F419017

General Info

Members Datasets Scaffolds Average Seq Length
352 233 704 218

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10005323|Ga0157370_1000532310
Length 233
Sequence MMGTVPKDALMFPRLPTVTKALLIANIVLFLLQQPFLLGNGTFEPFMLQPLRDGFDPFSPGGNFQPWQLLTYGFLHGGFGHLFFNMLALFMFGAPLEQTWGEKRFLTYYLVCIVGAGLCQLLVGMMMADPATVLGASGGVFGLLLAYGMLFPNQRVMLLFPPIPMKARTFVIVFGAMELMLGATGWQPGVAHFAHLGGMLFGWLLIRYWRGQPPFNKRPPGGDPRKNHLRSVR

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
42 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
53 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
54 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
86 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
87 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
88 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
89 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
90 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
102 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
103 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
104 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
105 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
106 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
107 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
108 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
109 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
110 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
111 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
112 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
113 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
116 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
117 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
121 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
126 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
127 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
128 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
135 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
155 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
181 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
193 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
194 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
195 2643221559 Lysobacter sp. Root559 Isolate Unclassified
196 2643221586 Lysobacter sp. Root667 Isolate Unclassified
197 2643221612 Lysobacter sp. Root76 Isolate Unclassified
198 2643221695 Lysobacter sp. Root494 Isolate Unclassified
199 2643221727 Lysobacter sp. Root96 Isolate Unclassified
200 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
201 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
202 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
203 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
204 2818991457 Xanthomonas translucens 569 Isolate Unclassified
205 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
206 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
207 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
208 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
209 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
210 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
211 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
212 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
213 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
214 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
215 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
216 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
217 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
218 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
219 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
220 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
221 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
222 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
223 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
224 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
225 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
226 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
227 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
228 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
229 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
230 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
231 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
232 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
233 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.35
Metatranscriptomes 0
Isolates 11.65

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 14.49
Nodule 0.28
Rhizoplane 5.11
Rhizosphere 57.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10005323 3300013104 Bacteria 14452
2 SwRhRL2b_contig_1455210 2162886007 Bacteria 2981
3 SwRhRL2b_contig_3895547 2162886007 Bacteria 4226
4 JGI25152J39213_1000023 3300002773 Bacteria 105170
5 JGI25150J39212_1000646 3300002774 Bacteria 13032
6 JGI25151J46595_10000100 3300003187 Bacteria 116522
7 JGI25153J46596_10000071 3300003215 Bacteria 116950
8 Ga0055526_1000486 3300003771 Bacteria 31535
9 Ga0055537_1000261 3300003773 Bacteria 38387
10 Ga0055524_1021027 3300003775 Bacteria 2176
11 Ga0055536_1003939 3300003781 Bacteria 7783
12 Ga0055536_1005773 3300003781 Bacteria 5963
13 Ga0055534_1000034 3300003784 Bacteria 114684
14 Ga0055528_1000845 3300003790 Bacteria 20761
15 Ga0055530_10003023 3300003791 Bacteria 10060
16 Ga0055530_10004740 3300003791 Bacteria 6854
17 Ga0055531_10007461 3300003794 Bacteria 5963
18 Ga0058692_1000011 3300003856 Bacteria 321321
19 Ga0065704_10070324 3300005289 Bacteria 32729
20 Ga0065704_10070640 3300005289 Bacteria 18572
21 Ga0065715_10392350 3300005293 Bacteria 892
22 Ga0070670_100006830 3300005331 Bacteria 9669
23 Ga0070670_100031806 3300005331 Bacteria 4544
24 Ga0070666_10800356 3300005335 Bacteria 694
25 Ga0070668_100012341 3300005347 Bacteria 6363
26 Ga0070671_100225843 3300005355 Bacteria 1589
27 Ga0070667_100441242 3300005367 Bacteria 1189
28 Ga0070667_100669324 3300005367 Bacteria 959
29 Ga0070714_100036197 3300005435 Bacteria 4139
30 Ga0070662_100363952 3300005457 Bacteria 1187
31 Ga0068867_100168012 3300005459 Bacteria 1735
32 Ga0070672_100138049 3300005543 Bacteria 2009
33 Ga0070695_100129536 3300005545 Bacteria 1738
34 Ga0070696_100004341 3300005546 Bacteria 9453
35 Ga0070665_100231303 3300005548 Bacteria 1848
36 Ga0070665_100453663 3300005548 Bacteria 1292
37 Ga0075365_10011772 3300006038 Bacteria 5160
38 Ga0075365_10415379 3300006038 Bacteria 950
39 Ga0075365_10619494 3300006038 Bacteria 765
40 Ga0075364_10000031 3300006051 Bacteria 49341
41 Ga0075364_10024894 3300006051 Bacteria 3805
42 Ga0075364_10026484 3300006051 Bacteria 3699
43 Ga0075364_10081596 3300006051 Bacteria 2138
44 Ga0075367_10133535 3300006178 Bacteria 1535
45 Ga0075431_100814696 3300006847 Bacteria 906
46 Ga0105251_10002110 3300009011 Bacteria 16006
47 Ga0105244_10163390 3300009036 Bacteria 1062
48 Ga0105244_10190680 3300009036 Bacteria 969
49 Ga0105240_10002038 3300009093 Bacteria 33273
50 Ga0105245_10046692 3300009098 Bacteria 3870
51 Ga0105243_10176514 3300009148 Bacteria 1854
52 Ga0105248_10445602 3300009177 Bacteria 1459
53 Ga0105246_10479421 3300011119 Bacteria 1052
54 Ga0157314_1001314 3300012500 Bacteria 1803
55 Ga0157327_1003895 3300012512 Bacteria 1127
56 Ga0157371_10000154 3300013102 Bacteria 100237
57 Ga0157370_10034606 3300013104 Bacteria 4917
58 Ga0157369_10755338 3300013105 Bacteria 1000
59 Ga0157374_10015319 3300013296 Bacteria 6724
60 Ga0157375_10067257 3300013308 Bacteria 3580
61 Ga0157375_10387205 3300013308 Bacteria 1565
62 Ga0182008_10000045 3300014497 Bacteria 114620
63 Ga0182008_10023080 3300014497 Bacteria 3181
64 Ga0182006_1011851 3300015261 Bacteria 3820
65 Ga0182006_1029077 3300015261 Bacteria 2242
66 Ga0182007_10000175 3300015262 Bacteria 43873
67 Ga0182005_1000733 3300015265 Bacteria 15014
68 Ga0182005_1028335 3300015265 Bacteria 1527
69 Ga0163161_10000692 3300017792 Bacteria 26954
70 Ga0163161_10010740 3300017792 Bacteria 6343
71 Ga0163161_10101252 3300017792 Bacteria 2145
72 Ga0163161_10177473 3300017792 Bacteria 1631
73 Ga0163161_10306836 3300017792 Bacteria 1251
74 Ga0207425_1000030 3300025245 Bacteria 268200
75 Ga0209129_1000063 3300025258 Bacteria 240205
76 Ga0209565_1000022 3300025263 Bacteria 390888
77 Ga0209673_1000104 3300025273 Bacteria 186569
78 Ga0209675_1000048 3300025291 Bacteria 221457
79 Ga0209676_1000091 3300025292 Bacteria 251328
80 Ga0209676_1000117 3300025292 Bacteria 203251
81 Ga0209676_1001162 3300025292 Bacteria 28648
82 Ga0209676_1006850 3300025292 Bacteria 5521
83 Ga0209025_1000013 3300025294 Bacteria 871757
84 Ga0209025_1006302 3300025294 Bacteria 9270
85 Ga0209564_1000213 3300025295 Bacteria 132985
86 Ga0209758_1000014 3300025297 Bacteria 871757
87 Ga0209050_1000175 3300025298 Bacteria 146845
88 Ga0209050_1000206 3300025298 Bacteria 131913
89 Ga0209050_1063334 3300025298 Bacteria 863
90 Ga0209256_1004404 3300025299 Bacteria 8871
91 Ga0209256_1007920 3300025299 Bacteria 5075
92 Ga0209051_1001733 3300025303 Bacteria 17374
93 Ga0209257_1000062 3300025304 Bacteria 362413
94 Ga0209257_1000148 3300025304 Bacteria 193131
95 Ga0209257_1000711 3300025304 Bacteria 51490
96 Ga0209257_1001502 3300025304 Bacteria 27388
97 Ga0209257_1005535 3300025304 Bacteria 8803
98 Ga0207655_1091835 3300025728 Bacteria 1066
99 Ga0207713_1000514 3300025735 Bacteria 39386
100 Ga0207713_1008456 3300025735 Bacteria 5925
101 Ga0207695_10011748 3300025913 Bacteria 10577
102 Ga0207681_10550252 3300025923 Bacteria 950
103 Ga0207650_10018327 3300025925 Bacteria 4912
104 Ga0207650_10098500 3300025925 Bacteria 2246
105 Ga0207644_10447115 3300025931 Bacteria 1061
106 Ga0207706_10280620 3300025933 Bacteria 1453
107 Ga0207709_10005875 3300025935 Bacteria 6931
108 Ga0207709_10049897 3300025935 Bacteria 2557
109 Ga0207691_10006445 3300025940 Bacteria 11335
110 Ga0207641_10282542 3300026088 Bacteria 1562
111 Ga0207675_100260980 3300026118 Bacteria 1679
112 Ga0209371_1000007 3300027312 Bacteria 1050654
113 Ga0209371_1000016 3300027312 Bacteria 646301
114 Ga0209969_1017244 3300027360 Bacteria 1062
115 Ga0209999_1000100 3300027543 Bacteria 10325
116 Ga0209982_1002542 3300027552 Bacteria 2566
117 Ga0209970_1004955 3300027614 Bacteria 2202
118 Ga0209983_1001909 3300027665 Bacteria 4623
119 Ga0209971_1000857 3300027682 Bacteria 7832
120 Ga0209974_10001531 3300027876 Bacteria 8389
121 Ga0268266_10262370 3300028379 Bacteria 1601
122 Ga0268266_10403814 3300028379 Bacteria 1292
123 Ga0268256_1000008 3300030500 Bacteria 1050654
124 Ga0268256_1000015 3300030500 Bacteria 646300
125 Ga0316177_1077226 3300030731 Bacteria 5163
126 Ga0316176_1096536 3300030732 Bacteria 732
127 Ga0314311_1150566 3300030733 Bacteria 6620
128 Ga0314311_1252374 3300030733 Bacteria 1642
129 Ga0316178_1136278 3300030735 Bacteria 2989
130 Ga0316183_1088245 3300030742 Bacteria 2731
131 Ga0307513_10002570 3300031456 Bacteria 25077
132 Ga0307413_10028276 3300031824 Bacteria 3120
133 Ga0307413_10181230 3300031824 Bacteria 1502
134 Ga0307410_10202042 3300031852 Bacteria 1518
135 Ga0307407_10318407 3300031903 Bacteria 1091
136 Ga0307412_10001664 3300031911 Bacteria 12275
137 Ga0307412_10144009 3300031911 Bacteria 1749
138 Ga0307412_10151270 3300031911 Bacteria 1713
139 Ga0307412_10170752 3300031911 Bacteria 1626
140 Ga0307412_10401380 3300031911 Bacteria 1116
141 Ga0307414_10002558 3300032004 Bacteria 9569
142 Ga0307414_10005590 3300032004 Bacteria 6933
143 Ga0307414_10098430 3300032004 Bacteria 2194
144 Ga0307414_10160821 3300032004 Bacteria 1783
145 Ga0307414_10268376 3300032004 Bacteria 1428
146 Ga0307414_10320308 3300032004 Bacteria 1319
147 Ga0307414_10347974 3300032004 Bacteria 1271
148 Ga0307414_10469383 3300032004 Bacteria 1107
149 Ga0307411_10129272 3300032005 Bacteria 1843
150 Ga0307411_10254500 3300032005 Bacteria 1383
151 Ga0307411_10455067 3300032005 Bacteria 1072
152 Ga0373935_0689960 3300035692 Bacteria 751
153 Ga0395900_0168906 3300037418 Bacteria 2228
154 Ga0395901_0283198 3300038443 Bacteria 1722
155 Ga0439436_0092426 3300041404 Bacteria 843
156 Ga0439465_0003734 3300041413 Bacteria 4962
157 Ga0439465_0004272 3300041413 Bacteria 4646
158 Ga0451791_0399408 3300041451 Bacteria 2037
159 Ga0451797_0453175 3300041453 Bacteria 2360
160 Ga0451802_0028384 3300041460 Bacteria 1728
161 Ga0451806_403891 3300041462 Bacteria 5740
162 Ga0451804_0067688 3300041463 Bacteria 1766
163 Ga0451807_0376030 3300041486 Bacteria 2492
164 Ga0451807_0383160 3300041486 Bacteria 2537
165 Ga0451837_0705007 3300041494 Bacteria 1256
166 Ga0451837_0755288 3300041494 Bacteria 1176
167 Ga0451837_0784760 3300041494 Bacteria 1071
168 Ga0451839_1150760 3300041496 Bacteria 630
169 Ga0451843_1320003 3300041509 Bacteria 1978
170 Ga0451843_1438775 3300041509 Bacteria 1194
171 Ga0439445_0005232 3300042004 Bacteria 2952
172 Ga0439432_008836 3300042006 Bacteria 3523
173 Ga0439432_009256 3300042006 Bacteria 3440
174 Ga0439449_0002049 3300042007 Bacteria 7934
175 Ga0439449_0007316 3300042007 Bacteria 4195
176 Ga0439449_0015984 3300042007 Bacteria 2821
177 Ga0439449_0017445 3300042007 Bacteria 2696
178 Ga0439462_0082569 3300042015 Bacteria 878
179 Ga0450905_004226 3300042142 Bacteria 1897
180 Ga0450901_002990 3300042533 Bacteria 1784
181 Ga0451577_0002646 3300042876 Bacteria 20977
182 Ga0453684_0931392 3300044712 Bacteria 928
183 Ga0495627_006539 3300046453 Bacteria 4559
184 Ga0495627_022075 3300046453 Bacteria 2099
185 Ga0495591_029813 3300046458 Bacteria 1653
186 Ga0495638_0003940 3300046460 Bacteria 11446
187 Ga0495638_0170097 3300046460 Bacteria 1251
188 Ga0495610_0002939 3300046512 Bacteria 13764
189 Ga0495631_0001021 3300046518 Bacteria 17380
190 Ga0495643_0000616 3300046522 Bacteria 42480
191 Ga0495643_0032377 3300046522 Bacteria 2903
192 Ga0495663_0002249 3300046525 Bacteria 5867
193 Ga0495663_0029969 3300046525 Bacteria 1609
194 Ga0495663_0095350 3300046525 Bacteria 974
195 Ga0495654_0023355 3300046530 Bacteria 3203
196 Ga0495621_0010005 3300046539 Bacteria 2894
197 Ga0495621_0081141 3300046539 Bacteria 1209
198 Ga0495633_0010465 3300046558 Bacteria 5058
199 Ga0495656_0075542 3300046615 Bacteria 1508
200 Ga0495656_0089445 3300046615 Bacteria 1405
201 Ga0495625_0060752 3300046660 Bacteria 2676
202 Ga0495625_0158452 3300046660 Bacteria 1518
203 Ga0495659_0034609 3300046664 Bacteria 1777
204 Ga0495670_0095100 3300046691 Bacteria 1528
205 Ga0495671_0093761 3300046692 Bacteria 1469
206 Ga0495636_0011624 3300047318 Bacteria 3485
207 Ga0495636_0212812 3300047318 Bacteria 885
208 Ga0495672_0000073 3300047320 Bacteria 179398
209 Ga0495677_0148802 3300047445 Bacteria 901
210 Ga0495686_0002815 3300047472 Bacteria 15772
211 Ga0495686_0102710 3300047472 Bacteria 1722
212 Ga0496104_0186520 3300048907 Bacteria 1985
213 Ga0496105_0598500 3300048908 Bacteria 856
214 Ga0496107_0468346 3300048910 Bacteria 935
215 Ga0496108_0055444 3300048911 Bacteria 3328
216 Ga0496108_0235470 3300048911 Bacteria 1592
217 Ga0496110_0261377 3300048913 Bacteria 1575
218 Ga0496111_0142624 3300048914 Bacteria 1775
219 Ga0496112_0368628 3300048915 Bacteria 1378
220 Ga0496113_0007018 3300048916 Bacteria 7204
221 Ga0496113_0365159 3300048916 Bacteria 1158
222 Ga0496115_0345094 3300048918 Bacteria 1215
223 Ga0496116_0006018 3300048919 Bacteria 11109
224 Ga0496116_0019663 3300048919 Bacteria 5162
225 Ga0496117_0002887 3300048920 Bacteria 20835
226 Ga0496117_0003123 3300048920 Bacteria 19780
227 Ga0496117_0003338 3300048920 Bacteria 18746
228 Ga0496117_0004414 3300048920 Bacteria 15542
229 Ga0496117_0012677 3300048920 Bacteria 7406
230 Ga0496118_0000344 3300048921 Bacteria 78989
231 Ga0496118_0004829 3300048921 Bacteria 15717
232 Ga0496118_0007415 3300048921 Bacteria 11636
233 Ga0496118_0014013 3300048921 Bacteria 7530
234 Ga0496118_0035937 3300048921 Bacteria 4014
235 Ga0496118_0036765 3300048921 Bacteria 3952
236 Ga0496118_0156366 3300048921 Bacteria 1417
237 Ga0496118_0262904 3300048921 Bacteria 972
238 Ga0496119_0000799 3300048922 Bacteria 42139
239 Ga0496119_0001529 3300048922 Bacteria 27644
240 Ga0496120_0000188 3300048923 Bacteria 105545
241 Ga0496120_0000562 3300048923 Bacteria 56572
242 Ga0496121_0015836 3300048924 Bacteria 7844
243 Ga0496121_0025525 3300048924 Bacteria 5602
244 Ga0496122_0000196 3300048925 Bacteria 136499
245 Ga0496122_0002270 3300048925 Bacteria 27809
246 Ga0496122_0041505 3300048925 Bacteria 3636
247 Ga0496122_0048431 3300048925 Bacteria 3267
248 Ga0496122_0064611 3300048925 Bacteria 2661
249 Ga0496123_0000106 3300048926 Bacteria 167799
250 Ga0496123_0000128 3300048926 Bacteria 154836
251 Ga0496123_0033462 3300048926 Bacteria 3698
252 Ga0496123_0036076 3300048926 Bacteria 3512
253 Ga0496123_0073000 3300048926 Bacteria 2131
254 Ga0496123_0076185 3300048926 Bacteria 2066
255 Ga0496124_0000281 3300048927 Bacteria 97214
256 Ga0496124_0000608 3300048927 Bacteria 60173
257 Ga0496124_0002637 3300048927 Bacteria 23065
258 Ga0496124_0008883 3300048927 Bacteria 10427
259 Ga0496124_0013195 3300048927 Bacteria 8080
260 Ga0496124_0015252 3300048927 Bacteria 7374
261 Ga0496124_0056810 3300048927 Bacteria 3299
262 Ga0496124_0103310 3300048927 Bacteria 2305
263 Ga0496124_0238109 3300048927 Bacteria 1355
264 Ga0496125_0001648 3300048928 Bacteria 31454
265 Ga0496125_0002960 3300048928 Bacteria 21344
266 Ga0496125_0006956 3300048928 Bacteria 12114
267 Ga0496125_0071853 3300048928 Bacteria 2700
268 Ga0496125_0088413 3300048928 Bacteria 2335
269 Ga0496125_0233319 3300048928 Bacteria 1174
270 Ga0496126_0001169 3300048929 Bacteria 43238
271 Ga0496126_0042122 3300048929 Bacteria 4219
272 Ga0496126_0104430 3300048929 Bacteria 2475
273 Ga0496126_0211339 3300048929 Bacteria 1633
274 Ga0501300_005719 3300049523 Bacteria 1832
275 Ga0501032_0088169 3300049569 Bacteria 2060
276 Ga0501033_0017677 3300049570 Bacteria 5385
277 Ga0501034_0066942 3300049571 Bacteria 3605
278 Ga0501036_0339056 3300049572 Bacteria 1255
279 Ga0501037_0064335 3300049573 Bacteria 2673
280 Ga0501038_0003207 3300049574 Bacteria 15264
281 Ga0501039_0000469 3300049575 Bacteria 29348
282 Ga0501040_0003160 3300049576 Bacteria 10670
283 Ga0501041_0003332 3300049577 Bacteria 9243
284 Ga0501042_0007838 3300049578 Bacteria 7021
285 Ga0501046_0005501 3300049580 Bacteria 11314
286 Ga0501048_0002327 3300049582 Bacteria 14497
287 Ga0501068_0289233 3300049584 Bacteria 1048
288 Ga0501069_0284279 3300049585 Bacteria 968
289 Ga0501070_0024115 3300049586 Bacteria 5102
290 Ga0501071_0129951 3300049587 Bacteria 1870
291 Ga0501071_0711443 3300049587 Bacteria 773
292 Ga0501074_0014032 3300049590 Bacteria 5824
293 Ga0501075_0001199 3300049591 Bacteria 16768
294 Ga0501076_0001310 3300049592 Bacteria 16602
295 Ga0501077_0012891 3300049593 Bacteria 5236
296 Ga0501217_099710 3300049661 Bacteria 824
297 Ga0501225_0002316 3300049705 Bacteria 5881
298 Ga0501079_0005501 3300049741 Bacteria 9440
299 Ga0501081_0001930 3300049743 Bacteria 12876
300 Ga0501045_0000880 3300049824 Bacteria 19510
301 nmdc:mga00v17_37678_c1 3300050491 Bacteria 2888
302 nmdc:mga00v17_48433_c1 3300050491 Bacteria 2576
303 nmdc:mga00v17_882_c1 3300050491 Bacteria 16231
304 nmdc:mga0yw44_10905_c1 3300050492 Bacteria 4659
305 nmdc:mga05p37_260268_c1 3300050507 Bacteria 2076
306 nmdc:mga06r32_897344_c1 3300050510 Bacteria 843
307 Ga0500634_0000227 3300053161 Bacteria 18188
308 Ga0501084_0038721 3300054114 Bacteria 3986
309 Ga0501084_0268403 3300054114 Bacteria 1441
310 Ga0501082_0005064 3300060353 Bacteria 11488
311 Ga0530510_0002460 3300061734 Bacteria 12754
312 2547503202 2547132130 Bacteria 4660562
313 2578457554 2576861471 Bacteria 4648976
314 2643816264 2643221559 Bacteria 4424915
315 2643939051 2643221586 Bacteria 4446529
316 2644077208 2643221612 Bacteria 4361984
317 2644528680 2643221695 Bacteria 3441323
318 2644694565 2643221727 Bacteria 4415595
319 2747949962 2747842428 Bacteria 4689383
320 2748018327 2747842501 Bacteria 5293829
321 2765579929 2765235840 Bacteria 4663337
322 2816519021 2816332141 Bacteria 4436036
323 2819660114 2818991457 Bacteria 5323295
324 2842394886 2842391507 Bacteria 4486072
325 2842760555 2842757796 Bacteria 3981385
326 2852649978 2852649853 Bacteria 4036942
327 2852685070 2852684882 Bacteria 5463342
328 2857444751 2857442823 Bacteria 4562550
329 2874222615 2874220319 Bacteria 4594709
330 2895500827 2895498888 Bacteria 5283788
331 2895516303 2895511927 Bacteria 6802080
332 2895523779 2895522137 Bacteria 3284416
333 2895526639 2895525241 Bacteria 3388457
334 2919090557 2919089067 Bacteria 4560942
335 2919137518 2919134579 Bacteria 4480386
336 2928498391 2928496128 Bacteria 4631123
337 2929198386 2929195423 Bacteria 5325372
338 2931383926 2931380184 Bacteria 4455911
339 2937614511 2937610967 Bacteria 4618818
340 2939591152 2939589442 Bacteria 4214238
341 2939624649 2939622612 Bacteria 4698046
342 2939628265 2939626828 Bacteria 4695272
343 2941476677 2941475908 Bacteria 4145589
344 2961049380 2961047084 Bacteria 4594415
345 2961065936 2961064222 Bacteria 4749990
346 2974308182 2974307012 Bacteria 4172388
347 2977248934 2977247770 Bacteria 4160543
348 2984516609 2984514374 Bacteria 4172479
349 2987607408 2987605356 Bacteria 4187822
350 8021626355 8021622325 Bacteria 4844743
351 8021627659 8021626552 Bacteria 4665214
352 8021650778 8021648035 Bacteria 4772378
353 Ga0157370_10005323
354 SwRhRL2b_contig_1455210
355 SwRhRL2b_contig_3895547
356 JGI25152J39213_1000023
357 JGI25150J39212_1000646
358 JGI25151J46595_10000100
359 JGI25153J46596_10000071
360 Ga0055526_1000486
361 Ga0055537_1000261
362 Ga0055524_1021027
363 Ga0055536_1003939
364 Ga0055536_1005773
365 Ga0055534_1000034
366 Ga0055528_1000845
367 Ga0055530_10003023
368 Ga0055530_10004740
369 Ga0055531_10007461
370 Ga0058692_1000011
371 Ga0065704_10070324
372 Ga0065704_10070640
373 Ga0065715_10392350
374 Ga0070670_100006830
375 Ga0070670_100031806
376 Ga0070666_10800356
377 Ga0070668_100012341
378 Ga0070671_100225843
379 Ga0070667_100441242
380 Ga0070667_100669324
381 Ga0070714_100036197
382 Ga0070662_100363952
383 Ga0068867_100168012
384 Ga0070672_100138049
385 Ga0070695_100129536
386 Ga0070696_100004341
387 Ga0070665_100231303
388 Ga0070665_100453663
389 Ga0075365_10011772
390 Ga0075365_10415379
391 Ga0075365_10619494
392 Ga0075364_10000031
393 Ga0075364_10024894
394 Ga0075364_10026484
395 Ga0075364_10081596
396 Ga0075367_10133535
397 Ga0075431_100814696
398 Ga0105251_10002110
399 Ga0105244_10163390
400 Ga0105244_10190680
401 Ga0105240_10002038
402 Ga0105245_10046692
403 Ga0105243_10176514
404 Ga0105248_10445602
405 Ga0105246_10479421
406 Ga0157314_1001314
407 Ga0157327_1003895
408 Ga0157371_10000154
409 Ga0157370_10034606
410 Ga0157369_10755338
411 Ga0157374_10015319
412 Ga0157375_10067257
413 Ga0157375_10387205
414 Ga0182008_10000045
415 Ga0182008_10023080
416 Ga0182006_1011851
417 Ga0182006_1029077
418 Ga0182007_10000175
419 Ga0182005_1000733
420 Ga0182005_1028335
421 Ga0163161_10000692
422 Ga0163161_10010740
423 Ga0163161_10101252
424 Ga0163161_10177473
425 Ga0163161_10306836
426 Ga0207425_1000030
427 Ga0209129_1000063
428 Ga0209565_1000022
429 Ga0209673_1000104
430 Ga0209675_1000048
431 Ga0209676_1000091
432 Ga0209676_1000117
433 Ga0209676_1001162
434 Ga0209676_1006850
435 Ga0209025_1000013
436 Ga0209025_1006302
437 Ga0209564_1000213
438 Ga0209758_1000014
439 Ga0209050_1000175
440 Ga0209050_1000206
441 Ga0209050_1063334
442 Ga0209256_1004404
443 Ga0209256_1007920
444 Ga0209051_1001733
445 Ga0209257_1000062
446 Ga0209257_1000148
447 Ga0209257_1000711
448 Ga0209257_1001502
449 Ga0209257_1005535
450 Ga0207655_1091835
451 Ga0207713_1000514
452 Ga0207713_1008456
453 Ga0207695_10011748
454 Ga0207681_10550252
455 Ga0207650_10018327
456 Ga0207650_10098500
457 Ga0207644_10447115
458 Ga0207706_10280620
459 Ga0207709_10005875
460 Ga0207709_10049897
461 Ga0207691_10006445
462 Ga0207641_10282542
463 Ga0207675_100260980
464 Ga0209371_1000007
465 Ga0209371_1000016
466 Ga0209969_1017244
467 Ga0209999_1000100
468 Ga0209982_1002542
469 Ga0209970_1004955
470 Ga0209983_1001909
471 Ga0209971_1000857
472 Ga0209974_10001531
473 Ga0268266_10262370
474 Ga0268266_10403814
475 Ga0268256_1000008
476 Ga0268256_1000015
477 Ga0316177_1077226
478 Ga0316176_1096536
479 Ga0314311_1150566
480 Ga0314311_1252374
481 Ga0316178_1136278
482 Ga0316183_1088245
483 Ga0307513_10002570
484 Ga0307413_10028276
485 Ga0307413_10181230
486 Ga0307410_10202042
487 Ga0307407_10318407
488 Ga0307412_10001664
489 Ga0307412_10144009
490 Ga0307412_10151270
491 Ga0307412_10170752
492 Ga0307412_10401380
493 Ga0307414_10002558
494 Ga0307414_10005590
495 Ga0307414_10098430
496 Ga0307414_10160821
497 Ga0307414_10268376
498 Ga0307414_10320308
499 Ga0307414_10347974
500 Ga0307414_10469383
501 Ga0307411_10129272
502 Ga0307411_10254500
503 Ga0307411_10455067
504 Ga0373935_0689960
505 Ga0395900_0168906
506 Ga0395901_0283198
507 Ga0439436_0092426
508 Ga0439465_0003734
509 Ga0439465_0004272
510 Ga0451791_0399408
511 Ga0451797_0453175
512 Ga0451802_0028384
513 Ga0451806_403891
514 Ga0451804_0067688
515 Ga0451807_0376030
516 Ga0451807_0383160
517 Ga0451837_0705007
518 Ga0451837_0755288
519 Ga0451837_0784760
520 Ga0451839_1150760
521 Ga0451843_1320003
522 Ga0451843_1438775
523 Ga0439445_0005232
524 Ga0439432_008836
525 Ga0439432_009256
526 Ga0439449_0002049
527 Ga0439449_0007316
528 Ga0439449_0015984
529 Ga0439449_0017445
530 Ga0439462_0082569
531 Ga0450905_004226
532 Ga0450901_002990
533 Ga0451577_0002646
534 Ga0453684_0931392
535 Ga0495627_006539
536 Ga0495627_022075
537 Ga0495591_029813
538 Ga0495638_0003940
539 Ga0495638_0170097
540 Ga0495610_0002939
541 Ga0495631_0001021
542 Ga0495643_0000616
543 Ga0495643_0032377
544 Ga0495663_0002249
545 Ga0495663_0029969
546 Ga0495663_0095350
547 Ga0495654_0023355
548 Ga0495621_0010005
549 Ga0495621_0081141
550 Ga0495633_0010465
551 Ga0495656_0075542
552 Ga0495656_0089445
553 Ga0495625_0060752
554 Ga0495625_0158452
555 Ga0495659_0034609
556 Ga0495670_0095100
557 Ga0495671_0093761
558 Ga0495636_0011624
559 Ga0495636_0212812
560 Ga0495672_0000073
561 Ga0495677_0148802
562 Ga0495686_0002815
563 Ga0495686_0102710
564 Ga0496104_0186520
565 Ga0496105_0598500
566 Ga0496107_0468346
567 Ga0496108_0055444
568 Ga0496108_0235470
569 Ga0496110_0261377
570 Ga0496111_0142624
571 Ga0496112_0368628
572 Ga0496113_0007018
573 Ga0496113_0365159
574 Ga0496115_0345094
575 Ga0496116_0006018
576 Ga0496116_0019663
577 Ga0496117_0002887
578 Ga0496117_0003123
579 Ga0496117_0003338
580 Ga0496117_0004414
581 Ga0496117_0012677
582 Ga0496118_0000344
583 Ga0496118_0004829
584 Ga0496118_0007415
585 Ga0496118_0014013
586 Ga0496118_0035937
587 Ga0496118_0036765
588 Ga0496118_0156366
589 Ga0496118_0262904
590 Ga0496119_0000799
591 Ga0496119_0001529
592 Ga0496120_0000188
593 Ga0496120_0000562
594 Ga0496121_0015836
595 Ga0496121_0025525
596 Ga0496122_0000196
597 Ga0496122_0002270
598 Ga0496122_0041505
599 Ga0496122_0048431
600 Ga0496122_0064611
601 Ga0496123_0000106
602 Ga0496123_0000128
603 Ga0496123_0033462
604 Ga0496123_0036076
605 Ga0496123_0073000
606 Ga0496123_0076185
607 Ga0496124_0000281
608 Ga0496124_0000608
609 Ga0496124_0002637
610 Ga0496124_0008883
611 Ga0496124_0013195
612 Ga0496124_0015252
613 Ga0496124_0056810
614 Ga0496124_0103310
615 Ga0496124_0238109
616 Ga0496125_0001648
617 Ga0496125_0002960
618 Ga0496125_0006956
619 Ga0496125_0071853
620 Ga0496125_0088413
621 Ga0496125_0233319
622 Ga0496126_0001169
623 Ga0496126_0042122
624 Ga0496126_0104430
625 Ga0496126_0211339
626 Ga0501300_005719
627 Ga0501032_0088169
628 Ga0501033_0017677
629 Ga0501034_0066942
630 Ga0501036_0339056
631 Ga0501037_0064335
632 Ga0501038_0003207
633 Ga0501039_0000469
634 Ga0501040_0003160
635 Ga0501041_0003332
636 Ga0501042_0007838
637 Ga0501046_0005501
638 Ga0501048_0002327
639 Ga0501068_0289233
640 Ga0501069_0284279
641 Ga0501070_0024115
642 Ga0501071_0129951
643 Ga0501071_0711443
644 Ga0501074_0014032
645 Ga0501075_0001199
646 Ga0501076_0001310
647 Ga0501077_0012891
648 Ga0501217_099710
649 Ga0501225_0002316
650 Ga0501079_0005501
651 Ga0501081_0001930
652 Ga0501045_0000880
653 nmdc:mga00v17_37678_c1
654 nmdc:mga00v17_48433_c1
655 nmdc:mga00v17_882_c1
656 nmdc:mga0yw44_10905_c1
657 nmdc:mga05p37_260268_c1
658 nmdc:mga06r32_897344_c1
659 Ga0500634_0000227
660 Ga0501084_0038721
661 Ga0501084_0268403
662 Ga0501082_0005064
663 Ga0530510_0002460
664 2547503202
665 2578457554
666 2643816264
667 2643939051
668 2644077208
669 2644528680
670 2644694565
671 2747949962
672 2748018327
673 2765579929
674 2816519021
675 2819660114
676 2842394886
677 2842760555
678 2852649978
679 2852685070
680 2857444751
681 2874222615
682 2895500827
683 2895516303
684 2895523779
685 2895526639
686 2919090557
687 2919137518
688 2928498391
689 2929198386
690 2931383926
691 2937614511
692 2939591152
693 2939624649
694 2939628265
695 2941476677
696 2961049380
697 2961065936
698 2974308182
699 2977248934
700 2984516609
701 2987607408
702 8021626355
703 8021627659
704 8021650778

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01694

Rhomboid

Rhomboid family

63

212

0.94

PF08551

DUF1751

Eukaryotic integral membrane protein (DUF1751)

60

147

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pjp-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7897 5 190
5f5k-assembly1.cif.gz_A e.coli glpg y205f mutant complexed with aldehyde inhibitor in dmpc/chapso bicelle 0.7887 5 190
6pja-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7837 7 190
6pju-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7836 5 190
6pj9-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7832 5 190
ID Description Score Start End Superfamily
af_I1JZG9_137_329_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8981 8 190 1.20.1540.10
af_F1R9M8_118_305_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8973 8 195 1.20.1540.10
af_F1R9M8_118_305_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8705 8 195 1.20.1540.10
af_Q54D88_171_373_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.865 8 190 1.20.1540.10
af_Q8I3V7_262_478_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8513 7 190 1.20.1540.10
ID Description Score Start End GO Terms
AF-A0A1J5RZX3-F1-model_v4 Rhomboid protease GluP (EC 3.4.21.105) 0.9577 9 195 GO:0004252
GO:0006508
GO:0016020
AF-A0A4Z0FEC8-F1-model_v4 Rhomboid family intramembrane serine protease 0.9539 9 202 GO:0004252
GO:0006508
GO:0016020
AF-A0A2E6EAT9-F1-model_v4 Peptidase S54 rhomboid domain-containing protein 0.953 44 195 GO:0004252
GO:0006508
GO:0016020
AF-A0A562E3E1-F1-model_v4 Membrane associated rhomboid family serine protease 0.9525 1 180 GO:0004252
GO:0006508
GO:0016020
AF-A0A350BXA7-F1-model_v4 Rhomboid family intramembrane serine protease 0.9511 7 195 GO:0004252
GO:0006508
GO:0016020

Map