 1349
244 Ga0373955_0345773 3300035172 Bacteria 900
245 Ga0373955_0425018 3300035172 Bacteria 808
246 Ga0373933_0395895 3300035724 Bacteria 901
247 Ga0373937_0009187 3300036401 Bacteria 8581
248 Ga0373937_0778651 3300036401 Bacteria 904
249 Ga0395899_0001371 3300037312 Bacteria 20896
250 Ga0395899_0015683 3300037312 Bacteria 5777
251 Ga0395899_0077210 3300037312 Bacteria 2429
252 Ga0395899_0205336 3300037312 Unclassified 1371
253 Ga0395900_0000203 3300037418 Bacteria 93536
254 Ga0395900_0011411 3300037418 Bacteria 9093
255 Ga0395900_0020467 3300037418 Bacteria 6753
256 Ga0395900_0295456 3300037418 Bacteria 1608
257 Ga0395900_0457519 3300037418 Unclassified 1231
258 Ga0395900_0458123 3300037418 Unclassified 1230
259 Ga0395900_0497080 3300037418 Bacteria 1170
260 Ga0395898_0001978 3300037466 Bacteria 25752
261 Ga0395898_0006508 3300037466 Bacteria 12481
262 Ga0395898_0080335 3300037466 Bacteria 3145
263 Ga0395898_0114213 3300037466 Bacteria 2587
264 Ga0395898_0673564 3300037466 Bacteria 976
265 Ga0395905_0019205 3300037471 Bacteria 6481
266 Ga0395905_0125146 3300037471 Unclassified 2417
267 Ga0395901_0012648 3300038443 Bacteria 8563
268 Ga0395901_0025579 3300038443 Bacteria 6059
269 Ga0395901_0035421 3300038443 Bacteria 5156
270 Ga0395901_0191836 3300038443 Unclassified 2142
271 Ga0395901_0473544 3300038443 Bacteria 1278
272 Ga0395901_0798997 3300038443 Bacteria 932
273 Ga0436365_1345967 3300039437 Bacteria 27431
274 Ga0436365_1568167 3300039437 Bacteria 756
275 Ga0466972_0000010 3300044658 Bacteria 256339
276 Ga0466968_0288231 3300044735 Bacteria 787
277 Ga0466970_0000246 3300044765 Bacteria 26542
278 Ga0466957_0015506 3300044842 Bacteria 4451
279 Ga0466959_0398696 3300045049 Bacteria 935
280 Ga0495629_0162268 3300046459 Bacteria 1552
281 Ga0495582_0291156 3300046473 Bacteria 938
282 Ga0495652_0071302 3300046529 Bacteria 2901
283 Ga0495665_0124170 3300046531 Bacteria 1352
284 Ga0495587_0241403 3300046536 Bacteria 1017
285 Ga0495645_0453916 3300046543 Bacteria 808
286 Ga0495667_0097184 3300046559 Bacteria 1907
287 Ga0495635_0063631 3300046663 Bacteria 2533
288 Ga0495658_0016551 3300046683 Bacteria 3795
289 Ga0495624_0336149 3300046690 Bacteria 909
290 Ga0495674_0019574 3300047319 Bacteria 6280
291 Ga0495684_0294821 3300047471 Bacteria 1166
292 Ga0495686_0020338 3300047472 Bacteria 4427
293 Ga0495686_0101531 3300047472 Bacteria 1734
294 Ga0495686_0311899 3300047472 Bacteria 865
295 Ga0496101_0448655 3300048904 Bacteria 1018
296 Ga0496102_0506306 3300048905 Bacteria 1130
297 Ga0496105_0108312 3300048908 Bacteria 2294
298 Ga0496109_0602969 3300048912 Bacteria 1034
299 Ga0496114_0574886 3300048917 Bacteria 995
300 Ga0496115_0057329 3300048918 Bacteria 3133
301 Ga0496115_0312690 3300048918 Bacteria 1286
302 Ga0496121_0000008 3300048924 Bacteria 843593
303 Ga0501032_0005855 3300049569 Bacteria 9093
304 Ga0501032_0077969 3300049569 Bacteria 2206
305 Ga0501033_0116809 3300049570 Bacteria 1938
306 Ga0501034_0215975 3300049571 Bacteria 1871
307 Ga0501036_0042103 3300049572 Bacteria 3866
308 Ga0501043_0366919 3300049579 Unclassified 1092
309 Ga0501046_0357428 3300049580 Bacteria 1059
310 Ga0501047_0039420 3300049581 Bacteria 4569
311 Ga0501047_0172931 3300049581 Bacteria 2028
312 Ga0501047_0687706 3300049581 Bacteria 841
313 Ga0501048_0141420 3300049582 Bacteria 1702
314 Ga0501067_0058364 3300049583 Bacteria 2137
315 Ga0501069_0121564 3300049585 Bacteria 1491
316 Ga0501070_0430042 3300049586 Bacteria 1065
317 Ga0501073_0161284 3300049589 Bacteria 1553
318 Ga0501074_0682892 3300049590 Bacteria 725
319 Ga0501083_0041026 3300049744 Bacteria 3140
320 Ga0501035_0018145 3300049822 Bacteria 6483
321 Ga0501044_0073923 3300049823 Bacteria 3464
322 nmdc:mga0k408_46785_c1 3300050493 Bacteria 2499
323 Ga0500644_0000155 3300053088 Bacteria 42910
324 Ga0500646_0011388 3300053090 Bacteria 2288
325 Ga0500583_0005371 3300053092 Bacteria 4288
326 Ga0500562_000032 3300053108 Bacteria 89989
327 Ga0500569_013999 3300053109 Bacteria 1977
328 Ga0500594_0023725 3300053118 Bacteria 1558
329 Ga0500607_065250 3300053121 Bacteria 1893
330 Ga0500658_0003427 3300053134 Bacteria 5989
331 Ga0500561_0047827 3300053137 Bacteria 1156
332 Ga0500577_0007350 3300053142 Bacteria 3083
333 Ga0500590_040711 3300053148 Bacteria 2393
334 Ga0500616_0014614 3300053153 Bacteria 4507
335 Ga0500622_0007104 3300053156 Bacteria 6399
336 Ga0500633_0188385 3300053160 Bacteria 773
337 Ga0500636_0029428 3300053177 Bacteria 3245
338 Ga0500645_106487 3300053730 Bacteria 788
339 Ga0501084_0030393 3300054114 Bacteria 4518
340 Ga0501084_0126175 3300054114 Bacteria 2153
341 Ga0500661_011473 3300055283 Bacteria 1603

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049590 Ga0501074_0682892 Ga0501074_0682892_31_534 167
2 3300053160 Ga0500633_0188385 Ga0500633_0188385_66_608 170
3 3300053730 Ga0500645_106487 Ga0500645_106487_17_577 182
4 3300053109 Ga0500569_013999 Ga0500569_013999_377_967 186
5 3300013105 Ga0157369_10320228 Ga0157369_103202282 189
6 3300014969 Ga0157376_11034008 Ga0157376_110340081 189
7 3300021384 Ga0213876_10015559 Ga0213876_100155592 189
8 3300003323 rootH1_10108487 rootH1_101084872 194
9 3300006237 Ga0097621_100703368 Ga0097621_1007033682 195
10 3300003322 rootL2_10337904 rootL2_103379041 198
11 3300053090 Ga0500646_0011388 Ga0500646_0011388_268_894 198
12 3300053134 Ga0500658_0003427 Ga0500658_0003427_3640_4266 198
13 3300053142 Ga0500577_0007350 Ga0500577_0007350_1873_2499 198
14 3300053153 Ga0500616_0014614 Ga0500616_0014614_732_1358 198
15 3300053092 Ga0500583_0005371 Ga0500583_0005371_1465_2091 200
16 3300053148 Ga0500590_040711 Ga0500590_040711_1603_2229 200
17 iso_pu_bacteria 2929154850 2929158454 200
18 3300047472 Ga0495686_0311899 Ga0495686_0311899_22_642 202
19 3300053108 Ga0500562_000032 Ga0500562_000032_39951_40571 202
20 3300053118 Ga0500594_0023725 Ga0500594_0023725_780_1400 202
21 3300053156 Ga0500622_0007104 Ga0500622_0007104_1727_2347 202
22 3300053177 Ga0500636_0029428 Ga0500636_0029428_1226_1858 202
23 3300005331 Ga0070670_100367468 Ga0070670_1003674681 203
24 3300005334 Ga0068869_100965087 Ga0068869_1009650871 203
25 3300005530 Ga0070679_100277375 Ga0070679_1002773752 203
26 3300025925 Ga0207650_10147343 Ga0207650_101473433 203
27 iso_pu_bacteria 2884791551 2884797287 203
28 iso_pu_bacteria 2929177148 2929177244 203
29 iso_pu_bacteria 2945977869 2945979613 203
30 iso_pu_bacteria 2946013367 2946014520 203
31 3300003320 rootH2_10092063 rootH2_100920632 204
32 3300031251 Ga0265327_10054898 Ga0265327_100548981 204
33 3300037418 Ga0395900_0295456 Ga0395900_0295456_601_1233 204
34 3300048918 Ga0496115_0057329 Ga0496115_0057329_2491_3111 204
35 iso_pu_bacteria 2821136567 2821143165 204
36 iso_pu_bacteria 2904467357 2904470883 204
37 iso_pu_bacteria 2929239360 2929239666 204
38 3300003203 JGI25406J46586_10019511 JGI25406J46586_100195112 205
39 3300005564 Ga0070664_101134555 Ga0070664_1011345551 205
40 3300005616 Ga0068852_100191367 Ga0068852_1001913672 205
41 3300005985 Ga0081539_10000382 Ga0081539_1000038286 205
42 3300013102 Ga0157371_10117198 Ga0157371_101171982 205
43 3300013105 Ga0157369_10085423 Ga0157369_100854232 205
44 3300025919 Ga0207657_10403888 Ga0207657_104038882 205
45 3300025945 Ga0207679_10866441 Ga0207679_108664411 205
46 3300039437 Ga0436365_1568167 Ga0436365_1568167_80_697 205
47 iso_pu_bacteria 2818991442 2819576608 205
48 iso_pu_bacteria 2818991460 2819677354 205
49 3300005327 Ga0070658_10003542 Ga0070658_100035429 206
50 3300005328 Ga0070676_10014867 Ga0070676_100148672 206
51 3300005328 Ga0070676_10113286 Ga0070676_101132861 206
52 3300005333 Ga0070677_10355912 Ga0070677_103559121 206
53 3300005334 Ga0068869_100046555 Ga0068869_1000465552 206
54 3300005335 Ga0070666_10003892 Ga0070666_100038927 206
55 3300005336 Ga0070680_100000590 Ga0070680_1000005902 206
56 3300005336 Ga0070680_100085411 Ga0070680_1000854112 206
57 3300005337 Ga0070682_100007389 Ga0070682_1000073896 206
58 3300005338 Ga0068868_100048550 Ga0068868_1000485502 206
59 3300005338 Ga0068868_100173295 Ga0068868_1001732951 206
60 3300005339 Ga0070660_100364939 Ga0070660_1003649391 206
61 3300005341 Ga0070691_10004283 Ga0070691_100042831 206
62 3300005343 Ga0070687_100011524 Ga0070687_1000115245 206
63 3300005347 Ga0070668_100002414 Ga0070668_10000241410 206
64 3300005353 Ga0070669_100227463 Ga0070669_1002274632 206
65 3300005355 Ga0070671_100110593 Ga0070671_1001105932 206
66 3300005364 Ga0070673_100000160 Ga0070673_1000001605 206
67 3300005365 Ga0070688_100292238 Ga0070688_1002922382 206
68 3300005367 Ga0070667_100000031 Ga0070667_10000003113 206
69 3300005456 Ga0070678_100101053 Ga0070678_1001010532 206
70 3300005457 Ga0070662_100001909 Ga0070662_10000190910 206
71 3300005458 Ga0070681_10061239 Ga0070681_100612393 206
72 3300005459 Ga0068867_100037819 Ga0068867_1000378194 206
73 3300005530 Ga0070679_100010172 Ga0070679_1000101722 206
74 3300005539 Ga0068853_100056085 Ga0068853_1000560853 206
75 3300005539 Ga0068853_100087541 Ga0068853_1000875411 206
76 3300005539 Ga0068853_100418993 Ga0068853_1004189931 206
77 3300005543 Ga0070672_100600473 Ga0070672_1006004732 206
78 3300005547 Ga0070693_100021205 Ga0070693_1000212055 206
79 3300005548 Ga0070665_100002650 Ga0070665_10000265010 206
80 3300005563 Ga0068855_100020524 Ga0068855_1000205248 206
81 3300005563 Ga0068855_100041367 Ga0068855_1000413675 206
82 3300005563 Ga0068855_100838619 Ga0068855_1008386192 206
83 3300005564 Ga0070664_100543387 Ga0070664_1005433872 206
84 3300005577 Ga0068857_100384427 Ga0068857_1003844272 206
85 3300005616 Ga0068852_100031279 Ga0068852_1000312793 206
86 3300005616 Ga0068852_100258323 Ga0068852_1002583232 206
87 3300005617 Ga0068859_100927809 Ga0068859_1009278092 206
88 3300005618 Ga0068864_100053841 Ga0068864_1000538413 206
89 3300005618 Ga0068864_100357381 Ga0068864_1003573812 206
90 3300005719 Ga0068861_100034115 Ga0068861_1000341153 206
91 3300005834 Ga0068851_10001096 Ga0068851_100010964 206
92 3300005841 Ga0068863_100012353 Ga0068863_1000123536 206
93 3300005842 Ga0068858_100000391 Ga0068858_1000003915 206
94 3300005843 Ga0068860_100011611 Ga0068860_1000116116 206
95 3300005985 Ga0081539_10121923 Ga0081539_101219231 206
96 3300006163 Ga0070715_10113679 Ga0070715_101136792 206
97 3300006237 Ga0097621_100029042 Ga0097621_1000290421 206
98 3300006237 Ga0097621_100056118 Ga0097621_1000561182 206
99 3300006358 Ga0068871_100004482 Ga0068871_10000448211 206
100 3300006358 Ga0068871_100007676 Ga0068871_1000076767 206
101 3300006881 Ga0068865_100001228 Ga0068865_10000122813 206
102 3300006931 Ga0097620_100927801 Ga0097620_1009278012 206
103 3300009093 Ga0105240_10003619 Ga0105240_100036193 206
104 3300009101 Ga0105247_10112649 Ga0105247_101126491 206
105 3300009174 Ga0105241_10002270 Ga0105241_1000227011 206
106 3300009176 Ga0105242_10051252 Ga0105242_100512522 206
107 3300009177 Ga0105248_10132290 Ga0105248_101322902 206
108 3300009545 Ga0105237_10242977 Ga0105237_102429772 206
109 3300009553 Ga0105249_10020717 Ga0105249_100207172 206
110 3300010375 Ga0105239_10019811 Ga0105239_100198113 206
111 3300013104 Ga0157370_10013359 Ga0157370_100133594 206
112 3300013105 Ga0157369_10074483 Ga0157369_100744832 206
113 3300013105 Ga0157369_10191822 Ga0157369_101918222 206
114 3300013296 Ga0157374_10000909 Ga0157374_1000090922 206
115 3300013296 Ga0157374_10130010 Ga0157374_101300103 206
116 3300013296 Ga0157374_10230645 Ga0157374_102306452 206
117 3300013296 Ga0157374_10256138 Ga0157374_102561382 206
118 3300013296 Ga0157374_10341490 Ga0157374_103414901 206
119 3300013297 Ga0157378_10043428 Ga0157378_100434285 206
120 3300013297 Ga0157378_10097825 Ga0157378_100978252 206
121 3300013306 Ga0163162_10000029 Ga0163162_100000295 206
122 3300013306 Ga0163162_10028038 Ga0163162_100280384 206
123 3300013306 Ga0163162_10167359 Ga0163162_101673594 206
124 3300013306 Ga0163162_10543544 Ga0163162_105435441 206
125 3300013306 Ga0163162_11062573 Ga0163162_110625732 206
126 3300013307 Ga0157372_10150425 Ga0157372_101504252 206
127 3300013307 Ga0157372_10876886 Ga0157372_108768862 206
128 3300013307 Ga0157372_11091830 Ga0157372_110918302 206
129 3300013308 Ga0157375_10044559 Ga0157375_100445594 206
130 3300013308 Ga0157375_10228714 Ga0157375_102287142 206
131 3300013308 Ga0157375_10595951 Ga0157375_105959512 206
132 3300013308 Ga0157375_11170568 Ga0157375_111705681 206
133 3300014325 Ga0163163_10000174 Ga0163163_1000017413 206
134 3300014325 Ga0163163_10697195 Ga0163163_106971952 206
135 3300014968 Ga0157379_10000080 Ga0157379_1000008061 206
136 3300014968 Ga0157379_10049654 Ga0157379_100496543 206
137 3300014968 Ga0157379_10299316 Ga0157379_102993162 206
138 3300014969 Ga0157376_10002129 Ga0157376_100021295 206
139 3300014969 Ga0157376_10119253 Ga0157376_101192533 206
140 3300014969 Ga0157376_10181271 Ga0157376_101812712 206
141 3300014969 Ga0157376_10248379 Ga0157376_102483792 206
142 3300017792 Ga0163161_10084194 Ga0163161_100841942 206
143 3300025315 Ga0207697_10063039 Ga0207697_100630392 206
144 3300025321 Ga0207656_10017835 Ga0207656_100178353 206
145 3300025900 Ga0207710_10071523 Ga0207710_100715231 206
146 3300025903 Ga0207680_10024688 Ga0207680_100246882 206
147 3300025904 Ga0207647_10294208 Ga0207647_102942082 206
148 3300025907 Ga0207645_10004351 Ga0207645_100043518 206
149 3300025907 Ga0207645_10206109 Ga0207645_102061092 206
150 3300025909 Ga0207705_10007051 Ga0207705_100070515 206
151 3300025911 Ga0207654_10017740 Ga0207654_100177402 206
152 3300025912 Ga0207707_10013792 Ga0207707_100137923 206
153 3300025917 Ga0207660_10161046 Ga0207660_101610462 206
154 3300025921 Ga0207652_10014122 Ga0207652_100141226 206
155 3300025926 Ga0207659_10031954 Ga0207659_100319545 206
156 3300025931 Ga0207644_10240277 Ga0207644_102402771 206
157 3300025933 Ga0207706_10004896 Ga0207706_100048965 206
158 3300025938 Ga0207704_10005003 Ga0207704_100050036 206
159 3300025940 Ga0207691_10000004 Ga0207691_100000045 206
160 3300025940 Ga0207691_10287253 Ga0207691_102872531 206
161 3300025941 Ga0207711_10102862 Ga0207711_101028621 206
162 3300025942 Ga0207689_10055497 Ga0207689_100554971 206
163 3300025945 Ga0207679_10491389 Ga0207679_104913892 206
164 3300025949 Ga0207667_10106906 Ga0207667_101069062 206
165 3300025949 Ga0207667_10741724 Ga0207667_107417242 206
166 3300025960 Ga0207651_10016146 Ga0207651_100161465 206
167 3300025961 Ga0207712_10030998 Ga0207712_100309982 206
168 3300025972 Ga0207668_10000298 Ga0207668_1000029813 206
169 3300025986 Ga0207658_10005678 Ga0207658_100056786 206
170 3300026023 Ga0207677_10248915 Ga0207677_102489152 206
171 3300026035 Ga0207703_10084588 Ga0207703_100845883 206
172 3300026041 Ga0207639_10204157 Ga0207639_102041572 206
173 3300026041 Ga0207639_10715865 Ga0207639_107158652 206
174 3300026088 Ga0207641_10010103 Ga0207641_100101034 206
175 3300026089 Ga0207648_10016863 Ga0207648_100168637 206
176 3300026095 Ga0207676_10003554 Ga0207676_100035543 206
177 3300026095 Ga0207676_10160921 Ga0207676_101609212 206
178 3300026095 Ga0207676_10311859 Ga0207676_103118592 206
179 3300026118 Ga0207675_100113208 Ga0207675_1001132082 206
180 3300026121 Ga0207683_10102530 Ga0207683_101025302 206
181 3300026142 Ga0207698_10087631 Ga0207698_100876312 206
182 3300026142 Ga0207698_10137812 Ga0207698_101378121 206
183 3300028379 Ga0268266_10062872 Ga0268266_100628724 206
184 3300028381 Ga0268264_10003219 Ga0268264_1000321911 206
185 3300028800 Ga0265338_10060287 Ga0265338_100602872 206
186 3300031344 Ga0265316_10100086 Ga0265316_101000863 206
187 3300035170 Ga0373943_0129459 Ga0373943_0129459_232_858 206
188 3300035172 Ga0373955_0345773 Ga0373955_0345773_51_680 206
189 3300035172 Ga0373955_0425018 Ga0373955_0425018_154_780 206
190 3300035724 Ga0373933_0395895 Ga0373933_0395895_206_832 206
191 3300036401 Ga0373937_0009187 Ga0373937_0009187_7581_8210 206
192 3300036401 Ga0373937_0778651 Ga0373937_0778651_115_741 206
193 3300039437 Ga0436365_1345967 Ga0436365_1345967_11838_12458 206
194 3300044658 Ga0466972_0000010 Ga0466972_0000010_2354_3025 206
195 3300044765 Ga0466970_0000246 Ga0466970_0000246_25515_26186 206
196 3300046459 Ga0495629_0162268 Ga0495629_0162268_43_669 206
197 3300046473 Ga0495582_0291156 Ga0495582_0291156_143_769 206
198 3300046529 Ga0495652_0071302 Ga0495652_0071302_490_1116 206
199 3300046531 Ga0495665_0124170 Ga0495665_0124170_146_772 206
200 3300046536 Ga0495587_0241403 Ga0495587_0241403_162_788 206
201 3300046543 Ga0495645_0453916 Ga0495645_0453916_117_743 206
202 3300046559 Ga0495667_0097184 Ga0495667_0097184_651_1277 206
203 3300046663 Ga0495635_0063631 Ga0495635_0063631_1471_2097 206
204 3300046683 Ga0495658_0016551 Ga0495658_0016551_1907_2533 206
205 3300046690 Ga0495624_0336149 Ga0495624_0336149_79_705 206
206 3300047319 Ga0495674_0019574 Ga0495674_0019574_2408_3034 206
207 3300047471 Ga0495684_0294821 Ga0495684_0294821_125_751 206
208 3300048904 Ga0496101_0448655 Ga0496101_0448655_244_867 206
209 3300048905 Ga0496102_0506306 Ga0496102_0506306_434_1054 206
210 3300048908 Ga0496105_0108312 Ga0496105_0108312_398_1024 206
211 3300048912 Ga0496109_0602969 Ga0496109_0602969_220_843 206
212 3300048917 Ga0496114_0574886 Ga0496114_0574886_25_651 206
213 3300048918 Ga0496115_0312690 Ga0496115_0312690_635_1261 206
214 3300049581 Ga0501047_0039420 Ga0501047_0039420_13_633 206
215 3300049581 Ga0501047_0687706 Ga0501047_0687706_14_634 206
216 3300049582 Ga0501048_0141420 Ga0501048_0141420_471_1091 206
217 3300049583 Ga0501067_0058364 Ga0501067_0058364_217_837 206
218 3300049585 Ga0501069_0121564 Ga0501069_0121564_102_722 206
219 3300049586 Ga0501070_0430042 Ga0501070_0430042_189_809 206
220 3300049589 Ga0501073_0161284 Ga0501073_0161284_155_775 206
221 3300049744 Ga0501083_0041026 Ga0501083_0041026_518_1138 206
222 3300054114 Ga0501084_0126175 Ga0501084_0126175_922_1542 206
223 iso_pu_bacteria 8003151029 8003157653 206
224 3300003320 rootH2_10076019 rootH2_100760194 207
225 3300003323 rootH1_10007323 rootH1_1000732320 207
226 3300013102 Ga0157371_10000373 Ga0157371_100003739 207
227 3300013104 Ga0157370_10101786 Ga0157370_101017862 207
228 3300025284 Ga0209130_1003558 Ga0209130_10035585 207
229 3300025302 Ga0207426_1000415 Ga0207426_100041524 207
230 3300025925 Ga0207650_10324936 Ga0207650_103249361 207
231 3300049569 Ga0501032_0005855 Ga0501032_0005855_159_791 207
232 3300049572 Ga0501036_0042103 Ga0501036_0042103_603_1235 207
233 3300049580 Ga0501046_0357428 Ga0501046_0357428_11_643 207
234 3300049581 Ga0501047_0172931 Ga0501047_0172931_417_1049 207
235 3300054114 Ga0501084_0030393 Ga0501084_0030393_3416_4048 207
236 3300005262 Ga0065165_1004399 Ga0065165_10043995 208
237 3300025302 Ga0207426_1012070 Ga0207426_10120704 208
238 3300025923 Ga0207681_10235128 Ga0207681_102351282 208
239 3300026041 Ga0207639_10703168 Ga0207639_107031682 208
240 3300031548 Ga0307408_100171887 Ga0307408_1001718872 208
241 3300044735 Ga0466968_0288231 Ga0466968_0288231_88_714 208
242 3300045049 Ga0466959_0398696 Ga0466959_0398696_243_869 208
243 3300053088 Ga0500644_0000155 Ga0500644_0000155_38042_38668 208
244 3300053121 Ga0500607_065250 Ga0500607_065250_1243_1869 208
245 3300053137 Ga0500561_0047827 Ga0500561_0047827_51_677 208
246 3300055283 Ga0500661_011473 Ga0500661_011473_308_934 208
247 3300005327 Ga0070658_10243882 Ga0070658_102438822 209
248 3300005327 Ga0070658_10356007 Ga0070658_103560071 209
249 3300005329 Ga0070683_100054352 Ga0070683_1000543523 209
250 3300005339 Ga0070660_100099579 Ga0070660_1000995792 209
251 3300005366 Ga0070659_100430599 Ga0070659_1004305992 209
252 3300005455 Ga0070663_100099356 Ga0070663_1000993562 209
253 3300005458 Ga0070681_10325113 Ga0070681_103251132 209
254 3300005530 Ga0070679_100007518 Ga0070679_1000075184 209
255 3300005530 Ga0070679_100011558 Ga0070679_1000115584 209
256 3300005563 Ga0068855_100001835 Ga0068855_10000183513 209
257 3300005563 Ga0068855_100022645 Ga0068855_1000226457 209
258 3300005563 Ga0068855_100664065 Ga0068855_1006640652 209
259 3300005614 Ga0068856_100364601 Ga0068856_1003646013 209
260 3300005614 Ga0068856_100448352 Ga0068856_1004483522 209
261 3300006195 Ga0075366_10022330 Ga0075366_100223303 209
262 3300009093 Ga0105240_10222848 Ga0105240_102228482 209
263 3300013102 Ga0157371_10001416 Ga0157371_1000141611 209
264 3300013102 Ga0157371_10003865 Ga0157371_100038655 209
265 3300013102 Ga0157371_10016268 Ga0157371_100162684 209
266 3300013102 Ga0157371_10093468 Ga0157371_100934682 209
267 3300013104 Ga0157370_10000530 Ga0157370_1000053033 209
268 3300013104 Ga0157370_10007937 Ga0157370_100079377 209
269 3300013307 Ga0157372_10032382 Ga0157372_100323823 209
270 3300013307 Ga0157372_10046399 Ga0157372_100463992 209
271 3300013307 Ga0157372_10184881 Ga0157372_101848814 209
272 3300013307 Ga0157372_10213160 Ga0157372_102131602 209
273 3300025909 Ga0207705_10001332 Ga0207705_100013322 209
274 3300025909 Ga0207705_10555759 Ga0207705_105557591 209
275 3300025912 Ga0207707_10274434 Ga0207707_102744342 209
276 3300025912 Ga0207707_10285270 Ga0207707_102852702 209
277 3300025917 Ga0207660_10041548 Ga0207660_100415482 209
278 3300025921 Ga0207652_10000494 Ga0207652_100004944 209
279 3300025921 Ga0207652_10000633 Ga0207652_1000063310 209
280 3300025921 Ga0207652_10109240 Ga0207652_101092402 209
281 3300025932 Ga0207690_10005079 Ga0207690_100050796 209
282 3300025949 Ga0207667_10000936 Ga0207667_1000093625 209
283 3300025949 Ga0207667_10049503 Ga0207667_100495033 209
284 3300026041 Ga0207639_10523219 Ga0207639_105232191 209
285 3300026067 Ga0207678_10146584 Ga0207678_101465842 209
286 3300026078 Ga0207702_10402216 Ga0207702_104022162 209
287 3300026078 Ga0207702_10869627 Ga0207702_108696272 209
288 3300037312 Ga0395899_0001371 Ga0395899_0001371_16537_17172 209
289 3300037312 Ga0395899_0015683 Ga0395899_0015683_4235_4867 209
290 3300037312 Ga0395899_0205336 Ga0395899_0205336_216_872 209
291 3300037418 Ga0395900_0000203 Ga0395900_0000203_6930_7565 209
292 3300037418 Ga0395900_0011411 Ga0395900_0011411_7484_8140 209
293 3300037418 Ga0395900_0020467 Ga0395900_0020467_5254_5886 209
294 3300037418 Ga0395900_0457519 Ga0395900_0457519_360_1016 209
295 3300037418 Ga0395900_0458123 Ga0395900_0458123_327_1016 209
296 3300037466 Ga0395898_0001978 Ga0395898_0001978_8450_9085 209
297 3300037466 Ga0395898_0114213 Ga0395898_0114213_1471_2103 209
298 3300037466 Ga0395898_0673564 Ga0395898_0673564_73_762 209
299 3300037471 Ga0395905_0019205 Ga0395905_0019205_2143_2832 209
300 3300037471 Ga0395905_0125146 Ga0395905_0125146_308_964 209
301 3300038443 Ga0395901_0012648 Ga0395901_0012648_6924_7559 209
302 3300038443 Ga0395901_0035421 Ga0395901_0035421_748_1380 209
303 3300038443 Ga0395901_0191836 Ga0395901_0191836_215_904 209
304 3300038443 Ga0395901_0798997 Ga0395901_0798997_96_752 209
305 3300047472 Ga0495686_0020338 Ga0495686_0020338_2885_3529 209
306 3300047472 Ga0495686_0101531 Ga0495686_0101531_950_1594 209
307 3300049569 Ga0501032_0077969 Ga0501032_0077969_944_1576 209
308 3300049570 Ga0501033_0116809 Ga0501033_0116809_1050_1682 209
309 3300049571 Ga0501034_0215975 Ga0501034_0215975_109_741 209
310 3300049579 Ga0501043_0366919 Ga0501043_0366919_307_939 209
311 3300049822 Ga0501035_0018145 Ga0501035_0018145_747_1379 209
312 3300049823 Ga0501044_0073923 Ga0501044_0073923_2106_2738 209
313 3300050493 nmdc:mga0k408_46785_c1 nmdc:mga0k408_46785_c1_1077_1721 209
314 3300002738 JGI25154J39366_1000002 JGI25154J39366_1000002354 210
315 3300002741 JGI25157J39369_1003470 JGI25157J39369_10034703 210
316 3300003215 JGI25153J46596_10030539 JGI25153J46596_100305392 210
317 3300003761 Ga0055535_1006156 Ga0055535_10061562 210
318 3300003762 Ga0055542_1001676 Ga0055542_10016768 210
319 3300003791 Ga0055530_10038760 Ga0055530_100387601 210
320 3300025242 Ga0209258_100029 Ga0209258_100029161 210
321 3300025246 Ga0209646_1000005 Ga0209646_100000518 210
322 3300025250 Ga0209026_1000344 Ga0209026_100034415 210
323 3300025254 Ga0209148_1000089 Ga0209148_100008969 210
324 3300025297 Ga0209758_1001350 Ga0209758_100135017 210
325 3300025302 Ga0207426_1000536 Ga0207426_100053617 210
326 3300025302 Ga0207426_1000636 Ga0207426_100063624 210
327 3300044842 Ga0466957_0015506 Ga0466957_0015506_1094_1726 210
328 3300048924 Ga0496121_0000008 Ga0496121_0000008_134806_135441 210
329 3300005366 Ga0070659_100057538 Ga0070659_1000575383 212
330 3300013100 Ga0157373_10209438 Ga0157373_102094381 215
331 3300013102 Ga0157371_10160688 Ga0157371_101606882 215
332 3300013102 Ga0157371_10181606 Ga0157371_101816062 215
333 3300013104 Ga0157370_10278144 Ga0157370_102781441 215
334 3300013105 Ga0157369_10042815 Ga0157369_100428155 215
335 3300013307 Ga0157372_10254784 Ga0157372_102547842 215
336 3300037312 Ga0395899_0077210 Ga0395899_0077210_128_856 215
337 3300037418 Ga0395900_0497080 Ga0395900_0497080_300_1031 215
338 3300037466 Ga0395898_0006508 Ga0395898_0006508_11399_12127 215
339 3300037466 Ga0395898_0080335 Ga0395898_0080335_232_963 215
340 3300038443 Ga0395901_0025579 Ga0395901_0025579_2028_2756 215
341 3300038443 Ga0395901_0473544 Ga0395901_0473544_239_970 215
342 3300003323 rootH1_10086131 rootH1_100861313 217
343 3300003790 Ga0055528_1000338 Ga0055528_100033829 217
344 3300003794 Ga0055531_10024007 Ga0055531_100240071 217
345 3300005262 Ga0065165_1000100 Ga0065165_100010076 217
346 3300013307 Ga0157372_10031944 Ga0157372_100319443 217
347 3300025273 Ga0209673_1000113 Ga0209673_100011313 217
348 3300025295 Ga0209564_1017940 Ga0209564_10179403 217
349 3300025297 Ga0209758_1029113 Ga0209758_10291131 217
350 3300025298 Ga0209050_1000907 Ga0209050_10009072 217
351 3300025304 Ga0209257_1004964 Ga0209257_10049648 217
352 3300001989 JGI24739J22299_10018924 JGI24739J22299_100189242 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

53

165

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o6y-assembly2.cif.gz_B crystal structure of the bc1960 peptidoglycan n-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{n}-oxidanyl-benzamide 0.91 20 210
4m1b-assembly2.cif.gz_B structural determination of ba0150, a polysaccharide deacetylase from bacillus anthracis 0.8965 27 214
7y51-assembly1.cif.gz_A-2 acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant 0.8935 37 211
2cc0-assembly1.cif.gz_B family 4 carbohydrate esterase from streptomyces lividans in complex with acetate 0.8901 37 216
6h8n-assembly1.cif.gz_A structure of peptidoglycan deacetylase pdac from bacillus subtilis - mutant d285s 0.8831 31 215
ID Description Score Start End Superfamily
2c1iA03 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8997 37 216 3.20.20.370
4m1bB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8965 27 214 3.20.20.370
2cc0B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8901 37 216 3.20.20.370
2c79A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8831 37 211 3.20.20.370
4l1gD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8765 16 214 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A060C0I4-F1-model_v4 Polysacc_deac_1 0.999 39 133 GO:0005975
GO:0016020
GO:0016810
AF-A0A1Q4F696-F1-model_v4 Polysaccharide deacetylase family protein 0.9926 10 216 GO:0005975
GO:0016020
GO:0016810
AF-A0A522YP35-F1-model_v4 deleted 0.9919 11 216
AF-A0A519Y3Z5-F1-model_v4 Polysaccharide deacetylase family protein 0.9891 55 218 GO:0005975
GO:0016020
GO:0016810
AF-A0A849UVL6-F1-model_v4 Polysaccharide deacetylase family protein 0.9888 10 215 GO:0005975
GO:0016020
GO:0016810

Feature Viewer

pLDDT pTM Quality
93.57 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map