F419016
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 352 | 222 | 341 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300013100|Ga0157373_10209438|Ga0157373_102094381 |
| Length | 243 |
| Sequence | MVASYKRSSFFLLAETKNRKQKYLSLYCNFILMLYLKKTPWILKKIFPERVWNIKTDGKILYLTFDDGPHPEATLFVLEELKKYNAKATFFCIGKNVKEHFPIYQRIIEEGHKPGNHTFHHLNGWKTGDKKYLNDISEAAKIIDSDLFRPPYGRITKFQSKAISGERLQLKTIMWDVLSGDFDASVTGENCYLNVVNNSEAGSIIVFHDSAKAFTVLQYALPRILKYYSEKGFQFQSLRKELF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 2 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 3 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 4 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 5 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 6 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 7 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 8 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 9 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 10 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 13 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 14 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 96 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 150 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 151 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 152 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 153 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 154 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 155 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 157 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 158 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 159 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 160 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 161 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 162 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 163 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 164 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 165 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 166 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 167 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 182 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 183 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 185 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 186 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 187 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 204 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 205 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 206 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 207 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 208 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 209 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 210 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 211 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 212 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 213 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 214 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 215 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 216 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 217 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 218 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 219 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 220 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 222 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.88 |
| Metatranscriptomes | 0 |
| Isolates | 3.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.36 |
| Nodule | 0 |
| Rhizoplane | 1.99 |
| Rhizosphere | 80.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10018924 | 3300001989 | Bacteria | 2470 |
| 2 | JGI25154J39366_1000002 | 3300002738 | Bacteria | 466942 |
| 3 | JGI25157J39369_1003470 | 3300002741 | Bacteria | 3204 |
| 4 | JGI25406J46586_10019511 | 3300003203 | Bacteria | 2761 |
| 5 | JGI25153J46596_10030539 | 3300003215 | Bacteria | 1831 |
| 6 | rootH2_10076019 | 3300003320 | Bacteria | 7044 |
| 7 | rootH2_10092063 | 3300003320 | Bacteria | 2881 |
| 8 | rootL2_10337904 | 3300003322 | Bacteria | 1493 |
| 9 | rootH1_10007323 | 3300003323 | Bacteria | 15190 |
| 10 | rootH1_10086131 | 3300003323 | Bacteria | 4908 |
| 11 | rootH1_10108487 | 3300003323 | Bacteria | 1815 |
| 12 | Ga0055535_1006156 | 3300003761 | Bacteria | 2484 |
| 13 | Ga0055542_1001676 | 3300003762 | Bacteria | 9824 |
| 14 | Ga0055528_1000338 | 3300003790 | Bacteria | 39174 |
| 15 | Ga0055530_10038760 | 3300003791 | Bacteria | 1182 |
| 16 | Ga0055531_10024007 | 3300003794 | Bacteria | 2265 |
| 17 | Ga0065165_1000100 | 3300005262 | Bacteria | 141963 |
| 18 | Ga0065165_1004399 | 3300005262 | Bacteria | 8785 |
| 19 | Ga0070658_10003542 | 3300005327 | Bacteria | 12813 |
| 20 | Ga0070658_10243882 | 3300005327 | Bacteria | 1523 |
| 21 | Ga0070658_10356007 | 3300005327 | Bacteria | 1253 |
| 22 | Ga0070676_10014867 | 3300005328 | Bacteria | 4284 |
| 23 | Ga0070676_10113286 | 3300005328 | Bacteria | 1692 |
| 24 | Ga0070683_100054352 | 3300005329 | Bacteria | 3713 |
| 25 | Ga0070670_100367468 | 3300005331 | Bacteria | 1266 |
| 26 | Ga0070677_10355912 | 3300005333 | Bacteria | 760 |
| 27 | Ga0068869_100046555 | 3300005334 | Bacteria | 3127 |
| 28 | Ga0068869_100965087 | 3300005334 | Bacteria | 740 |
| 29 | Ga0070666_10003892 | 3300005335 | Bacteria | 9069 |
| 30 | Ga0070680_100000590 | 3300005336 | Bacteria | 25076 |
| 31 | Ga0070680_100085411 | 3300005336 | Bacteria | 2608 |
| 32 | Ga0070682_100007389 | 3300005337 | Bacteria | 6199 |
| 33 | Ga0068868_100048550 | 3300005338 | Bacteria | 3329 |
| 34 | Ga0068868_100173295 | 3300005338 | Unclassified | 1787 |
| 35 | Ga0070660_100099579 | 3300005339 | Bacteria | 2302 |
| 36 | Ga0070660_100364939 | 3300005339 | Bacteria | 1190 |
| 37 | Ga0070691_10004283 | 3300005341 | Bacteria | 6479 |
| 38 | Ga0070687_100011524 | 3300005343 | Bacteria | 3870 |
| 39 | Ga0070668_100002414 | 3300005347 | Bacteria | 13757 |
| 40 | Ga0070669_100227463 | 3300005353 | Bacteria | 1477 |
| 41 | Ga0070671_100110593 | 3300005355 | Bacteria | 2308 |
| 42 | Ga0070673_100000160 | 3300005364 | Bacteria | 32512 |
| 43 | Ga0070688_100292238 | 3300005365 | Bacteria | 1175 |
| 44 | Ga0070659_100057538 | 3300005366 | Bacteria | 3066 |
| 45 | Ga0070659_100430599 | 3300005366 | Bacteria | 1117 |
| 46 | Ga0070667_100000031 | 3300005367 | Bacteria | 177447 |
| 47 | Ga0070663_100099356 | 3300005455 | Bacteria | 2169 |
| 48 | Ga0070678_100101053 | 3300005456 | Bacteria | 2235 |
| 49 | Ga0070662_100001909 | 3300005457 | Bacteria | 12799 |
| 50 | Ga0070681_10061239 | 3300005458 | Bacteria | 3739 |
| 51 | Ga0070681_10325113 | 3300005458 | Bacteria | 1448 |
| 52 | Ga0068867_100037819 | 3300005459 | Bacteria | 3510 |
| 53 | Ga0070679_100007518 | 3300005530 | Bacteria | 10191 |
| 54 | Ga0070679_100010172 | 3300005530 | Bacteria | 8917 |
| 55 | Ga0070679_100011558 | 3300005530 | Bacteria | 8414 |
| 56 | Ga0070679_100277375 | 3300005530 | Bacteria | 1629 |
| 57 | Ga0068853_100056085 | 3300005539 | Bacteria | 3396 |
| 58 | Ga0068853_100087541 | 3300005539 | Bacteria | 2733 |
| 59 | Ga0068853_100418993 | 3300005539 | Bacteria | 1255 |
| 60 | Ga0070672_100600473 | 3300005543 | Bacteria | 958 |
| 61 | Ga0070693_100021205 | 3300005547 | Bacteria | 3439 |
| 62 | Ga0070665_100002650 | 3300005548 | Bacteria | 19467 |
| 63 | Ga0068855_100001835 | 3300005563 | Bacteria | 26494 |
| 64 | Ga0068855_100020524 | 3300005563 | Bacteria | 7922 |
| 65 | Ga0068855_100022645 | 3300005563 | Bacteria | 7527 |
| 66 | Ga0068855_100041367 | 3300005563 | Bacteria | 5462 |
| 67 | Ga0068855_100664065 | 3300005563 | Bacteria | 1118 |
| 68 | Ga0068855_100838619 | 3300005563 | Bacteria | 975 |
| 69 | Ga0070664_100543387 | 3300005564 | Bacteria | 1074 |
| 70 | Ga0070664_101134555 | 3300005564 | Bacteria | 737 |
| 71 | Ga0068857_100384427 | 3300005577 | Bacteria | 1304 |
| 72 | Ga0068856_100364601 | 3300005614 | Bacteria | 1463 |
| 73 | Ga0068856_100448352 | 3300005614 | Unclassified | 1311 |
| 74 | Ga0068852_100031279 | 3300005616 | Bacteria | 4390 |
| 75 | Ga0068852_100191367 | 3300005616 | Bacteria | 1931 |
| 76 | Ga0068852_100258323 | 3300005616 | Bacteria | 1672 |
| 77 | Ga0068859_100927809 | 3300005617 | Bacteria | 955 |
| 78 | Ga0068864_100053841 | 3300005618 | Bacteria | 3472 |
| 79 | Ga0068864_100357381 | 3300005618 | Bacteria | 1380 |
| 80 | Ga0068861_100034115 | 3300005719 | Bacteria | 3761 |
| 81 | Ga0068851_10001096 | 3300005834 | Bacteria | 11756 |
| 82 | Ga0068863_100012353 | 3300005841 | Bacteria | 8246 |
| 83 | Ga0068858_100000391 | 3300005842 | Bacteria | 45896 |
| 84 | Ga0068860_100011611 | 3300005843 | Bacteria | 8688 |
| 85 | Ga0081539_10000382 | 3300005985 | Bacteria | 96235 |
| 86 | Ga0081539_10121923 | 3300005985 | Bacteria | 1293 |
| 87 | Ga0070715_10113679 | 3300006163 | Bacteria | 1281 |
| 88 | Ga0075366_10022330 | 3300006195 | Bacteria | 3680 |
| 89 | Ga0097621_100029042 | 3300006237 | Bacteria | 4364 |
| 90 | Ga0097621_100056118 | 3300006237 | Bacteria | 3217 |
| 91 | Ga0097621_100703368 | 3300006237 | Bacteria | 931 |
| 92 | Ga0068871_100004482 | 3300006358 | Bacteria | 9721 |
| 93 | Ga0068871_100007676 | 3300006358 | Bacteria | 7714 |
| 94 | Ga0068865_100001228 | 3300006881 | Bacteria | 14914 |
| 95 | Ga0097620_100927801 | 3300006931 | Bacteria | 955 |
| 96 | Ga0105240_10003619 | 3300009093 | Bacteria | 23928 |
| 97 | Ga0105240_10222848 | 3300009093 | Bacteria | 2196 |
| 98 | Ga0105247_10112649 | 3300009101 | Bacteria | 1753 |
| 99 | Ga0105241_10002270 | 3300009174 | Bacteria | 14447 |
| 100 | Ga0105242_10051252 | 3300009176 | Bacteria | 3363 |
| 101 | Ga0105248_10132290 | 3300009177 | Bacteria | 2815 |
| 102 | Ga0105237_10242977 | 3300009545 | Bacteria | 1802 |
| 103 | Ga0105249_10020717 | 3300009553 | Bacteria | 5879 |
| 104 | Ga0105239_10019811 | 3300010375 | Bacteria | 7425 |
| 105 | Ga0157373_10209438 | 3300013100 | Bacteria | 1375 |
| 106 | Ga0157371_10000373 | 3300013102 | Bacteria | 56546 |
| 107 | Ga0157371_10001416 | 3300013102 | Bacteria | 24929 |
| 108 | Ga0157371_10003865 | 3300013102 | Bacteria | 13362 |
| 109 | Ga0157371_10016268 | 3300013102 | Bacteria | 5556 |
| 110 | Ga0157371_10093468 | 3300013102 | Bacteria | 2131 |
| 111 | Ga0157371_10117198 | 3300013102 | Bacteria | 1893 |
| 112 | Ga0157371_10160688 | 3300013102 | Bacteria | 1604 |
| 113 | Ga0157371_10181606 | 3300013102 | Bacteria | 1505 |
| 114 | Ga0157370_10000530 | 3300013104 | Bacteria | 47795 |
| 115 | Ga0157370_10007937 | 3300013104 | Bacteria | 11494 |
| 116 | Ga0157370_10013359 | 3300013104 | Bacteria | 8459 |
| 117 | Ga0157370_10101786 | 3300013104 | Bacteria | 2690 |
| 118 | Ga0157370_10278144 | 3300013104 | Bacteria | 1547 |
| 119 | Ga0157369_10042815 | 3300013105 | Bacteria | 4939 |
| 120 | Ga0157369_10074483 | 3300013105 | Bacteria | 3641 |
| 121 | Ga0157369_10085423 | 3300013105 | Bacteria | 3372 |
| 122 | Ga0157369_10191822 | 3300013105 | Bacteria | 2147 |
| 123 | Ga0157369_10320228 | 3300013105 | Bacteria | 1612 |
| 124 | Ga0157374_10000909 | 3300013296 | Bacteria | 25741 |
| 125 | Ga0157374_10130010 | 3300013296 | Bacteria | 2436 |
| 126 | Ga0157374_10230645 | 3300013296 | Bacteria | 1818 |
| 127 | Ga0157374_10256138 | 3300013296 | Unclassified | 1723 |
| 128 | Ga0157374_10341490 | 3300013296 | Bacteria | 1487 |
| 129 | Ga0157378_10043428 | 3300013297 | Bacteria | 3991 |
| 130 | Ga0157378_10097825 | 3300013297 | Bacteria | 2675 |
| 131 | Ga0163162_10000029 | 3300013306 | Bacteria | 168510 |
| 132 | Ga0163162_10028038 | 3300013306 | Bacteria | 5570 |
| 133 | Ga0163162_10167359 | 3300013306 | Bacteria | 2322 |
| 134 | Ga0163162_10543544 | 3300013306 | Bacteria | 1290 |
| 135 | Ga0163162_11062573 | 3300013306 | Bacteria | 917 |
| 136 | Ga0157372_10031944 | 3300013307 | Bacteria | 5768 |
| 137 | Ga0157372_10032382 | 3300013307 | Bacteria | 5733 |
| 138 | Ga0157372_10046399 | 3300013307 | Bacteria | 4823 |
| 139 | Ga0157372_10150425 | 3300013307 | Bacteria | 2686 |
| 140 | Ga0157372_10184881 | 3300013307 | Bacteria | 2413 |
| 141 | Ga0157372_10213160 | 3300013307 | Bacteria | 2238 |
| 142 | Ga0157372_10254784 | 3300013307 | Bacteria | 2037 |
| 143 | Ga0157372_10876886 | 3300013307 | Bacteria | 1041 |
| 144 | Ga0157372_11091830 | 3300013307 | Unclassified | 923 |
| 145 | Ga0157375_10044559 | 3300013308 | Bacteria | 4311 |
| 146 | Ga0157375_10228714 | 3300013308 | Bacteria | 2019 |
| 147 | Ga0157375_10595951 | 3300013308 | Bacteria | 1265 |
| 148 | Ga0157375_11170568 | 3300013308 | Bacteria | 901 |
| 149 | Ga0163163_10000174 | 3300014325 | Bacteria | 67568 |
| 150 | Ga0163163_10697195 | 3300014325 | Bacteria | 1079 |
| 151 | Ga0157379_10000080 | 3300014968 | Bacteria | 63139 |
| 152 | Ga0157379_10049654 | 3300014968 | Bacteria | 3746 |
| 153 | Ga0157379_10299316 | 3300014968 | Bacteria | 1466 |
| 154 | Ga0157376_10002129 | 3300014969 | Bacteria | 13332 |
| 155 | Ga0157376_10119253 | 3300014969 | Unclassified | 2335 |
| 156 | Ga0157376_10181271 | 3300014969 | Bacteria | 1925 |
| 157 | Ga0157376_10248379 | 3300014969 | Bacteria | 1661 |
| 158 | Ga0157376_11034008 | 3300014969 | Bacteria | 845 |
| 159 | Ga0163161_10084194 | 3300017792 | Bacteria | 2345 |
| 160 | Ga0213876_10015559 | 3300021384 | Bacteria | 4025 |
| 161 | Ga0209258_100029 | 3300025242 | Bacteria | 490648 |
| 162 | Ga0209646_1000005 | 3300025246 | Bacteria | 717627 |
| 163 | Ga0209026_1000344 | 3300025250 | Bacteria | 44543 |
| 164 | Ga0209148_1000089 | 3300025254 | Bacteria | 253548 |
| 165 | Ga0209673_1000113 | 3300025273 | Bacteria | 179012 |
| 166 | Ga0209130_1003558 | 3300025284 | Bacteria | 6519 |
| 167 | Ga0209564_1017940 | 3300025295 | Bacteria | 2725 |
| 168 | Ga0209758_1001350 | 3300025297 | Bacteria | 29547 |
| 169 | Ga0209758_1029113 | 3300025297 | Bacteria | 2317 |
| 170 | Ga0209050_1000907 | 3300025298 | Bacteria | 39185 |
| 171 | Ga0207426_1000415 | 3300025302 | Bacteria | 70247 |
| 172 | Ga0207426_1000536 | 3300025302 | Bacteria | 54323 |
| 173 | Ga0207426_1000636 | 3300025302 | Bacteria | 44207 |
| 174 | Ga0207426_1012070 | 3300025302 | Bacteria | 3262 |
| 175 | Ga0209257_1004964 | 3300025304 | Bacteria | 9751 |
| 176 | Ga0207697_10063039 | 3300025315 | Bacteria | 1545 |
| 177 | Ga0207656_10017835 | 3300025321 | Bacteria | 2786 |
| 178 | Ga0207710_10071523 | 3300025900 | Unclassified | 1591 |
| 179 | Ga0207680_10024688 | 3300025903 | Bacteria | 3303 |
| 180 | Ga0207647_10294208 | 3300025904 | Bacteria | 925 |
| 181 | Ga0207645_10004351 | 3300025907 | Bacteria | 10489 |
| 182 | Ga0207645_10206109 | 3300025907 | Bacteria | 1294 |
| 183 | Ga0207705_10001332 | 3300025909 | Bacteria | 19775 |
| 184 | Ga0207705_10007051 | 3300025909 | Bacteria | 8289 |
| 185 | Ga0207705_10555759 | 3300025909 | Unclassified | 892 |
| 186 | Ga0207654_10017740 | 3300025911 | Bacteria | 3726 |
| 187 | Ga0207707_10013792 | 3300025912 | Bacteria | 7048 |
| 188 | Ga0207707_10274434 | 3300025912 | Bacteria | 1461 |
| 189 | Ga0207707_10285270 | 3300025912 | Bacteria | 1429 |
| 190 | Ga0207660_10041548 | 3300025917 | Bacteria | 3223 |
| 191 | Ga0207660_10161046 | 3300025917 | Bacteria | 1731 |
| 192 | Ga0207657_10403888 | 3300025919 | Bacteria | 1074 |
| 193 | Ga0207652_10000494 | 3300025921 | Bacteria | 40156 |
| 194 | Ga0207652_10000633 | 3300025921 | Bacteria | 34817 |
| 195 | Ga0207652_10014122 | 3300025921 | Bacteria | 6466 |
| 196 | Ga0207652_10109240 | 3300025921 | Bacteria | 2451 |
| 197 | Ga0207681_10235128 | 3300025923 | Bacteria | 1424 |
| 198 | Ga0207650_10147343 | 3300025925 | Bacteria | 1855 |
| 199 | Ga0207650_10324936 | 3300025925 | Bacteria | 1261 |
| 200 | Ga0207659_10031954 | 3300025926 | Bacteria | 3609 |
| 201 | Ga0207644_10240277 | 3300025931 | Bacteria | 1442 |
| 202 | Ga0207690_10005079 | 3300025932 | Bacteria | 7773 |
| 203 | Ga0207706_10004896 | 3300025933 | Bacteria | 12524 |
| 204 | Ga0207704_10005003 | 3300025938 | Bacteria | 6097 |
| 205 | Ga0207691_10000004 | 3300025940 | Bacteria | 168729 |
| 206 | Ga0207691_10287253 | 3300025940 | Bacteria | 1415 |
| 207 | Ga0207711_10102862 | 3300025941 | Bacteria | 2529 |
| 208 | Ga0207689_10055497 | 3300025942 | Bacteria | 3260 |
| 209 | Ga0207679_10491389 | 3300025945 | Bacteria | 1094 |
| 210 | Ga0207679_10866441 | 3300025945 | Bacteria | 825 |
| 211 | Ga0207667_10000936 | 3300025949 | Bacteria | 37241 |
| 212 | Ga0207667_10049503 | 3300025949 | Bacteria | 4437 |
| 213 | Ga0207667_10106906 | 3300025949 | Bacteria | 2886 |
| 214 | Ga0207667_10741724 | 3300025949 | Bacteria | 982 |
| 215 | Ga0207651_10016146 | 3300025960 | Bacteria | 4363 |
| 216 | Ga0207712_10030998 | 3300025961 | Bacteria | 3599 |
| 217 | Ga0207668_10000298 | 3300025972 | Bacteria | 32532 |
| 218 | Ga0207658_10005678 | 3300025986 | Bacteria | 8530 |
| 219 | Ga0207677_10248915 | 3300026023 | Bacteria | 1442 |
| 220 | Ga0207703_10084588 | 3300026035 | Bacteria | 2653 |
| 221 | Ga0207639_10204157 | 3300026041 | Bacteria | 1697 |
| 222 | Ga0207639_10523219 | 3300026041 | Bacteria | 1086 |
| 223 | Ga0207639_10703168 | 3300026041 | Bacteria | 938 |
| 224 | Ga0207639_10715865 | 3300026041 | Bacteria | 929 |
| 225 | Ga0207678_10146584 | 3300026067 | Bacteria | 2015 |
| 226 | Ga0207702_10402216 | 3300026078 | Bacteria | 1321 |
| 227 | Ga0207702_10869627 | 3300026078 | Bacteria | 893 |
| 228 | Ga0207641_10010103 | 3300026088 | Bacteria | 7761 |
| 229 | Ga0207648_10016863 | 3300026089 | Bacteria | 6660 |
| 230 | Ga0207676_10003554 | 3300026095 | Bacteria | 11027 |
| 231 | Ga0207676_10160921 | 3300026095 | Bacteria | 1945 |
| 232 | Ga0207676_10311859 | 3300026095 | Bacteria | 1441 |
| 233 | Ga0207675_100113208 | 3300026118 | Bacteria | 2562 |
| 234 | Ga0207683_10102530 | 3300026121 | Bacteria | 2555 |
| 235 | Ga0207698_10087631 | 3300026142 | Bacteria | 2536 |
| 236 | Ga0207698_10137812 | 3300026142 | Bacteria | 2097 |
| 237 | Ga0268266_10062872 | 3300028379 | Bacteria | 3204 |
| 238 | Ga0268264_10003219 | 3300028381 | Bacteria | 14141 |
| 239 | Ga0265338_10060287 | 3300028800 | Bacteria | 3336 |
| 240 | Ga0265327_10054898 | 3300031251 | Bacteria | 2060 |
| 241 | Ga0265316_10100086 | 3300031344 | Bacteria | 2204 |
| 242 | Ga0307408_100171887 | 3300031548 | Unclassified | 1731 |
| 243 | Ga0373943_0129459 | 3300035170 | Bacteria | 1349 |
| 244 | Ga0373955_0345773 | 3300035172 | Bacteria | 900 |
| 245 | Ga0373955_0425018 | 3300035172 | Bacteria | 808 |
| 246 | Ga0373933_0395895 | 3300035724 | Bacteria | 901 |
| 247 | Ga0373937_0009187 | 3300036401 | Bacteria | 8581 |
| 248 | Ga0373937_0778651 | 3300036401 | Bacteria | 904 |
| 249 | Ga0395899_0001371 | 3300037312 | Bacteria | 20896 |
| 250 | Ga0395899_0015683 | 3300037312 | Bacteria | 5777 |
| 251 | Ga0395899_0077210 | 3300037312 | Bacteria | 2429 |
| 252 | Ga0395899_0205336 | 3300037312 | Unclassified | 1371 |
| 253 | Ga0395900_0000203 | 3300037418 | Bacteria | 93536 |
| 254 | Ga0395900_0011411 | 3300037418 | Bacteria | 9093 |
| 255 | Ga0395900_0020467 | 3300037418 | Bacteria | 6753 |
| 256 | Ga0395900_0295456 | 3300037418 | Bacteria | 1608 |
| 257 | Ga0395900_0457519 | 3300037418 | Unclassified | 1231 |
| 258 | Ga0395900_0458123 | 3300037418 | Unclassified | 1230 |
| 259 | Ga0395900_0497080 | 3300037418 | Bacteria | 1170 |
| 260 | Ga0395898_0001978 | 3300037466 | Bacteria | 25752 |
| 261 | Ga0395898_0006508 | 3300037466 | Bacteria | 12481 |
| 262 | Ga0395898_0080335 | 3300037466 | Bacteria | 3145 |
| 263 | Ga0395898_0114213 | 3300037466 | Bacteria | 2587 |
| 264 | Ga0395898_0673564 | 3300037466 | Bacteria | 976 |
| 265 | Ga0395905_0019205 | 3300037471 | Bacteria | 6481 |
| 266 | Ga0395905_0125146 | 3300037471 | Unclassified | 2417 |
| 267 | Ga0395901_0012648 | 3300038443 | Bacteria | 8563 |
| 268 | Ga0395901_0025579 | 3300038443 | Bacteria | 6059 |
| 269 | Ga0395901_0035421 | 3300038443 | Bacteria | 5156 |
| 270 | Ga0395901_0191836 | 3300038443 | Unclassified | 2142 |
| 271 | Ga0395901_0473544 | 3300038443 | Bacteria | 1278 |
| 272 | Ga0395901_0798997 | 3300038443 | Bacteria | 932 |
| 273 | Ga0436365_1345967 | 3300039437 | Bacteria | 27431 |
| 274 | Ga0436365_1568167 | 3300039437 | Bacteria | 756 |
| 275 | Ga0466972_0000010 | 3300044658 | Bacteria | 256339 |
| 276 | Ga0466968_0288231 | 3300044735 | Bacteria | 787 |
| 277 | Ga0466970_0000246 | 3300044765 | Bacteria | 26542 |
| 278 | Ga0466957_0015506 | 3300044842 | Bacteria | 4451 |
| 279 | Ga0466959_0398696 | 3300045049 | Bacteria | 935 |
| 280 | Ga0495629_0162268 | 3300046459 | Bacteria | 1552 |
| 281 | Ga0495582_0291156 | 3300046473 | Bacteria | 938 |
| 282 | Ga0495652_0071302 | 3300046529 | Bacteria | 2901 |
| 283 | Ga0495665_0124170 | 3300046531 | Bacteria | 1352 |
| 284 | Ga0495587_0241403 | 3300046536 | Bacteria | 1017 |
| 285 | Ga0495645_0453916 | 3300046543 | Bacteria | 808 |
| 286 | Ga0495667_0097184 | 3300046559 | Bacteria | 1907 |
| 287 | Ga0495635_0063631 | 3300046663 | Bacteria | 2533 |
| 288 | Ga0495658_0016551 | 3300046683 | Bacteria | 3795 |
| 289 | Ga0495624_0336149 | 3300046690 | Bacteria | 909 |
| 290 | Ga0495674_0019574 | 3300047319 | Bacteria | 6280 |
| 291 | Ga0495684_0294821 | 3300047471 | Bacteria | 1166 |
| 292 | Ga0495686_0020338 | 3300047472 | Bacteria | 4427 |
| 293 | Ga0495686_0101531 | 3300047472 | Bacteria | 1734 |
| 294 | Ga0495686_0311899 | 3300047472 | Bacteria | 865 |
| 295 | Ga0496101_0448655 | 3300048904 | Bacteria | 1018 |
| 296 | Ga0496102_0506306 | 3300048905 | Bacteria | 1130 |
| 297 | Ga0496105_0108312 | 3300048908 | Bacteria | 2294 |
| 298 | Ga0496109_0602969 | 3300048912 | Bacteria | 1034 |
| 299 | Ga0496114_0574886 | 3300048917 | Bacteria | 995 |
| 300 | Ga0496115_0057329 | 3300048918 | Bacteria | 3133 |
| 301 | Ga0496115_0312690 | 3300048918 | Bacteria | 1286 |
| 302 | Ga0496121_0000008 | 3300048924 | Bacteria | 843593 |
| 303 | Ga0501032_0005855 | 3300049569 | Bacteria | 9093 |
| 304 | Ga0501032_0077969 | 3300049569 | Bacteria | 2206 |
| 305 | Ga0501033_0116809 | 3300049570 | Bacteria | 1938 |
| 306 | Ga0501034_0215975 | 3300049571 | Bacteria | 1871 |
| 307 | Ga0501036_0042103 | 3300049572 | Bacteria | 3866 |
| 308 | Ga0501043_0366919 | 3300049579 | Unclassified | 1092 |
| 309 | Ga0501046_0357428 | 3300049580 | Bacteria | 1059 |
| 310 | Ga0501047_0039420 | 3300049581 | Bacteria | 4569 |
| 311 | Ga0501047_0172931 | 3300049581 | Bacteria | 2028 |
| 312 | Ga0501047_0687706 | 3300049581 | Bacteria | 841 |
| 313 | Ga0501048_0141420 | 3300049582 | Bacteria | 1702 |
| 314 | Ga0501067_0058364 | 3300049583 | Bacteria | 2137 |
| 315 | Ga0501069_0121564 | 3300049585 | Bacteria | 1491 |
| 316 | Ga0501070_0430042 | 3300049586 | Bacteria | 1065 |
| 317 | Ga0501073_0161284 | 3300049589 | Bacteria | 1553 |
| 318 | Ga0501074_0682892 | 3300049590 | Bacteria | 725 |
| 319 | Ga0501083_0041026 | 3300049744 | Bacteria | 3140 |
| 320 | Ga0501035_0018145 | 3300049822 | Bacteria | 6483 |
| 321 | Ga0501044_0073923 | 3300049823 | Bacteria | 3464 |
| 322 | nmdc:mga0k408_46785_c1 | 3300050493 | Bacteria | 2499 |
| 323 | Ga0500644_0000155 | 3300053088 | Bacteria | 42910 |
| 324 | Ga0500646_0011388 | 3300053090 | Bacteria | 2288 |
| 325 | Ga0500583_0005371 | 3300053092 | Bacteria | 4288 |
| 326 | Ga0500562_000032 | 3300053108 | Bacteria | 89989 |
| 327 | Ga0500569_013999 | 3300053109 | Bacteria | 1977 |
| 328 | Ga0500594_0023725 | 3300053118 | Bacteria | 1558 |
| 329 | Ga0500607_065250 | 3300053121 | Bacteria | 1893 |
| 330 | Ga0500658_0003427 | 3300053134 | Bacteria | 5989 |
| 331 | Ga0500561_0047827 | 3300053137 | Bacteria | 1156 |
| 332 | Ga0500577_0007350 | 3300053142 | Bacteria | 3083 |
| 333 | Ga0500590_040711 | 3300053148 | Bacteria | 2393 |
| 334 | Ga0500616_0014614 | 3300053153 | Bacteria | 4507 |
| 335 | Ga0500622_0007104 | 3300053156 | Bacteria | 6399 |
| 336 | Ga0500633_0188385 | 3300053160 | Bacteria | 773 |
| 337 | Ga0500636_0029428 | 3300053177 | Bacteria | 3245 |
| 338 | Ga0500645_106487 | 3300053730 | Bacteria | 788 |
| 339 | Ga0501084_0030393 | 3300054114 | Bacteria | 4518 |
| 340 | Ga0501084_0126175 | 3300054114 | Bacteria | 2153 |
| 341 | Ga0500661_011473 | 3300055283 | Bacteria | 1603 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049590 | Ga0501074_0682892 | Ga0501074_0682892_31_534 | 167 |
| 2 | 3300053160 | Ga0500633_0188385 | Ga0500633_0188385_66_608 | 170 |
| 3 | 3300053730 | Ga0500645_106487 | Ga0500645_106487_17_577 | 182 |
| 4 | 3300053109 | Ga0500569_013999 | Ga0500569_013999_377_967 | 186 |
| 5 | 3300013105 | Ga0157369_10320228 | Ga0157369_103202282 | 189 |
| 6 | 3300014969 | Ga0157376_11034008 | Ga0157376_110340081 | 189 |
| 7 | 3300021384 | Ga0213876_10015559 | Ga0213876_100155592 | 189 |
| 8 | 3300003323 | rootH1_10108487 | rootH1_101084872 | 194 |
| 9 | 3300006237 | Ga0097621_100703368 | Ga0097621_1007033682 | 195 |
| 10 | 3300003322 | rootL2_10337904 | rootL2_103379041 | 198 |
| 11 | 3300053090 | Ga0500646_0011388 | Ga0500646_0011388_268_894 | 198 |
| 12 | 3300053134 | Ga0500658_0003427 | Ga0500658_0003427_3640_4266 | 198 |
| 13 | 3300053142 | Ga0500577_0007350 | Ga0500577_0007350_1873_2499 | 198 |
| 14 | 3300053153 | Ga0500616_0014614 | Ga0500616_0014614_732_1358 | 198 |
| 15 | 3300053092 | Ga0500583_0005371 | Ga0500583_0005371_1465_2091 | 200 |
| 16 | 3300053148 | Ga0500590_040711 | Ga0500590_040711_1603_2229 | 200 |
| 17 | iso_pu_bacteria | 2929154850 | 2929158454 | 200 |
| 18 | 3300047472 | Ga0495686_0311899 | Ga0495686_0311899_22_642 | 202 |
| 19 | 3300053108 | Ga0500562_000032 | Ga0500562_000032_39951_40571 | 202 |
| 20 | 3300053118 | Ga0500594_0023725 | Ga0500594_0023725_780_1400 | 202 |
| 21 | 3300053156 | Ga0500622_0007104 | Ga0500622_0007104_1727_2347 | 202 |
| 22 | 3300053177 | Ga0500636_0029428 | Ga0500636_0029428_1226_1858 | 202 |
| 23 | 3300005331 | Ga0070670_100367468 | Ga0070670_1003674681 | 203 |
| 24 | 3300005334 | Ga0068869_100965087 | Ga0068869_1009650871 | 203 |
| 25 | 3300005530 | Ga0070679_100277375 | Ga0070679_1002773752 | 203 |
| 26 | 3300025925 | Ga0207650_10147343 | Ga0207650_101473433 | 203 |
| 27 | iso_pu_bacteria | 2884791551 | 2884797287 | 203 |
| 28 | iso_pu_bacteria | 2929177148 | 2929177244 | 203 |
| 29 | iso_pu_bacteria | 2945977869 | 2945979613 | 203 |
| 30 | iso_pu_bacteria | 2946013367 | 2946014520 | 203 |
| 31 | 3300003320 | rootH2_10092063 | rootH2_100920632 | 204 |
| 32 | 3300031251 | Ga0265327_10054898 | Ga0265327_100548981 | 204 |
| 33 | 3300037418 | Ga0395900_0295456 | Ga0395900_0295456_601_1233 | 204 |
| 34 | 3300048918 | Ga0496115_0057329 | Ga0496115_0057329_2491_3111 | 204 |
| 35 | iso_pu_bacteria | 2821136567 | 2821143165 | 204 |
| 36 | iso_pu_bacteria | 2904467357 | 2904470883 | 204 |
| 37 | iso_pu_bacteria | 2929239360 | 2929239666 | 204 |
| 38 | 3300003203 | JGI25406J46586_10019511 | JGI25406J46586_100195112 | 205 |
| 39 | 3300005564 | Ga0070664_101134555 | Ga0070664_1011345551 | 205 |
| 40 | 3300005616 | Ga0068852_100191367 | Ga0068852_1001913672 | 205 |
| 41 | 3300005985 | Ga0081539_10000382 | Ga0081539_1000038286 | 205 |
| 42 | 3300013102 | Ga0157371_10117198 | Ga0157371_101171982 | 205 |
| 43 | 3300013105 | Ga0157369_10085423 | Ga0157369_100854232 | 205 |
| 44 | 3300025919 | Ga0207657_10403888 | Ga0207657_104038882 | 205 |
| 45 | 3300025945 | Ga0207679_10866441 | Ga0207679_108664411 | 205 |
| 46 | 3300039437 | Ga0436365_1568167 | Ga0436365_1568167_80_697 | 205 |
| 47 | iso_pu_bacteria | 2818991442 | 2819576608 | 205 |
| 48 | iso_pu_bacteria | 2818991460 | 2819677354 | 205 |
| 49 | 3300005327 | Ga0070658_10003542 | Ga0070658_100035429 | 206 |
| 50 | 3300005328 | Ga0070676_10014867 | Ga0070676_100148672 | 206 |
| 51 | 3300005328 | Ga0070676_10113286 | Ga0070676_101132861 | 206 |
| 52 | 3300005333 | Ga0070677_10355912 | Ga0070677_103559121 | 206 |
| 53 | 3300005334 | Ga0068869_100046555 | Ga0068869_1000465552 | 206 |
| 54 | 3300005335 | Ga0070666_10003892 | Ga0070666_100038927 | 206 |
| 55 | 3300005336 | Ga0070680_100000590 | Ga0070680_1000005902 | 206 |
| 56 | 3300005336 | Ga0070680_100085411 | Ga0070680_1000854112 | 206 |
| 57 | 3300005337 | Ga0070682_100007389 | Ga0070682_1000073896 | 206 |
| 58 | 3300005338 | Ga0068868_100048550 | Ga0068868_1000485502 | 206 |
| 59 | 3300005338 | Ga0068868_100173295 | Ga0068868_1001732951 | 206 |
| 60 | 3300005339 | Ga0070660_100364939 | Ga0070660_1003649391 | 206 |
| 61 | 3300005341 | Ga0070691_10004283 | Ga0070691_100042831 | 206 |
| 62 | 3300005343 | Ga0070687_100011524 | Ga0070687_1000115245 | 206 |
| 63 | 3300005347 | Ga0070668_100002414 | Ga0070668_10000241410 | 206 |
| 64 | 3300005353 | Ga0070669_100227463 | Ga0070669_1002274632 | 206 |
| 65 | 3300005355 | Ga0070671_100110593 | Ga0070671_1001105932 | 206 |
| 66 | 3300005364 | Ga0070673_100000160 | Ga0070673_1000001605 | 206 |
| 67 | 3300005365 | Ga0070688_100292238 | Ga0070688_1002922382 | 206 |
| 68 | 3300005367 | Ga0070667_100000031 | Ga0070667_10000003113 | 206 |
| 69 | 3300005456 | Ga0070678_100101053 | Ga0070678_1001010532 | 206 |
| 70 | 3300005457 | Ga0070662_100001909 | Ga0070662_10000190910 | 206 |
| 71 | 3300005458 | Ga0070681_10061239 | Ga0070681_100612393 | 206 |
| 72 | 3300005459 | Ga0068867_100037819 | Ga0068867_1000378194 | 206 |
| 73 | 3300005530 | Ga0070679_100010172 | Ga0070679_1000101722 | 206 |
| 74 | 3300005539 | Ga0068853_100056085 | Ga0068853_1000560853 | 206 |
| 75 | 3300005539 | Ga0068853_100087541 | Ga0068853_1000875411 | 206 |
| 76 | 3300005539 | Ga0068853_100418993 | Ga0068853_1004189931 | 206 |
| 77 | 3300005543 | Ga0070672_100600473 | Ga0070672_1006004732 | 206 |
| 78 | 3300005547 | Ga0070693_100021205 | Ga0070693_1000212055 | 206 |
| 79 | 3300005548 | Ga0070665_100002650 | Ga0070665_10000265010 | 206 |
| 80 | 3300005563 | Ga0068855_100020524 | Ga0068855_1000205248 | 206 |
| 81 | 3300005563 | Ga0068855_100041367 | Ga0068855_1000413675 | 206 |
| 82 | 3300005563 | Ga0068855_100838619 | Ga0068855_1008386192 | 206 |
| 83 | 3300005564 | Ga0070664_100543387 | Ga0070664_1005433872 | 206 |
| 84 | 3300005577 | Ga0068857_100384427 | Ga0068857_1003844272 | 206 |
| 85 | 3300005616 | Ga0068852_100031279 | Ga0068852_1000312793 | 206 |
| 86 | 3300005616 | Ga0068852_100258323 | Ga0068852_1002583232 | 206 |
| 87 | 3300005617 | Ga0068859_100927809 | Ga0068859_1009278092 | 206 |
| 88 | 3300005618 | Ga0068864_100053841 | Ga0068864_1000538413 | 206 |
| 89 | 3300005618 | Ga0068864_100357381 | Ga0068864_1003573812 | 206 |
| 90 | 3300005719 | Ga0068861_100034115 | Ga0068861_1000341153 | 206 |
| 91 | 3300005834 | Ga0068851_10001096 | Ga0068851_100010964 | 206 |
| 92 | 3300005841 | Ga0068863_100012353 | Ga0068863_1000123536 | 206 |
| 93 | 3300005842 | Ga0068858_100000391 | Ga0068858_1000003915 | 206 |
| 94 | 3300005843 | Ga0068860_100011611 | Ga0068860_1000116116 | 206 |
| 95 | 3300005985 | Ga0081539_10121923 | Ga0081539_101219231 | 206 |
| 96 | 3300006163 | Ga0070715_10113679 | Ga0070715_101136792 | 206 |
| 97 | 3300006237 | Ga0097621_100029042 | Ga0097621_1000290421 | 206 |
| 98 | 3300006237 | Ga0097621_100056118 | Ga0097621_1000561182 | 206 |
| 99 | 3300006358 | Ga0068871_100004482 | Ga0068871_10000448211 | 206 |
| 100 | 3300006358 | Ga0068871_100007676 | Ga0068871_1000076767 | 206 |
| 101 | 3300006881 | Ga0068865_100001228 | Ga0068865_10000122813 | 206 |
| 102 | 3300006931 | Ga0097620_100927801 | Ga0097620_1009278012 | 206 |
| 103 | 3300009093 | Ga0105240_10003619 | Ga0105240_100036193 | 206 |
| 104 | 3300009101 | Ga0105247_10112649 | Ga0105247_101126491 | 206 |
| 105 | 3300009174 | Ga0105241_10002270 | Ga0105241_1000227011 | 206 |
| 106 | 3300009176 | Ga0105242_10051252 | Ga0105242_100512522 | 206 |
| 107 | 3300009177 | Ga0105248_10132290 | Ga0105248_101322902 | 206 |
| 108 | 3300009545 | Ga0105237_10242977 | Ga0105237_102429772 | 206 |
| 109 | 3300009553 | Ga0105249_10020717 | Ga0105249_100207172 | 206 |
| 110 | 3300010375 | Ga0105239_10019811 | Ga0105239_100198113 | 206 |
| 111 | 3300013104 | Ga0157370_10013359 | Ga0157370_100133594 | 206 |
| 112 | 3300013105 | Ga0157369_10074483 | Ga0157369_100744832 | 206 |
| 113 | 3300013105 | Ga0157369_10191822 | Ga0157369_101918222 | 206 |
| 114 | 3300013296 | Ga0157374_10000909 | Ga0157374_1000090922 | 206 |
| 115 | 3300013296 | Ga0157374_10130010 | Ga0157374_101300103 | 206 |
| 116 | 3300013296 | Ga0157374_10230645 | Ga0157374_102306452 | 206 |
| 117 | 3300013296 | Ga0157374_10256138 | Ga0157374_102561382 | 206 |
| 118 | 3300013296 | Ga0157374_10341490 | Ga0157374_103414901 | 206 |
| 119 | 3300013297 | Ga0157378_10043428 | Ga0157378_100434285 | 206 |
| 120 | 3300013297 | Ga0157378_10097825 | Ga0157378_100978252 | 206 |
| 121 | 3300013306 | Ga0163162_10000029 | Ga0163162_100000295 | 206 |
| 122 | 3300013306 | Ga0163162_10028038 | Ga0163162_100280384 | 206 |
| 123 | 3300013306 | Ga0163162_10167359 | Ga0163162_101673594 | 206 |
| 124 | 3300013306 | Ga0163162_10543544 | Ga0163162_105435441 | 206 |
| 125 | 3300013306 | Ga0163162_11062573 | Ga0163162_110625732 | 206 |
| 126 | 3300013307 | Ga0157372_10150425 | Ga0157372_101504252 | 206 |
| 127 | 3300013307 | Ga0157372_10876886 | Ga0157372_108768862 | 206 |
| 128 | 3300013307 | Ga0157372_11091830 | Ga0157372_110918302 | 206 |
| 129 | 3300013308 | Ga0157375_10044559 | Ga0157375_100445594 | 206 |
| 130 | 3300013308 | Ga0157375_10228714 | Ga0157375_102287142 | 206 |
| 131 | 3300013308 | Ga0157375_10595951 | Ga0157375_105959512 | 206 |
| 132 | 3300013308 | Ga0157375_11170568 | Ga0157375_111705681 | 206 |
| 133 | 3300014325 | Ga0163163_10000174 | Ga0163163_1000017413 | 206 |
| 134 | 3300014325 | Ga0163163_10697195 | Ga0163163_106971952 | 206 |
| 135 | 3300014968 | Ga0157379_10000080 | Ga0157379_1000008061 | 206 |
| 136 | 3300014968 | Ga0157379_10049654 | Ga0157379_100496543 | 206 |
| 137 | 3300014968 | Ga0157379_10299316 | Ga0157379_102993162 | 206 |
| 138 | 3300014969 | Ga0157376_10002129 | Ga0157376_100021295 | 206 |
| 139 | 3300014969 | Ga0157376_10119253 | Ga0157376_101192533 | 206 |
| 140 | 3300014969 | Ga0157376_10181271 | Ga0157376_101812712 | 206 |
| 141 | 3300014969 | Ga0157376_10248379 | Ga0157376_102483792 | 206 |
| 142 | 3300017792 | Ga0163161_10084194 | Ga0163161_100841942 | 206 |
| 143 | 3300025315 | Ga0207697_10063039 | Ga0207697_100630392 | 206 |
| 144 | 3300025321 | Ga0207656_10017835 | Ga0207656_100178353 | 206 |
| 145 | 3300025900 | Ga0207710_10071523 | Ga0207710_100715231 | 206 |
| 146 | 3300025903 | Ga0207680_10024688 | Ga0207680_100246882 | 206 |
| 147 | 3300025904 | Ga0207647_10294208 | Ga0207647_102942082 | 206 |
| 148 | 3300025907 | Ga0207645_10004351 | Ga0207645_100043518 | 206 |
| 149 | 3300025907 | Ga0207645_10206109 | Ga0207645_102061092 | 206 |
| 150 | 3300025909 | Ga0207705_10007051 | Ga0207705_100070515 | 206 |
| 151 | 3300025911 | Ga0207654_10017740 | Ga0207654_100177402 | 206 |
| 152 | 3300025912 | Ga0207707_10013792 | Ga0207707_100137923 | 206 |
| 153 | 3300025917 | Ga0207660_10161046 | Ga0207660_101610462 | 206 |
| 154 | 3300025921 | Ga0207652_10014122 | Ga0207652_100141226 | 206 |
| 155 | 3300025926 | Ga0207659_10031954 | Ga0207659_100319545 | 206 |
| 156 | 3300025931 | Ga0207644_10240277 | Ga0207644_102402771 | 206 |
| 157 | 3300025933 | Ga0207706_10004896 | Ga0207706_100048965 | 206 |
| 158 | 3300025938 | Ga0207704_10005003 | Ga0207704_100050036 | 206 |
| 159 | 3300025940 | Ga0207691_10000004 | Ga0207691_100000045 | 206 |
| 160 | 3300025940 | Ga0207691_10287253 | Ga0207691_102872531 | 206 |
| 161 | 3300025941 | Ga0207711_10102862 | Ga0207711_101028621 | 206 |
| 162 | 3300025942 | Ga0207689_10055497 | Ga0207689_100554971 | 206 |
| 163 | 3300025945 | Ga0207679_10491389 | Ga0207679_104913892 | 206 |
| 164 | 3300025949 | Ga0207667_10106906 | Ga0207667_101069062 | 206 |
| 165 | 3300025949 | Ga0207667_10741724 | Ga0207667_107417242 | 206 |
| 166 | 3300025960 | Ga0207651_10016146 | Ga0207651_100161465 | 206 |
| 167 | 3300025961 | Ga0207712_10030998 | Ga0207712_100309982 | 206 |
| 168 | 3300025972 | Ga0207668_10000298 | Ga0207668_1000029813 | 206 |
| 169 | 3300025986 | Ga0207658_10005678 | Ga0207658_100056786 | 206 |
| 170 | 3300026023 | Ga0207677_10248915 | Ga0207677_102489152 | 206 |
| 171 | 3300026035 | Ga0207703_10084588 | Ga0207703_100845883 | 206 |
| 172 | 3300026041 | Ga0207639_10204157 | Ga0207639_102041572 | 206 |
| 173 | 3300026041 | Ga0207639_10715865 | Ga0207639_107158652 | 206 |
| 174 | 3300026088 | Ga0207641_10010103 | Ga0207641_100101034 | 206 |
| 175 | 3300026089 | Ga0207648_10016863 | Ga0207648_100168637 | 206 |
| 176 | 3300026095 | Ga0207676_10003554 | Ga0207676_100035543 | 206 |
| 177 | 3300026095 | Ga0207676_10160921 | Ga0207676_101609212 | 206 |
| 178 | 3300026095 | Ga0207676_10311859 | Ga0207676_103118592 | 206 |
| 179 | 3300026118 | Ga0207675_100113208 | Ga0207675_1001132082 | 206 |
| 180 | 3300026121 | Ga0207683_10102530 | Ga0207683_101025302 | 206 |
| 181 | 3300026142 | Ga0207698_10087631 | Ga0207698_100876312 | 206 |
| 182 | 3300026142 | Ga0207698_10137812 | Ga0207698_101378121 | 206 |
| 183 | 3300028379 | Ga0268266_10062872 | Ga0268266_100628724 | 206 |
| 184 | 3300028381 | Ga0268264_10003219 | Ga0268264_1000321911 | 206 |
| 185 | 3300028800 | Ga0265338_10060287 | Ga0265338_100602872 | 206 |
| 186 | 3300031344 | Ga0265316_10100086 | Ga0265316_101000863 | 206 |
| 187 | 3300035170 | Ga0373943_0129459 | Ga0373943_0129459_232_858 | 206 |
| 188 | 3300035172 | Ga0373955_0345773 | Ga0373955_0345773_51_680 | 206 |
| 189 | 3300035172 | Ga0373955_0425018 | Ga0373955_0425018_154_780 | 206 |
| 190 | 3300035724 | Ga0373933_0395895 | Ga0373933_0395895_206_832 | 206 |
| 191 | 3300036401 | Ga0373937_0009187 | Ga0373937_0009187_7581_8210 | 206 |
| 192 | 3300036401 | Ga0373937_0778651 | Ga0373937_0778651_115_741 | 206 |
| 193 | 3300039437 | Ga0436365_1345967 | Ga0436365_1345967_11838_12458 | 206 |
| 194 | 3300044658 | Ga0466972_0000010 | Ga0466972_0000010_2354_3025 | 206 |
| 195 | 3300044765 | Ga0466970_0000246 | Ga0466970_0000246_25515_26186 | 206 |
| 196 | 3300046459 | Ga0495629_0162268 | Ga0495629_0162268_43_669 | 206 |
| 197 | 3300046473 | Ga0495582_0291156 | Ga0495582_0291156_143_769 | 206 |
| 198 | 3300046529 | Ga0495652_0071302 | Ga0495652_0071302_490_1116 | 206 |
| 199 | 3300046531 | Ga0495665_0124170 | Ga0495665_0124170_146_772 | 206 |
| 200 | 3300046536 | Ga0495587_0241403 | Ga0495587_0241403_162_788 | 206 |
| 201 | 3300046543 | Ga0495645_0453916 | Ga0495645_0453916_117_743 | 206 |
| 202 | 3300046559 | Ga0495667_0097184 | Ga0495667_0097184_651_1277 | 206 |
| 203 | 3300046663 | Ga0495635_0063631 | Ga0495635_0063631_1471_2097 | 206 |
| 204 | 3300046683 | Ga0495658_0016551 | Ga0495658_0016551_1907_2533 | 206 |
| 205 | 3300046690 | Ga0495624_0336149 | Ga0495624_0336149_79_705 | 206 |
| 206 | 3300047319 | Ga0495674_0019574 | Ga0495674_0019574_2408_3034 | 206 |
| 207 | 3300047471 | Ga0495684_0294821 | Ga0495684_0294821_125_751 | 206 |
| 208 | 3300048904 | Ga0496101_0448655 | Ga0496101_0448655_244_867 | 206 |
| 209 | 3300048905 | Ga0496102_0506306 | Ga0496102_0506306_434_1054 | 206 |
| 210 | 3300048908 | Ga0496105_0108312 | Ga0496105_0108312_398_1024 | 206 |
| 211 | 3300048912 | Ga0496109_0602969 | Ga0496109_0602969_220_843 | 206 |
| 212 | 3300048917 | Ga0496114_0574886 | Ga0496114_0574886_25_651 | 206 |
| 213 | 3300048918 | Ga0496115_0312690 | Ga0496115_0312690_635_1261 | 206 |
| 214 | 3300049581 | Ga0501047_0039420 | Ga0501047_0039420_13_633 | 206 |
| 215 | 3300049581 | Ga0501047_0687706 | Ga0501047_0687706_14_634 | 206 |
| 216 | 3300049582 | Ga0501048_0141420 | Ga0501048_0141420_471_1091 | 206 |
| 217 | 3300049583 | Ga0501067_0058364 | Ga0501067_0058364_217_837 | 206 |
| 218 | 3300049585 | Ga0501069_0121564 | Ga0501069_0121564_102_722 | 206 |
| 219 | 3300049586 | Ga0501070_0430042 | Ga0501070_0430042_189_809 | 206 |
| 220 | 3300049589 | Ga0501073_0161284 | Ga0501073_0161284_155_775 | 206 |
| 221 | 3300049744 | Ga0501083_0041026 | Ga0501083_0041026_518_1138 | 206 |
| 222 | 3300054114 | Ga0501084_0126175 | Ga0501084_0126175_922_1542 | 206 |
| 223 | iso_pu_bacteria | 8003151029 | 8003157653 | 206 |
| 224 | 3300003320 | rootH2_10076019 | rootH2_100760194 | 207 |
| 225 | 3300003323 | rootH1_10007323 | rootH1_1000732320 | 207 |
| 226 | 3300013102 | Ga0157371_10000373 | Ga0157371_100003739 | 207 |
| 227 | 3300013104 | Ga0157370_10101786 | Ga0157370_101017862 | 207 |
| 228 | 3300025284 | Ga0209130_1003558 | Ga0209130_10035585 | 207 |
| 229 | 3300025302 | Ga0207426_1000415 | Ga0207426_100041524 | 207 |
| 230 | 3300025925 | Ga0207650_10324936 | Ga0207650_103249361 | 207 |
| 231 | 3300049569 | Ga0501032_0005855 | Ga0501032_0005855_159_791 | 207 |
| 232 | 3300049572 | Ga0501036_0042103 | Ga0501036_0042103_603_1235 | 207 |
| 233 | 3300049580 | Ga0501046_0357428 | Ga0501046_0357428_11_643 | 207 |
| 234 | 3300049581 | Ga0501047_0172931 | Ga0501047_0172931_417_1049 | 207 |
| 235 | 3300054114 | Ga0501084_0030393 | Ga0501084_0030393_3416_4048 | 207 |
| 236 | 3300005262 | Ga0065165_1004399 | Ga0065165_10043995 | 208 |
| 237 | 3300025302 | Ga0207426_1012070 | Ga0207426_10120704 | 208 |
| 238 | 3300025923 | Ga0207681_10235128 | Ga0207681_102351282 | 208 |
| 239 | 3300026041 | Ga0207639_10703168 | Ga0207639_107031682 | 208 |
| 240 | 3300031548 | Ga0307408_100171887 | Ga0307408_1001718872 | 208 |
| 241 | 3300044735 | Ga0466968_0288231 | Ga0466968_0288231_88_714 | 208 |
| 242 | 3300045049 | Ga0466959_0398696 | Ga0466959_0398696_243_869 | 208 |
| 243 | 3300053088 | Ga0500644_0000155 | Ga0500644_0000155_38042_38668 | 208 |
| 244 | 3300053121 | Ga0500607_065250 | Ga0500607_065250_1243_1869 | 208 |
| 245 | 3300053137 | Ga0500561_0047827 | Ga0500561_0047827_51_677 | 208 |
| 246 | 3300055283 | Ga0500661_011473 | Ga0500661_011473_308_934 | 208 |
| 247 | 3300005327 | Ga0070658_10243882 | Ga0070658_102438822 | 209 |
| 248 | 3300005327 | Ga0070658_10356007 | Ga0070658_103560071 | 209 |
| 249 | 3300005329 | Ga0070683_100054352 | Ga0070683_1000543523 | 209 |
| 250 | 3300005339 | Ga0070660_100099579 | Ga0070660_1000995792 | 209 |
| 251 | 3300005366 | Ga0070659_100430599 | Ga0070659_1004305992 | 209 |
| 252 | 3300005455 | Ga0070663_100099356 | Ga0070663_1000993562 | 209 |
| 253 | 3300005458 | Ga0070681_10325113 | Ga0070681_103251132 | 209 |
| 254 | 3300005530 | Ga0070679_100007518 | Ga0070679_1000075184 | 209 |
| 255 | 3300005530 | Ga0070679_100011558 | Ga0070679_1000115584 | 209 |
| 256 | 3300005563 | Ga0068855_100001835 | Ga0068855_10000183513 | 209 |
| 257 | 3300005563 | Ga0068855_100022645 | Ga0068855_1000226457 | 209 |
| 258 | 3300005563 | Ga0068855_100664065 | Ga0068855_1006640652 | 209 |
| 259 | 3300005614 | Ga0068856_100364601 | Ga0068856_1003646013 | 209 |
| 260 | 3300005614 | Ga0068856_100448352 | Ga0068856_1004483522 | 209 |
| 261 | 3300006195 | Ga0075366_10022330 | Ga0075366_100223303 | 209 |
| 262 | 3300009093 | Ga0105240_10222848 | Ga0105240_102228482 | 209 |
| 263 | 3300013102 | Ga0157371_10001416 | Ga0157371_1000141611 | 209 |
| 264 | 3300013102 | Ga0157371_10003865 | Ga0157371_100038655 | 209 |
| 265 | 3300013102 | Ga0157371_10016268 | Ga0157371_100162684 | 209 |
| 266 | 3300013102 | Ga0157371_10093468 | Ga0157371_100934682 | 209 |
| 267 | 3300013104 | Ga0157370_10000530 | Ga0157370_1000053033 | 209 |
| 268 | 3300013104 | Ga0157370_10007937 | Ga0157370_100079377 | 209 |
| 269 | 3300013307 | Ga0157372_10032382 | Ga0157372_100323823 | 209 |
| 270 | 3300013307 | Ga0157372_10046399 | Ga0157372_100463992 | 209 |
| 271 | 3300013307 | Ga0157372_10184881 | Ga0157372_101848814 | 209 |
| 272 | 3300013307 | Ga0157372_10213160 | Ga0157372_102131602 | 209 |
| 273 | 3300025909 | Ga0207705_10001332 | Ga0207705_100013322 | 209 |
| 274 | 3300025909 | Ga0207705_10555759 | Ga0207705_105557591 | 209 |
| 275 | 3300025912 | Ga0207707_10274434 | Ga0207707_102744342 | 209 |
| 276 | 3300025912 | Ga0207707_10285270 | Ga0207707_102852702 | 209 |
| 277 | 3300025917 | Ga0207660_10041548 | Ga0207660_100415482 | 209 |
| 278 | 3300025921 | Ga0207652_10000494 | Ga0207652_100004944 | 209 |
| 279 | 3300025921 | Ga0207652_10000633 | Ga0207652_1000063310 | 209 |
| 280 | 3300025921 | Ga0207652_10109240 | Ga0207652_101092402 | 209 |
| 281 | 3300025932 | Ga0207690_10005079 | Ga0207690_100050796 | 209 |
| 282 | 3300025949 | Ga0207667_10000936 | Ga0207667_1000093625 | 209 |
| 283 | 3300025949 | Ga0207667_10049503 | Ga0207667_100495033 | 209 |
| 284 | 3300026041 | Ga0207639_10523219 | Ga0207639_105232191 | 209 |
| 285 | 3300026067 | Ga0207678_10146584 | Ga0207678_101465842 | 209 |
| 286 | 3300026078 | Ga0207702_10402216 | Ga0207702_104022162 | 209 |
| 287 | 3300026078 | Ga0207702_10869627 | Ga0207702_108696272 | 209 |
| 288 | 3300037312 | Ga0395899_0001371 | Ga0395899_0001371_16537_17172 | 209 |
| 289 | 3300037312 | Ga0395899_0015683 | Ga0395899_0015683_4235_4867 | 209 |
| 290 | 3300037312 | Ga0395899_0205336 | Ga0395899_0205336_216_872 | 209 |
| 291 | 3300037418 | Ga0395900_0000203 | Ga0395900_0000203_6930_7565 | 209 |
| 292 | 3300037418 | Ga0395900_0011411 | Ga0395900_0011411_7484_8140 | 209 |
| 293 | 3300037418 | Ga0395900_0020467 | Ga0395900_0020467_5254_5886 | 209 |
| 294 | 3300037418 | Ga0395900_0457519 | Ga0395900_0457519_360_1016 | 209 |
| 295 | 3300037418 | Ga0395900_0458123 | Ga0395900_0458123_327_1016 | 209 |
| 296 | 3300037466 | Ga0395898_0001978 | Ga0395898_0001978_8450_9085 | 209 |
| 297 | 3300037466 | Ga0395898_0114213 | Ga0395898_0114213_1471_2103 | 209 |
| 298 | 3300037466 | Ga0395898_0673564 | Ga0395898_0673564_73_762 | 209 |
| 299 | 3300037471 | Ga0395905_0019205 | Ga0395905_0019205_2143_2832 | 209 |
| 300 | 3300037471 | Ga0395905_0125146 | Ga0395905_0125146_308_964 | 209 |
| 301 | 3300038443 | Ga0395901_0012648 | Ga0395901_0012648_6924_7559 | 209 |
| 302 | 3300038443 | Ga0395901_0035421 | Ga0395901_0035421_748_1380 | 209 |
| 303 | 3300038443 | Ga0395901_0191836 | Ga0395901_0191836_215_904 | 209 |
| 304 | 3300038443 | Ga0395901_0798997 | Ga0395901_0798997_96_752 | 209 |
| 305 | 3300047472 | Ga0495686_0020338 | Ga0495686_0020338_2885_3529 | 209 |
| 306 | 3300047472 | Ga0495686_0101531 | Ga0495686_0101531_950_1594 | 209 |
| 307 | 3300049569 | Ga0501032_0077969 | Ga0501032_0077969_944_1576 | 209 |
| 308 | 3300049570 | Ga0501033_0116809 | Ga0501033_0116809_1050_1682 | 209 |
| 309 | 3300049571 | Ga0501034_0215975 | Ga0501034_0215975_109_741 | 209 |
| 310 | 3300049579 | Ga0501043_0366919 | Ga0501043_0366919_307_939 | 209 |
| 311 | 3300049822 | Ga0501035_0018145 | Ga0501035_0018145_747_1379 | 209 |
| 312 | 3300049823 | Ga0501044_0073923 | Ga0501044_0073923_2106_2738 | 209 |
| 313 | 3300050493 | nmdc:mga0k408_46785_c1 | nmdc:mga0k408_46785_c1_1077_1721 | 209 |
| 314 | 3300002738 | JGI25154J39366_1000002 | JGI25154J39366_1000002354 | 210 |
| 315 | 3300002741 | JGI25157J39369_1003470 | JGI25157J39369_10034703 | 210 |
| 316 | 3300003215 | JGI25153J46596_10030539 | JGI25153J46596_100305392 | 210 |
| 317 | 3300003761 | Ga0055535_1006156 | Ga0055535_10061562 | 210 |
| 318 | 3300003762 | Ga0055542_1001676 | Ga0055542_10016768 | 210 |
| 319 | 3300003791 | Ga0055530_10038760 | Ga0055530_100387601 | 210 |
| 320 | 3300025242 | Ga0209258_100029 | Ga0209258_100029161 | 210 |
| 321 | 3300025246 | Ga0209646_1000005 | Ga0209646_100000518 | 210 |
| 322 | 3300025250 | Ga0209026_1000344 | Ga0209026_100034415 | 210 |
| 323 | 3300025254 | Ga0209148_1000089 | Ga0209148_100008969 | 210 |
| 324 | 3300025297 | Ga0209758_1001350 | Ga0209758_100135017 | 210 |
| 325 | 3300025302 | Ga0207426_1000536 | Ga0207426_100053617 | 210 |
| 326 | 3300025302 | Ga0207426_1000636 | Ga0207426_100063624 | 210 |
| 327 | 3300044842 | Ga0466957_0015506 | Ga0466957_0015506_1094_1726 | 210 |
| 328 | 3300048924 | Ga0496121_0000008 | Ga0496121_0000008_134806_135441 | 210 |
| 329 | 3300005366 | Ga0070659_100057538 | Ga0070659_1000575383 | 212 |
| 330 | 3300013100 | Ga0157373_10209438 | Ga0157373_102094381 | 215 |
| 331 | 3300013102 | Ga0157371_10160688 | Ga0157371_101606882 | 215 |
| 332 | 3300013102 | Ga0157371_10181606 | Ga0157371_101816062 | 215 |
| 333 | 3300013104 | Ga0157370_10278144 | Ga0157370_102781441 | 215 |
| 334 | 3300013105 | Ga0157369_10042815 | Ga0157369_100428155 | 215 |
| 335 | 3300013307 | Ga0157372_10254784 | Ga0157372_102547842 | 215 |
| 336 | 3300037312 | Ga0395899_0077210 | Ga0395899_0077210_128_856 | 215 |
| 337 | 3300037418 | Ga0395900_0497080 | Ga0395900_0497080_300_1031 | 215 |
| 338 | 3300037466 | Ga0395898_0006508 | Ga0395898_0006508_11399_12127 | 215 |
| 339 | 3300037466 | Ga0395898_0080335 | Ga0395898_0080335_232_963 | 215 |
| 340 | 3300038443 | Ga0395901_0025579 | Ga0395901_0025579_2028_2756 | 215 |
| 341 | 3300038443 | Ga0395901_0473544 | Ga0395901_0473544_239_970 | 215 |
| 342 | 3300003323 | rootH1_10086131 | rootH1_100861313 | 217 |
| 343 | 3300003790 | Ga0055528_1000338 | Ga0055528_100033829 | 217 |
| 344 | 3300003794 | Ga0055531_10024007 | Ga0055531_100240071 | 217 |
| 345 | 3300005262 | Ga0065165_1000100 | Ga0065165_100010076 | 217 |
| 346 | 3300013307 | Ga0157372_10031944 | Ga0157372_100319443 | 217 |
| 347 | 3300025273 | Ga0209673_1000113 | Ga0209673_100011313 | 217 |
| 348 | 3300025295 | Ga0209564_1017940 | Ga0209564_10179403 | 217 |
| 349 | 3300025297 | Ga0209758_1029113 | Ga0209758_10291131 | 217 |
| 350 | 3300025298 | Ga0209050_1000907 | Ga0209050_10009072 | 217 |
| 351 | 3300025304 | Ga0209257_1004964 | Ga0209257_10049648 | 217 |
| 352 | 3300001989 | JGI24739J22299_10018924 | JGI24739J22299_100189242 | 219 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5o6y-assembly2.cif.gz_B | crystal structure of the bc1960 peptidoglycan n-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{n}-oxidanyl-benzamide | 0.91 | 20 | 210 |
| 4m1b-assembly2.cif.gz_B | structural determination of ba0150, a polysaccharide deacetylase from bacillus anthracis | 0.8965 | 27 | 214 |
| 7y51-assembly1.cif.gz_A-2 | acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant | 0.8935 | 37 | 211 |
| 2cc0-assembly1.cif.gz_B | family 4 carbohydrate esterase from streptomyces lividans in complex with acetate | 0.8901 | 37 | 216 |
| 6h8n-assembly1.cif.gz_A | structure of peptidoglycan deacetylase pdac from bacillus subtilis - mutant d285s | 0.8831 | 31 | 215 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2c1iA03 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.8997 | 37 | 216 | 3.20.20.370 |
| 4m1bB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.8965 | 27 | 214 | 3.20.20.370 |
| 2cc0B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.8901 | 37 | 216 | 3.20.20.370 |
| 2c79A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.8831 | 37 | 211 | 3.20.20.370 |
| 4l1gD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.8765 | 16 | 214 | 3.20.20.370 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A060C0I4-F1-model_v4 | Polysacc_deac_1 | 0.999 | 39 | 133 |
GO:0005975
GO:0016020 GO:0016810 |
| AF-A0A1Q4F696-F1-model_v4 | Polysaccharide deacetylase family protein | 0.9926 | 10 | 216 |
GO:0005975
GO:0016020 GO:0016810 |
| AF-A0A522YP35-F1-model_v4 | deleted | 0.9919 | 11 | 216 |
|
| AF-A0A519Y3Z5-F1-model_v4 | Polysaccharide deacetylase family protein | 0.9891 | 55 | 218 |
GO:0005975
GO:0016020 GO:0016810 |
| AF-A0A849UVL6-F1-model_v4 | Polysaccharide deacetylase family protein | 0.9888 | 10 | 215 |
GO:0005975
GO:0016020 GO:0016810 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar