F419161

General Info

Members Datasets Scaffolds Average Seq Length
352 212 704 227

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0000904|Ga0496108_0000904_22295_23092
Length 265
Sequence VLIQGPCHDRLELRFSSLFNLNHKEAPMAPRIIVSYDDTDNDRDALALGRLLAFSGAELSLAYVRHAQGGALEQKEAEDLLERGAEAVGAPDMPRHVIVNPGTSVGLTELAEQENADIIVFGSEYRTADGLVKPGISAHKLLLGGPAAIAVAPAGLRERPSAGVTTIGILDEGDDAARATAASLAAALGAGVADFKGTPVDLLVVGSRPESPQGKVTLSASSDYAVEAATYPVLVVPRGVTIRFDAAVPEPQAPQDEPEAPPVTA

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
113 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
114 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
117 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
123 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
124 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
211 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.7
Nodule 0
Rhizoplane 11.08
Rhizosphere 84.09
Stem 0
Stem Tuber 0
Unclassified 7.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0000904 3300048911 Bacteria 23112
2 JGI25404J52841_10031783 3300003659 Bacteria 1127
3 Ga0070658_10032896 3300005327 Bacteria 4170
4 Ga0070683_100001764 3300005329 Bacteria 16833
5 Ga0070683_100004081 3300005329 Bacteria 11970
6 Ga0070677_10000021 3300005333 Bacteria 47171
7 Ga0070682_100000334 3300005337 Bacteria 32362
8 Ga0068868_100000615 3300005338 Bacteria 23958
9 Ga0070660_100210304 3300005339 Bacteria 1579
10 Ga0070660_100229107 3300005339 Bacteria 1512
11 Ga0070689_100027653 3300005340 Bacteria 4277
12 Ga0070687_100033698 3300005343 Bacteria 2530
13 Ga0070661_100000255 3300005344 Bacteria 43552
14 Ga0070692_10175873 3300005345 Viruses 1237
15 Ga0070668_100008466 3300005347 Bacteria 7640
16 Ga0070674_100000034 3300005356 Bacteria 63783
17 Ga0070674_100001938 3300005356 Bacteria 11300
18 Ga0070688_100003986 3300005365 Bacteria 7652
19 Ga0070688_100008337 3300005365 Bacteria 5624
20 Ga0070659_100000954 3300005366 Bacteria 21269
21 Ga0070667_100048020 3300005367 Bacteria 3592
22 Ga0070667_100113221 3300005367 Bacteria 2354
23 Ga0070714_100001276 3300005435 Bacteria 18215
24 Ga0070714_100045577 3300005435 Bacteria 3717
25 Ga0070714_100052229 3300005435 Bacteria 3486
26 Ga0070713_100000101 3300005436 Bacteria 54832
27 Ga0070711_100165473 3300005439 Bacteria 1681
28 Ga0070662_100000001 3300005457 Bacteria 317995
29 Ga0070681_10015709 3300005458 Bacteria 7545
30 Ga0070681_10393981 3300005458 Bacteria 1296
31 Ga0070685_10001176 3300005466 Bacteria 14005
32 Ga0070679_100000365 3300005530 Bacteria 38496
33 Ga0070684_100021460 3300005535 Bacteria 5374
34 Ga0070684_100041158 3300005535 Bacteria 3983
35 Ga0068853_100240008 3300005539 Unclassified 1661
36 Ga0070686_100033718 3300005544 Bacteria 3148
37 Ga0070693_100001286 3300005547 Bacteria 11337
38 Ga0070693_100134450 3300005547 Bacteria 1550
39 Ga0068857_100045400 3300005577 Bacteria 3898
40 Ga0068854_100000267 3300005578 Bacteria 35526
41 Ga0068854_100017154 3300005578 Bacteria 4841
42 Ga0068856_100001040 3300005614 Bacteria 29492
43 Ga0068856_100026649 3300005614 Bacteria 5637
44 Ga0070702_100233551 3300005615 Bacteria 1237
45 Ga0068852_100000132 3300005616 Bacteria 50593
46 Ga0068859_101112114 3300005617 Unclassified 869
47 Ga0068866_10000005 3300005718 Bacteria 196339
48 Ga0068866_10000891 3300005718 Bacteria 13181
49 Ga0068851_10002447 3300005834 Bacteria 8147
50 Ga0068851_10004966 3300005834 Bacteria 6025
51 Ga0068863_100000050 3300005841 Bacteria 130200
52 Ga0068858_100000017 3300005842 Bacteria 186913
53 Ga0068860_100590315 3300005843 Unclassified 1116
54 Ga0068862_100006605 3300005844 Bacteria 9618
55 Ga0081455_10001231 3300005937 Bacteria 31996
56 Ga0081455_10051128 3300005937 Bacteria 3546
57 Ga0081540_1000046 3300005983 Bacteria 131375
58 Ga0070717_10000006 3300006028 Bacteria 353403
59 Ga0075365_10311936 3300006038 Bacteria 1107
60 Ga0075368_10048130 3300006042 Bacteria 1689
61 Ga0075363_100408192 3300006048 Bacteria 799
62 Ga0075364_10200306 3300006051 Bacteria 1353
63 Ga0070712_100000003 3300006175 Bacteria 253696
64 Ga0075369_10014393 3300006186 Bacteria 3159
65 Ga0075433_10020838 3300006852 Bacteria 5488
66 Ga0075433_10188661 3300006852 Bacteria 1834
67 Ga0075434_100077172 3300006871 Bacteria 3326
68 Ga0068865_100000039 3300006881 Bacteria 73689
69 Ga0068865_100540610 3300006881 Unclassified 977
70 Ga0097620_101112210 3300006931 Unclassified 869
71 Ga0075435_100039664 3300007076 Bacteria 3759
72 Ga0105240_10108593 3300009093 Bacteria 3361
73 Ga0111539_10640010 3300009094 Bacteria 1238
74 Ga0105245_10000022 3300009098 Bacteria 181225
75 Ga0105245_10001911 3300009098 Bacteria 18926
76 Ga0105245_10007491 3300009098 Bacteria 9564
77 Ga0105245_10025648 3300009098 Bacteria 5183
78 Ga0105245_10289515 3300009098 Unclassified 1604
79 Ga0105245_10683842 3300009098 Bacteria 1058
80 Ga0105247_10000832 3300009101 Bacteria 23437
81 Ga0105241_10209044 3300009174 Bacteria 1634
82 Ga0105242_10003703 3300009176 Bacteria 11898
83 Ga0105242_10091353 3300009176 Bacteria 2563
84 Ga0105248_10000017 3300009177 Bacteria 298089
85 Ga0105248_10315184 3300009177 Bacteria 1762
86 Ga0105238_10000016 3300009551 Bacteria 236218
87 Ga0105249_10000054 3300009553 Bacteria 162883
88 Ga0105249_10024928 3300009553 Bacteria 5381
89 Ga0105249_10475417 3300009553 Bacteria 1292
90 Ga0105239_10067201 3300010375 Bacteria 3938
91 Ga0157371_10005762 3300013102 Bacteria 10381
92 Ga0157370_10018159 3300013104 Bacteria 7079
93 Ga0157370_10022495 3300013104 Bacteria 6272
94 Ga0157369_10000803 3300013105 Bacteria 40158
95 Ga0157378_10003220 3300013297 Bacteria 14521
96 Ga0157378_10052238 3300013297 Unclassified 3637
97 Ga0157378_10519642 3300013297 Bacteria 1192
98 Ga0163162_10998599 3300013306 Bacteria 946
99 Ga0157372_10000407 3300013307 Bacteria 47331
100 Ga0157372_10463320 3300013307 Bacteria 1477
101 Ga0157375_10000194 3300013308 Bacteria 56860
102 Ga0157375_10013139 3300013308 Bacteria 7357
103 Ga0157375_10258097 3300013308 Bacteria 1904
104 Ga0163163_10979274 3300014325 Bacteria 909
105 Ga0157379_10029192 3300014968 Bacteria 4905
106 Ga0157379_10037859 3300014968 Bacteria 4302
107 Ga0207656_10000620 3300025321 Bacteria 11627
108 Ga0207656_10001698 3300025321 Bacteria 7310
109 Ga0207682_10000020 3300025893 Bacteria 64537
110 Ga0207642_10000005 3300025899 Bacteria 401934
111 Ga0207642_10000681 3300025899 Bacteria 10448
112 Ga0207710_10000227 3300025900 Bacteria 48932
113 Ga0207688_10127969 3300025901 Bacteria 1487
114 Ga0207654_10025727 3300025911 Bacteria 3178
115 Ga0207707_10136672 3300025912 Bacteria 2143
116 Ga0207695_10081727 3300025913 Bacteria 3269
117 Ga0207693_10000009 3300025915 Bacteria 168990
118 Ga0207693_10006350 3300025915 Bacteria 9795
119 Ga0207663_10263933 3300025916 Bacteria 1273
120 Ga0207663_10576573 3300025916 Bacteria 882
121 Ga0207663_10709317 3300025916 Unclassified 797
122 Ga0207657_10285320 3300025919 Bacteria 1310
123 Ga0207649_10000015 3300025920 Bacteria 245662
124 Ga0207652_10000536 3300025921 Bacteria 38532
125 Ga0207694_10000012 3300025924 Bacteria 411218
126 Ga0207687_10000025 3300025927 Bacteria 175177
127 Ga0207687_10000065 3300025927 Bacteria 80752
128 Ga0207687_10001395 3300025927 Bacteria 16502
129 Ga0207687_10001642 3300025927 Bacteria 15441
130 Ga0207700_10000019 3300025928 Bacteria 183117
131 Ga0207664_10000060 3300025929 Bacteria 116764
132 Ga0207664_10008355 3300025929 Bacteria 7214
133 Ga0207664_10038748 3300025929 Bacteria 3697
134 Ga0207664_10042397 3300025929 Bacteria 3552
135 Ga0207706_10000003 3300025933 Bacteria 345011
136 Ga0207686_10001801 3300025934 Bacteria 11912
137 Ga0207686_10058571 3300025934 Unclassified 2429
138 Ga0207686_10352027 3300025934 Bacteria 1109
139 Ga0207686_10691134 3300025934 Unclassified 810
140 Ga0207709_10099872 3300025935 Bacteria 1916
141 Ga0207670_10024168 3300025936 Bacteria 3795
142 Ga0207669_10000002 3300025937 Bacteria 377651
143 Ga0207669_10000060 3300025937 Bacteria 54757
144 Ga0207704_10000165 3300025938 Bacteria 35234
145 Ga0207711_10000011 3300025941 Bacteria 518817
146 Ga0207661_10009098 3300025944 Bacteria 7118
147 Ga0207661_10010577 3300025944 Bacteria 6646
148 Ga0207661_10738496 3300025944 Bacteria 906
149 Ga0207667_10662091 3300025949 Bacteria 1049
150 Ga0207712_10000032 3300025961 Bacteria 210628
151 Ga0207712_10608579 3300025961 Unclassified 946
152 Ga0207668_10007808 3300025972 Bacteria 6364
153 Ga0207640_10002975 3300025981 Bacteria 9123
154 Ga0207640_10012422 3300025981 Bacteria 4848
155 Ga0207640_10177945 3300025981 Bacteria 1592
156 Ga0207658_10026209 3300025986 Bacteria 4085
157 Ga0207658_10082253 3300025986 Bacteria 2472
158 Ga0207677_10000163 3300026023 Bacteria 52869
159 Ga0207703_10000030 3300026035 Bacteria 199014
160 Ga0207639_10166800 3300026041 Unclassified 1861
161 Ga0207702_10000349 3300026078 Bacteria 52941
162 Ga0207702_10068076 3300026078 Bacteria 3058
163 Ga0207702_10313114 3300026078 Bacteria 1493
164 Ga0207641_10004313 3300026088 Bacteria 12349
165 Ga0207641_10526971 3300026088 Unclassified 1150
166 Ga0207674_10092994 3300026116 Bacteria 3005
167 Ga0207698_10000014 3300026142 Bacteria 240703
168 Ga0268265_10034234 3300028380 Unclassified 3700
169 Ga0265337_1002089 3300028556 Bacteria 9441
170 Ga0265326_10000024 3300028558 Bacteria 112928
171 Ga0265326_10000033 3300028558 Bacteria 91972
172 Ga0265319_1000037 3300028563 Bacteria 115642
173 Ga0265334_10000078 3300028573 Bacteria 70145
174 Ga0265323_10168337 3300028653 Bacteria 697
175 Ga0265322_10000017 3300028654 Bacteria 114833
176 Ga0265336_10019377 3300028666 Bacteria 2195
177 Ga0265338_10000051 3300028800 Bacteria 211202
178 Ga0265338_10018497 3300028800 Bacteria 7456
179 Ga0265324_10000479 3300029957 Bacteria 28017
180 Ga0265332_10028836 3300031238 Unclassified 2428
181 Ga0265328_10002684 3300031239 Bacteria 7960
182 Ga0265320_10000010 3300031240 Bacteria 250501
183 Ga0265329_10045987 3300031242 Bacteria 1394
184 Ga0265331_10000505 3300031250 Bacteria 36592
185 Ga0265327_10000040 3300031251 Bacteria 291052
186 Ga0265316_10031948 3300031344 Unclassified 4301
187 Ga0265313_10042670 3300031595 Bacteria 2226
188 Ga0265314_10000803 3300031711 Bacteria 37303
189 Ga0265342_10079499 3300031712 Bacteria 1896
190 Ga0316583_10164854 3300032133 Unclassified 771
191 Ga0373953_0170355 3300035117 Bacteria 937
192 Ga0373924_0226122 3300035410 Bacteria 827
193 Ga0373937_0047810 3300036401 Bacteria 3915
194 Ga0316582_0416473 3300036647 Bacteria 926
195 Ga0436360_0475298 3300039438 Bacteria 5245
196 Ga0436363_1293873 3300039450 Bacteria 984
197 Ga0436363_1662024 3300039450 Unclassified 907
198 Ga0466963_0000051 3300044694 Bacteria 39254
199 Ga0466963_0058658 3300044694 Bacteria 2567
200 Ga0466963_0140851 3300044694 Bacteria 1671
201 Ga0495592_0366595 3300046454 Bacteria 920
202 Ga0495603_0003294 3300046455 Bacteria 9611
203 Ga0495603_0017863 3300046455 Bacteria 4294
204 Ga0495629_0003154 3300046459 Bacteria 12483
205 Ga0495629_0022365 3300046459 Bacteria 4508
206 Ga0495629_0042208 3300046459 Bacteria 3206
207 Ga0495641_0018394 3300046461 Archaea 3606
208 Ga0495641_0052780 3300046461 Unclassified 1852
209 Ga0495651_0561868 3300046462 Unclassified 724
210 Ga0495653_0112075 3300046463 Bacteria 1959
211 Ga0495653_0155047 3300046463 Bacteria 1596
212 Ga0495582_0000002 3300046473 Bacteria 219909
213 Ga0495662_0019399 3300046476 Bacteria 3288
214 Ga0495662_0022903 3300046476 Bacteria 3015
215 Ga0495662_0069045 3300046476 Bacteria 1712
216 Ga0495594_0000001 3300046499 Bacteria 293051
217 Ga0495606_0000886 3300046507 Bacteria 44754
218 Ga0495608_0000071 3300046511 Bacteria 77182
219 Ga0495608_0003011 3300046511 Bacteria 12031
220 Ga0495618_0000051 3300046514 Bacteria 87668
221 Ga0495620_0000154 3300046515 Bacteria 55875
222 Ga0495628_0032279 3300046516 Bacteria 4228
223 Ga0495630_0000027 3300046517 Bacteria 146589
224 Ga0495630_0000125 3300046517 Bacteria 61325
225 Ga0495652_0000009 3300046529 Bacteria 311000
226 Ga0495652_0136895 3300046529 Bacteria 1931
227 Ga0495586_0008656 3300046535 Bacteria 5418
228 Ga0495587_0001679 3300046536 Bacteria 14777
229 Ga0495587_0085269 3300046536 Bacteria 1829
230 Ga0495645_0005720 3300046543 Bacteria 8566
231 Ga0495645_0029900 3300046543 Bacteria 3967
232 Ga0495622_0000033 3300046557 Bacteria 124162
233 Ga0495667_0000019 3300046559 Bacteria 181645
234 Ga0495667_0082351 3300046559 Bacteria 2091
235 Ga0495634_0000728 3300046642 Bacteria 31906
236 Ga0495634_0001282 3300046642 Bacteria 23024
237 Ga0495634_0010090 3300046642 Bacteria 6933
238 Ga0495634_0023515 3300046642 Bacteria 4330
239 Ga0495625_0453204 3300046660 Bacteria 792
240 Ga0495635_0000017 3300046663 Bacteria 195506
241 Ga0495635_0012168 3300046663 Bacteria 6033
242 Ga0495635_0048705 3300046663 Bacteria 2921
243 Ga0495657_0000096 3300046675 Bacteria 77239
244 Ga0495657_0017703 3300046675 Bacteria 5169
245 Ga0495599_0102178 3300046678 Bacteria 1787
246 Ga0495647_0000707 3300046681 Bacteria 9923
247 Ga0495658_0000001 3300046683 Bacteria 385362
248 Ga0495658_0002175 3300046683 Bacteria 9917
249 Ga0495658_0016565 3300046683 Bacteria 3794
250 Ga0495669_0000067 3300046684 Bacteria 68406
251 Ga0495669_0003115 3300046684 Bacteria 6824
252 Ga0495613_0000067 3300046689 Bacteria 101960
253 Ga0495613_0000155 3300046689 Bacteria 67203
254 Ga0495613_0040081 3300046689 Bacteria 3471
255 Ga0495624_0000200 3300046690 Bacteria 45997
256 Ga0495624_0353748 3300046690 Unclassified 883
257 Ga0495600_0001022 3300046809 Bacteria 15110
258 Ga0495600_0132196 3300046809 Bacteria 1622
259 Ga0495604_0000252 3300047317 Bacteria 47517
260 Ga0495604_0004840 3300047317 Bacteria 10669
261 Ga0495672_0116586 3300047320 Unclassified 1426
262 Ga0495676_0001522 3300047321 Bacteria 20074
263 Ga0495676_0014385 3300047321 Bacteria 7081
264 Ga0495676_0430178 3300047321 Unclassified 873
265 Ga0495680_0001106 3300047322 Bacteria 29781
266 Ga0495680_0003503 3300047322 Bacteria 15397
267 Ga0495680_0009313 3300047322 Bacteria 8845
268 Ga0495680_0268229 3300047322 Bacteria 1206
269 Ga0495675_0000036 3300047444 Bacteria 91842
270 Ga0495679_032643 3300047446 Bacteria 1668
271 Ga0495684_0328312 3300047471 Bacteria 1092
272 Ga0495593_0151117 3300047673 Bacteria 1174
273 Ga0495602_0000548 3300048088 Bacteria 35114
274 Ga0495602_0045718 3300048088 Bacteria 3960
275 Ga0496100_0000006 3300048903 Bacteria 297429
276 Ga0496100_0063756 3300048903 Bacteria 2436
277 Ga0496101_0000009 3300048904 Bacteria 297429
278 Ga0496101_0034365 3300048904 Bacteria 3580
279 Ga0496102_0512533 3300048905 Bacteria 1122
280 Ga0496102_0829426 3300048905 Bacteria 847
281 Ga0496104_0000029 3300048907 Bacteria 202968
282 Ga0496104_0002134 3300048907 Bacteria 17161
283 Ga0496105_0000002 3300048908 Bacteria 753215
284 Ga0496105_0001818 3300048908 Bacteria 15276
285 Ga0496106_0000072 3300048909 Bacteria 80978
286 Ga0496106_0001291 3300048909 Bacteria 18817
287 Ga0496106_0298775 3300048909 Bacteria 1291
288 Ga0496107_0000015 3300048910 Bacteria 173644
289 Ga0496107_0025573 3300048910 Bacteria 4180
290 Ga0496108_0000004 3300048911 Bacteria 545055
291 Ga0496108_0000239 3300048911 Bacteria 49308
292 Ga0496108_0002920 3300048911 Bacteria 13744
293 Ga0496108_0016161 3300048911 Bacteria 6085
294 Ga0496108_0589093 3300048911 Bacteria 969
295 Ga0496109_0000011 3300048912 Bacteria 234908
296 Ga0496109_0000031 3300048912 Bacteria 163998
297 Ga0496109_0000304 3300048912 Bacteria 46522
298 Ga0496109_0000369 3300048912 Bacteria 41635
299 Ga0496109_0009459 3300048912 Bacteria 8309
300 Ga0496110_0000171 3300048913 Bacteria 39922
301 Ga0496110_0244054 3300048913 Unclassified 1635
302 Ga0496111_0000020 3300048914 Bacteria 67992
303 Ga0496112_0000641 3300048915 Bacteria 24272
304 Ga0496112_0083023 3300048915 Bacteria 3168
305 Ga0496113_0000002 3300048916 Bacteria 220193
306 Ga0496113_0406397 3300048916 Unclassified 1093
307 Ga0496114_0000003 3300048917 Bacteria 630981
308 Ga0496114_0067954 3300048917 Bacteria 2991
309 Ga0496114_0112217 3300048917 Bacteria 2336
310 Ga0496115_0000022 3300048918 Bacteria 164224
311 Ga0496115_0000027 3300048918 Bacteria 145505
312 Ga0496115_0044379 3300048918 Bacteria 3545
313 Ga0496116_0000138 3300048919 Bacteria 151606
314 Ga0496117_0002585 3300048920 Bacteria 22522
315 Ga0496118_0001672 3300048921 Bacteria 32516
316 Ga0496118_0261894 3300048921 Unclassified 975
317 Ga0496119_0004068 3300048922 Bacteria 14751
318 Ga0496119_0007922 3300048922 Bacteria 9454
319 Ga0496120_0001397 3300048923 Bacteria 29221
320 Ga0496126_0046969 3300048929 Bacteria 3955
321 Ga0496126_0094459 3300048929 Bacteria 2624
322 Ga0501047_0138259 3300049581 Unclassified 2315
323 Ga0501070_0005207 3300049586 Bacteria 11084
324 Ga0501083_0022284 3300049744 Bacteria 4395
325 nmdc:mga0yw44_236774_c1 3300050492 Bacteria 1213
326 nmdc:mga05p37_472487_c1 3300050507 Bacteria 1446
327 nmdc:mga0n895_247189_c1 3300050512 Bacteria 1810
328 nmdc:mga0n895_397584_c1 3300050512 Bacteria 1394
329 nmdc:mga0rr50_45221_c1 3300050513 Bacteria 3234
330 nmdc:mga08x19_493569_c1 3300050514 Bacteria 864
331 nmdc:mga0a205_560075_c1 3300050515 Bacteria 998
332 nmdc:mga0a205_9195_c1 3300050515 Bacteria 9020
333 Ga0495601_0000019 3300053077 Bacteria 161673
334 Ga0495601_0011249 3300053077 Bacteria 5347
335 Ga0495601_0016446 3300053077 Bacteria 4483
336 Ga0495601_0068018 3300053077 Bacteria 2270
337 Ga0495601_0266869 3300053077 Bacteria 1117
338 Ga0495612_0010522 3300053078 Bacteria 3739
339 Ga0495612_0038164 3300053078 Bacteria 1952
340 Ga0495612_0046990 3300053078 Bacteria 1768
341 Ga0495612_0151123 3300053078 Bacteria 1011
342 Ga0495595_0000009 3300053084 Bacteria 193039
343 Ga0495595_0163261 3300053084 Bacteria 1100
344 Ga0495619_0000001 3300053085 Bacteria 586054
345 Ga0495619_0000022 3300053085 Bacteria 184144
346 Ga0495619_0000124 3300053085 Bacteria 56387
347 Ga0495619_0000177 3300053085 Bacteria 46800
348 Ga0495619_0000649 3300053085 Bacteria 22812
349 Ga0495619_0002165 3300053085 Bacteria 13016
350 Ga0495619_0007570 3300053085 Bacteria 6875
351 Ga0495619_0169723 3300053085 Bacteria 1508
352 Ga0495619_0208904 3300053085 Bacteria 1352
353 Ga0496108_0000904
354 JGI25404J52841_10031783
355 Ga0070658_10032896
356 Ga0070683_100001764
357 Ga0070683_100004081
358 Ga0070677_10000021
359 Ga0070682_100000334
360 Ga0068868_100000615
361 Ga0070660_100210304
362 Ga0070660_100229107
363 Ga0070689_100027653
364 Ga0070687_100033698
365 Ga0070661_100000255
366 Ga0070692_10175873
367 Ga0070668_100008466
368 Ga0070674_100000034
369 Ga0070674_100001938
370 Ga0070688_100003986
371 Ga0070688_100008337
372 Ga0070659_100000954
373 Ga0070667_100048020
374 Ga0070667_100113221
375 Ga0070714_100001276
376 Ga0070714_100045577
377 Ga0070714_100052229
378 Ga0070713_100000101
379 Ga0070711_100165473
380 Ga0070662_100000001
381 Ga0070681_10015709
382 Ga0070681_10393981
383 Ga0070685_10001176
384 Ga0070679_100000365
385 Ga0070684_100021460
386 Ga0070684_100041158
387 Ga0068853_100240008
388 Ga0070686_100033718
389 Ga0070693_100001286
390 Ga0070693_100134450
391 Ga0068857_100045400
392 Ga0068854_100000267
393 Ga0068854_100017154
394 Ga0068856_100001040
395 Ga0068856_100026649
396 Ga0070702_100233551
397 Ga0068852_100000132
398 Ga0068859_101112114
399 Ga0068866_10000005
400 Ga0068866_10000891
401 Ga0068851_10002447
402 Ga0068851_10004966
403 Ga0068863_100000050
404 Ga0068858_100000017
405 Ga0068860_100590315
406 Ga0068862_100006605
407 Ga0081455_10001231
408 Ga0081455_10051128
409 Ga0081540_1000046
410 Ga0070717_10000006
411 Ga0075365_10311936
412 Ga0075368_10048130
413 Ga0075363_100408192
414 Ga0075364_10200306
415 Ga0070712_100000003
416 Ga0075369_10014393
417 Ga0075433_10020838
418 Ga0075433_10188661
419 Ga0075434_100077172
420 Ga0068865_100000039
421 Ga0068865_100540610
422 Ga0097620_101112210
423 Ga0075435_100039664
424 Ga0105240_10108593
425 Ga0111539_10640010
426 Ga0105245_10000022
427 Ga0105245_10001911
428 Ga0105245_10007491
429 Ga0105245_10025648
430 Ga0105245_10289515
431 Ga0105245_10683842
432 Ga0105247_10000832
433 Ga0105241_10209044
434 Ga0105242_10003703
435 Ga0105242_10091353
436 Ga0105248_10000017
437 Ga0105248_10315184
438 Ga0105238_10000016
439 Ga0105249_10000054
440 Ga0105249_10024928
441 Ga0105249_10475417
442 Ga0105239_10067201
443 Ga0157371_10005762
444 Ga0157370_10018159
445 Ga0157370_10022495
446 Ga0157369_10000803
447 Ga0157378_10003220
448 Ga0157378_10052238
449 Ga0157378_10519642
450 Ga0163162_10998599
451 Ga0157372_10000407
452 Ga0157372_10463320
453 Ga0157375_10000194
454 Ga0157375_10013139
455 Ga0157375_10258097
456 Ga0163163_10979274
457 Ga0157379_10029192
458 Ga0157379_10037859
459 Ga0207656_10000620
460 Ga0207656_10001698
461 Ga0207682_10000020
462 Ga0207642_10000005
463 Ga0207642_10000681
464 Ga0207710_10000227
465 Ga0207688_10127969
466 Ga0207654_10025727
467 Ga0207707_10136672
468 Ga0207695_10081727
469 Ga0207693_10000009
470 Ga0207693_10006350
471 Ga0207663_10263933
472 Ga0207663_10576573
473 Ga0207663_10709317
474 Ga0207657_10285320
475 Ga0207649_10000015
476 Ga0207652_10000536
477 Ga0207694_10000012
478 Ga0207687_10000025
479 Ga0207687_10000065
480 Ga0207687_10001395
481 Ga0207687_10001642
482 Ga0207700_10000019
483 Ga0207664_10000060
484 Ga0207664_10008355
485 Ga0207664_10038748
486 Ga0207664_10042397
487 Ga0207706_10000003
488 Ga0207686_10001801
489 Ga0207686_10058571
490 Ga0207686_10352027
491 Ga0207686_10691134
492 Ga0207709_10099872
493 Ga0207670_10024168
494 Ga0207669_10000002
495 Ga0207669_10000060
496 Ga0207704_10000165
497 Ga0207711_10000011
498 Ga0207661_10009098
499 Ga0207661_10010577
500 Ga0207661_10738496
501 Ga0207667_10662091
502 Ga0207712_10000032
503 Ga0207712_10608579
504 Ga0207668_10007808
505 Ga0207640_10002975
506 Ga0207640_10012422
507 Ga0207640_10177945
508 Ga0207658_10026209
509 Ga0207658_10082253
510 Ga0207677_10000163
511 Ga0207703_10000030
512 Ga0207639_10166800
513 Ga0207702_10000349
514 Ga0207702_10068076
515 Ga0207702_10313114
516 Ga0207641_10004313
517 Ga0207641_10526971
518 Ga0207674_10092994
519 Ga0207698_10000014
520 Ga0268265_10034234
521 Ga0265337_1002089
522 Ga0265326_10000024
523 Ga0265326_10000033
524 Ga0265319_1000037
525 Ga0265334_10000078
526 Ga0265323_10168337
527 Ga0265322_10000017
528 Ga0265336_10019377
529 Ga0265338_10000051
530 Ga0265338_10018497
531 Ga0265324_10000479
532 Ga0265332_10028836
533 Ga0265328_10002684
534 Ga0265320_10000010
535 Ga0265329_10045987
536 Ga0265331_10000505
537 Ga0265327_10000040
538 Ga0265316_10031948
539 Ga0265313_10042670
540 Ga0265314_10000803
541 Ga0265342_10079499
542 Ga0316583_10164854
543 Ga0373953_0170355
544 Ga0373924_0226122
545 Ga0373937_0047810
546 Ga0316582_0416473
547 Ga0436360_0475298
548 Ga0436363_1293873
549 Ga0436363_1662024
550 Ga0466963_0000051
551 Ga0466963_0058658
552 Ga0466963_0140851
553 Ga0495592_0366595
554 Ga0495603_0003294
555 Ga0495603_0017863
556 Ga0495629_0003154
557 Ga0495629_0022365
558 Ga0495629_0042208
559 Ga0495641_0018394
560 Ga0495641_0052780
561 Ga0495651_0561868
562 Ga0495653_0112075
563 Ga0495653_0155047
564 Ga0495582_0000002
565 Ga0495662_0019399
566 Ga0495662_0022903
567 Ga0495662_0069045
568 Ga0495594_0000001
569 Ga0495606_0000886
570 Ga0495608_0000071
571 Ga0495608_0003011
572 Ga0495618_0000051
573 Ga0495620_0000154
574 Ga0495628_0032279
575 Ga0495630_0000027
576 Ga0495630_0000125
577 Ga0495652_0000009
578 Ga0495652_0136895
579 Ga0495586_0008656
580 Ga0495587_0001679
581 Ga0495587_0085269
582 Ga0495645_0005720
583 Ga0495645_0029900
584 Ga0495622_0000033
585 Ga0495667_0000019
586 Ga0495667_0082351
587 Ga0495634_0000728
588 Ga0495634_0001282
589 Ga0495634_0010090
590 Ga0495634_0023515
591 Ga0495625_0453204
592 Ga0495635_0000017
593 Ga0495635_0012168
594 Ga0495635_0048705
595 Ga0495657_0000096
596 Ga0495657_0017703
597 Ga0495599_0102178
598 Ga0495647_0000707
599 Ga0495658_0000001
600 Ga0495658_0002175
601 Ga0495658_0016565
602 Ga0495669_0000067
603 Ga0495669_0003115
604 Ga0495613_0000067
605 Ga0495613_0000155
606 Ga0495613_0040081
607 Ga0495624_0000200
608 Ga0495624_0353748
609 Ga0495600_0001022
610 Ga0495600_0132196
611 Ga0495604_0000252
612 Ga0495604_0004840
613 Ga0495672_0116586
614 Ga0495676_0001522
615 Ga0495676_0014385
616 Ga0495676_0430178
617 Ga0495680_0001106
618 Ga0495680_0003503
619 Ga0495680_0009313
620 Ga0495680_0268229
621 Ga0495675_0000036
622 Ga0495679_032643
623 Ga0495684_0328312
624 Ga0495593_0151117
625 Ga0495602_0000548
626 Ga0495602_0045718
627 Ga0496100_0000006
628 Ga0496100_0063756
629 Ga0496101_0000009
630 Ga0496101_0034365
631 Ga0496102_0512533
632 Ga0496102_0829426
633 Ga0496104_0000029
634 Ga0496104_0002134
635 Ga0496105_0000002
636 Ga0496105_0001818
637 Ga0496106_0000072
638 Ga0496106_0001291
639 Ga0496106_0298775
640 Ga0496107_0000015
641 Ga0496107_0025573
642 Ga0496108_0000004
643 Ga0496108_0000239
644 Ga0496108_0002920
645 Ga0496108_0016161
646 Ga0496108_0589093
647 Ga0496109_0000011
648 Ga0496109_0000031
649 Ga0496109_0000304
650 Ga0496109_0000369
651 Ga0496109_0009459
652 Ga0496110_0000171
653 Ga0496110_0244054
654 Ga0496111_0000020
655 Ga0496112_0000641
656 Ga0496112_0083023
657 Ga0496113_0000002
658 Ga0496113_0406397
659 Ga0496114_0000003
660 Ga0496114_0067954
661 Ga0496114_0112217
662 Ga0496115_0000022
663 Ga0496115_0000027
664 Ga0496115_0044379
665 Ga0496116_0000138
666 Ga0496117_0002585
667 Ga0496118_0001672
668 Ga0496118_0261894
669 Ga0496119_0004068
670 Ga0496119_0007922
671 Ga0496120_0001397
672 Ga0496126_0046969
673 Ga0496126_0094459
674 Ga0501047_0138259
675 Ga0501070_0005207
676 Ga0501083_0022284
677 nmdc:mga0yw44_236774_c1
678 nmdc:mga05p37_472487_c1
679 nmdc:mga0n895_247189_c1
680 nmdc:mga0n895_397584_c1
681 nmdc:mga0rr50_45221_c1
682 nmdc:mga08x19_493569_c1
683 nmdc:mga0a205_560075_c1
684 nmdc:mga0a205_9195_c1
685 Ga0495601_0000019
686 Ga0495601_0011249
687 Ga0495601_0016446
688 Ga0495601_0068018
689 Ga0495601_0266869
690 Ga0495612_0010522
691 Ga0495612_0038164
692 Ga0495612_0046990
693 Ga0495612_0151123
694 Ga0495595_0000009
695 Ga0495595_0163261
696 Ga0495619_0000001
697 Ga0495619_0000022
698 Ga0495619_0000124
699 Ga0495619_0000177
700 Ga0495619_0000649
701 Ga0495619_0002165
702 Ga0495619_0007570
703 Ga0495619_0169723
704 Ga0495619_0208904

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z09-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein from thermus thermophilus hb8 0.802 1 124
2z09-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein from thermus thermophilus hb8 0.7843 1 124
2z08-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein from thermus thermophilus hb8 0.7842 1 115
3qtb-assembly1.cif.gz_A structure of the universal stress protein from archaeoglobus fulgidus in complex with damp 0.7819 3 95
3fh0-assembly1.cif.gz_A crystal structure of putative universal stress protein kpn_01444 - atpase 0.7815 1 115
ID Description Score Start End Superfamily
af_A0A1D6IXZ9_18_150_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8043 1 99 3.40.50.620
2z09A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.802 1 124 3.40.50.620
af_Q54L57_1_123_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7852 3 124 3.40.50.620
2z09A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7843 1 124 3.40.50.620
af_A0A1P8AST2_6_157_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7832 1 101 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A538C5W7-F1-model_v4 UspA domain-containing protein 0.9606 1 217
AF-A0A2W6BTD6-F1-model_v4 UspA domain-containing protein 0.9604 1 217
AF-A0A538KMW8-F1-model_v4 UspA domain-containing protein 0.9577 1 217
AF-A0A538C5W7-F1-model_v4 UspA domain-containing protein 0.9563 1 217
AF-A0A2W6BTD6-F1-model_v4 UspA domain-containing protein 0.9561 1 217

Map