F419199

General Info

Members Datasets Scaffolds Average Seq Length
352 240 337 203

Family's Representative Sequence

Representative Sequence 3300049850|Ga0501204_006130|Ga0501204_006130_232_900
Length 222
Sequence MDSCLRGNDGNSQKYGDLRMSLIIWGRLNSHNVKKVAWLAVEAGIDHERRDIGGKFGFTDAYLAMNPNRLIPTIDDDGFILWESNAIVRYLADRYAPALVPADPQAKASADRWMDWQFSYADAQRDAFVNLVRKGPEDRDMAAVAAAAKACDAAMAILDSTLARQPWLSGDRFGIGDVPMGVYVHTWFTLAIERSERPHVAAWYERLKGRPGYADNVMIPLS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
4 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
5 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
6 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
7 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
8 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
9 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
10 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
11 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
12 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
13 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
14 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
15 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
16 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
17 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
96 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
150 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
180 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
185 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
186 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
187 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
188 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
216 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
217 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
220 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
221 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
227 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
230 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
231 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
232 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
233 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
234 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
235 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
236 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
237 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
238 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
239 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
240 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.74
Metatranscriptomes 0
Isolates 4.26

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 18.75
Nodule 0.28
Rhizoplane 3.12
Rhizosphere 65.06
Stem 0
Stem Tuber 0
Unclassified 12.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2237776 2162886007 Bacteria 72079
2 JGI24741J21665_1000486 3300001915 Bacteria 12107
3 JGI24740J21852_10023526 3300001979 Bacteria 2103
4 JGI24739J22299_10025215 3300001989 Bacteria 2091
5 JGI24737J22298_10008346 3300001990 Bacteria 3472
6 JGI25151J46595_10101123 3300003187 Bacteria 776
7 JGI25153J46596_10000113 3300003215 Bacteria 92345
8 rootH1_10266815 3300003323 Bacteria 1582
9 Ga0055525_1000051 3300003759 Bacteria 240942
10 Ga0055542_1000677 3300003762 Bacteria 27414
11 Ga0055529_1000016 3300003763 Bacteria 364775
12 Ga0055536_1000542 3300003781 Bacteria 25852
13 Ga0055534_1010821 3300003784 Bacteria 1885
14 Ga0055530_10000187 3300003791 Bacteria 55610
15 Ga0055530_10005657 3300003791 Bacteria 5853
16 Ga0055531_10000760 3300003794 Bacteria 27012
17 Ga0065704_10070144 3300005289 Bacteria 333223
18 Ga0065704_10148496 3300005289 Bacteria 1450
19 Ga0070658_10000697 3300005327 Bacteria 29129
20 Ga0070666_10003475 3300005335 Bacteria 9547
21 Ga0070660_100011785 3300005339 Bacteria 6227
22 Ga0070660_100012000 3300005339 Bacteria 6181
23 Ga0070661_100003943 3300005344 Bacteria 10204
24 Ga0070661_100146857 3300005344 Bacteria 1781
25 Ga0070668_100115565 3300005347 Bacteria 2139
26 Ga0070667_100000528 3300005367 Bacteria 38357
27 Ga0070708_100052193 3300005445 Bacteria 3625
28 Ga0070678_100013099 3300005456 Bacteria 5185
29 Ga0070678_100390974 3300005456 Bacteria 1206
30 Ga0070662_100012795 3300005457 Bacteria 5570
31 Ga0068867_101021183 3300005459 Bacteria 751
32 Ga0070706_100013897 3300005467 Bacteria 7441
33 Ga0070706_100584931 3300005467 Unclassified 1038
34 Ga0070707_100077510 3300005468 Bacteria 3207
35 Ga0070707_101118025 3300005468 Bacteria 754
36 Ga0070698_100159168 3300005471 Bacteria 2203
37 Ga0070699_100031727 3300005518 Bacteria 4561
38 Ga0070684_100484284 3300005535 Bacteria 1145
39 Ga0070697_100006959 3300005536 Bacteria 8795
40 Ga0070697_100042224 3300005536 Bacteria 3690
41 Ga0068853_100018741 3300005539 Bacteria 5732
42 Ga0070672_100220711 3300005543 Bacteria 1590
43 Ga0070696_100295079 3300005546 Bacteria 1240
44 Ga0070665_100000044 3300005548 Bacteria 276702
45 Ga0070665_100091577 3300005548 Bacteria 3045
46 Ga0070665_100243680 3300005548 Bacteria 1798
47 Ga0070665_101439221 3300005548 Bacteria 698
48 Ga0070704_100074520 3300005549 Bacteria 2476
49 Ga0070664_100351097 3300005564 Bacteria 1342
50 Ga0068854_100510774 3300005578 Bacteria 1013
51 Ga0068856_100098542 3300005614 Bacteria 2913
52 Ga0068859_100153646 3300005617 Bacteria 2378
53 Ga0068864_100000017 3300005618 Bacteria 285607
54 Ga0068851_10036787 3300005834 Bacteria 2452
55 Ga0068863_100000018 3300005841 Bacteria 206948
56 Ga0068863_100023975 3300005841 Bacteria 5823
57 Ga0068858_100092176 3300005842 Bacteria 2820
58 Ga0068858_100336900 3300005842 Bacteria 1443
59 Ga0068862_100000010 3300005844 Bacteria 285607
60 Ga0068862_100023143 3300005844 Bacteria 5202
61 Ga0068862_100177003 3300005844 Bacteria 1913
62 Ga0081539_10046000 3300005985 Bacteria 2504
63 Ga0075365_10002078 3300006038 Bacteria 9561
64 Ga0075368_10000503 3300006042 Bacteria 11617
65 Ga0075363_100001970 3300006048 Bacteria 8162
66 Ga0075364_10027259 3300006051 Bacteria 3648
67 Ga0075364_10697931 3300006051 Bacteria 692
68 Ga0075432_10001579 3300006058 Bacteria 7470
69 Ga0075362_10001342 3300006177 Bacteria 7780
70 Ga0075362_10149761 3300006177 Bacteria 1119
71 Ga0075367_10001466 3300006178 Bacteria 10180
72 Ga0075369_10002228 3300006186 Bacteria 6875
73 Ga0075369_10032500 3300006186 Bacteria 2208
74 Ga0075369_10057399 3300006186 Bacteria 1693
75 Ga0075369_10269764 3300006186 Bacteria 792
76 Ga0075366_10011070 3300006195 Bacteria 5081
77 Ga0075366_10014289 3300006195 Bacteria 4534
78 Ga0075366_10326135 3300006195 Bacteria 941
79 Ga0075370_10031362 3300006353 Bacteria 2967
80 Ga0075370_10160025 3300006353 Bacteria 1321
81 Ga0075370_10324975 3300006353 Bacteria 917
82 Ga0097620_100153646 3300006931 Bacteria 2378
83 Ga0075435_100258733 3300007076 Bacteria 1483
84 Ga0105251_10007273 3300009011 Bacteria 6860
85 Ga0105240_10864930 3300009093 Bacteria 975
86 Ga0111539_10068660 3300009094 Bacteria 4185
87 Ga0105247_10027497 3300009101 Bacteria 3439
88 Ga0114129_11133368 3300009147 Bacteria 978
89 Ga0105243_10000782 3300009148 Bacteria 30522
90 Ga0105241_10001365 3300009174 Bacteria 18600
91 Ga0105248_10000105 3300009177 Bacteria 94143
92 Ga0105248_10001360 3300009177 Bacteria 27285
93 Ga0105238_10123941 3300009551 Bacteria 2563
94 Ga0105249_10000207 3300009553 Bacteria 67193
95 Ga0105249_10229625 3300009553 Bacteria 1830
96 Ga0105246_10185112 3300011119 Bacteria 1607
97 Ga0157326_1000752 3300012513 Bacteria 3796
98 Ga0157326_1006565 3300012513 Bacteria 1244
99 Ga0157371_10000146 3300013102 Bacteria 103290
100 Ga0157370_10098391 3300013104 Bacteria 2743
101 Ga0157370_10107410 3300013104 Bacteria 2611
102 Ga0157374_10391078 3300013296 Bacteria 1386
103 Ga0163162_10019962 3300013306 Bacteria 6582
104 Ga0163162_10143842 3300013306 Bacteria 2499
105 Ga0163162_10893827 3300013306 Bacteria 1002
106 Ga0157372_10139286 3300013307 Bacteria 2794
107 Ga0163163_10184792 3300014325 Bacteria 2132
108 Ga0157379_10040747 3300014968 Bacteria 4146
109 Ga0157376_10502299 3300014969 Bacteria 1192
110 Ga0209563_100019 3300025230 Bacteria 697828
111 Ga0207425_1017287 3300025245 Bacteria 1587
112 Ga0209148_1000017 3300025254 Bacteria 787064
113 Ga0209455_1000005 3300025272 Bacteria 1416756
114 Ga0209675_1000196 3300025291 Bacteria 65422
115 Ga0209025_1017648 3300025294 Bacteria 4101
116 Ga0209758_1000035 3300025297 Bacteria 448190
117 Ga0209050_1000218 3300025298 Bacteria 128776
118 Ga0209050_1000279 3300025298 Bacteria 109034
119 Ga0209257_1000130 3300025304 Bacteria 212188
120 Ga0209257_1004144 3300025304 Bacteria 11536
121 Ga0207656_10002030 3300025321 Bacteria 6759
122 Ga0207713_1024768 3300025735 Bacteria 2787
123 Ga0207710_10015171 3300025900 Bacteria 3254
124 Ga0207705_10000220 3300025909 Bacteria 56835
125 Ga0207684_10120894 3300025910 Bacteria 2245
126 Ga0207654_10000650 3300025911 Bacteria 19636
127 Ga0207657_10020851 3300025919 Bacteria 6185
128 Ga0207649_10006153 3300025920 Bacteria 6515
129 Ga0207649_10081116 3300025920 Bacteria 2100
130 Ga0207649_10172195 3300025920 Bacteria 1509
131 Ga0207646_10190931 3300025922 Unclassified 1850
132 Ga0207681_10174819 3300025923 Bacteria 1631
133 Ga0207681_10304017 3300025923 Bacteria 1263
134 Ga0207694_10131270 3300025924 Bacteria 2008
135 Ga0207650_10000057 3300025925 Bacteria 156913
136 Ga0207659_10434026 3300025926 Bacteria 1104
137 Ga0207706_10045680 3300025933 Bacteria 3880
138 Ga0207709_10000031 3300025935 Bacteria 329046
139 Ga0207669_10000057 3300025937 Bacteria 56270
140 Ga0207669_10038360 3300025937 Bacteria 2757
141 Ga0207665_10148968 3300025939 Bacteria 1675
142 Ga0207691_10031042 3300025940 Bacteria 4990
143 Ga0207711_10000031 3300025941 Bacteria 203323
144 Ga0207711_10055575 3300025941 Bacteria 3399
145 Ga0207661_10542009 3300025944 Bacteria 1065
146 Ga0207667_10001207 3300025949 Bacteria 32304
147 Ga0207712_10000234 3300025961 Bacteria 54386
148 Ga0207668_10019975 3300025972 Bacteria 4248
149 Ga0207640_10006429 3300025981 Bacteria 6448
150 Ga0207658_10001935 3300025986 Bacteria 15454
151 Ga0207658_10516081 3300025986 Bacteria 1066
152 Ga0207703_10226504 3300026035 Bacteria 1674
153 Ga0207639_10001334 3300026041 Bacteria 16655
154 Ga0207678_10015599 3300026067 Bacteria 6680
155 Ga0207702_10004382 3300026078 Bacteria 12574
156 Ga0207641_10000002 3300026088 Bacteria 981004
157 Ga0207676_10000005 3300026095 Bacteria 698744
158 Ga0207683_10020674 3300026121 Bacteria 5631
159 Ga0207683_10375598 3300026121 Bacteria 1306
160 Ga0207698_10000969 3300026142 Bacteria 16705
161 Ga0209813_10000147 3300027866 Bacteria 24313
162 Ga0207428_10057843 3300027907 Bacteria 3078
163 Ga0207428_10289689 3300027907 Bacteria 1214
164 Ga0268266_10000002 3300028379 Bacteria 3059047
165 Ga0268266_10444011 3300028379 Bacteria 1232
166 Ga0268266_11267837 3300028379 Unclassified 712
167 Ga0268265_10000003 3300028380 Bacteria 949201
168 Ga0268265_10197436 3300028380 Bacteria 1742
169 Ga0307515_10120496 3300028794 Bacteria 2976
170 Ga0307513_10012899 3300031456 Bacteria 10283
171 Ga0307513_10196008 3300031456 Bacteria 1866
172 Ga0307412_10064377 3300031911 Bacteria 2477
173 Ga0307409_100737123 3300031995 Bacteria 988
174 Ga0307414_10298246 3300032004 Bacteria 1362
175 Ga0307411_10047814 3300032005 Bacteria 2768
176 Ga0307510_10004156 3300033180 Bacteria 16999
177 Ga0307510_10180289 3300033180 Bacteria 1676
178 Ga0307510_10185091 3300033180 Bacteria 1639
179 Ga0395899_0206229 3300037312 Bacteria 1368
180 Ga0395905_0104377 3300037471 Bacteria 2661
181 Ga0451787_337081 3300041441 Bacteria 1310
182 Ga0439441_085719 3300042001 Bacteria 691
183 Ga0466963_0067649 3300044694 Bacteria 2398
184 Ga0466970_0117147 3300044765 Bacteria 1457
185 Ga0495627_000132 3300046453 Bacteria 90039
186 Ga0495638_0000033 3300046460 Bacteria 288195
187 Ga0495638_0107171 3300046460 Bacteria 1664
188 Ga0495650_0005480 3300046471 Bacteria 8225
189 Ga0495584_0092820 3300046491 Bacteria 1523
190 Ga0495585_0004745 3300046492 Bacteria 8746
191 Ga0495585_0081081 3300046492 Bacteria 1758
192 Ga0495583_0000673 3300046506 Bacteria 44600
193 Ga0495583_0002180 3300046506 Bacteria 17457
194 Ga0495583_0004636 3300046506 Bacteria 9709
195 Ga0495583_0022332 3300046506 Bacteria 3230
196 Ga0495583_0040163 3300046506 Bacteria 2200
197 Ga0495583_0075241 3300046506 Bacteria 1477
198 Ga0495606_0000434 3300046507 Bacteria 69495
199 Ga0495610_0000071 3300046512 Bacteria 121210
200 Ga0495610_0000433 3300046512 Bacteria 42994
201 Ga0495610_0177285 3300046512 Bacteria 889
202 Ga0495616_0043656 3300046513 Bacteria 2277
203 Ga0495631_0012132 3300046518 Bacteria 4219
204 Ga0495632_0000211 3300046519 Bacteria 59066
205 Ga0495632_0001135 3300046519 Bacteria 22761
206 Ga0495637_0000725 3300046520 Bacteria 22513
207 Ga0495637_0052319 3300046520 Bacteria 1705
208 Ga0495643_0000027 3300046522 Bacteria 266446
209 Ga0495643_0000053 3300046522 Bacteria 202031
210 Ga0495643_0000991 3300046522 Bacteria 29043
211 Ga0495643_0009995 3300046522 Bacteria 5859
212 Ga0495643_0019966 3300046522 Bacteria 3871
213 Ga0495643_0142769 3300046522 Bacteria 1192
214 Ga0495643_0214494 3300046522 Bacteria 916
215 Ga0495648_0000014 3300046524 Bacteria 288365
216 Ga0495648_0000750 3300046524 Bacteria 34697
217 Ga0495648_0122756 3300046524 Bacteria 1393
218 Ga0495648_0138948 3300046524 Bacteria 1281
219 Ga0495648_0265315 3300046524 Bacteria 821
220 Ga0495663_0000020 3300046525 Bacteria 124560
221 Ga0495663_0002604 3300046525 Bacteria 5376
222 Ga0495642_0234580 3300046528 Bacteria 801
223 Ga0495587_0057640 3300046536 Bacteria 2283
224 Ga0495609_0008194 3300046538 Bacteria 5131
225 Ga0495622_0003260 3300046557 Bacteria 7678
226 Ga0495633_0001684 3300046558 Bacteria 16614
227 Ga0495633_0002265 3300046558 Bacteria 13772
228 Ga0495633_0026695 3300046558 Bacteria 2830
229 Ga0495633_0080767 3300046558 Bacteria 1513
230 Ga0495633_0168148 3300046558 Bacteria 1011
231 Ga0495668_0000004 3300046616 Bacteria 574236
232 Ga0495668_0000007 3300046616 Bacteria 552902
233 Ga0495668_0142816 3300046616 Bacteria 1310
234 Ga0495668_0290151 3300046616 Bacteria 896
235 Ga0495668_0303583 3300046616 Bacteria 875
236 Ga0495611_0036591 3300046648 Bacteria 2179
237 Ga0495625_0000167 3300046660 Bacteria 102783
238 Ga0495625_0081418 3300046660 Bacteria 2253
239 Ga0495625_0197537 3300046660 Bacteria 1329
240 Ga0495625_0433988 3300046660 Bacteria 814
241 Ga0495661_0039100 3300046665 Bacteria 2950
242 Ga0495669_0000197 3300046684 Bacteria 37314
243 Ga0495670_0013329 3300046691 Bacteria 4044
244 Ga0495670_0025963 3300046691 Bacteria 2900
245 Ga0495671_0000019 3300046692 Bacteria 288186
246 Ga0495671_0000031 3300046692 Bacteria 202030
247 Ga0495671_0223752 3300046692 Bacteria 911
248 Ga0495649_0020566 3300046694 Bacteria 3702
249 Ga0495649_0027783 3300046694 Bacteria 3138
250 Ga0495600_0032388 3300046809 Bacteria 3391
251 Ga0495660_0027657 3300046810 Bacteria 3208
252 Ga0495672_0271553 3300047320 Bacteria 814
253 Ga0495683_0023859 3300047323 Bacteria 3142
254 Ga0495683_0078228 3300047323 Bacteria 1616
255 Ga0495687_000178 3300047443 Bacteria 93234
256 Ga0495687_001516 3300047443 Bacteria 21182
257 Ga0495677_0020444 3300047445 Bacteria 2400
258 Ga0495673_0000042 3300047469 Bacteria 288018
259 Ga0495681_0000228 3300047470 Bacteria 46877
260 Ga0495681_0007987 3300047470 Bacteria 6683
261 Ga0495681_0012134 3300047470 Bacteria 5077
262 Ga0495686_0000191 3300047472 Bacteria 114738
263 Ga0495686_0026386 3300047472 Bacteria 3801
264 Ga0495686_0102824 3300047472 Bacteria 1721
265 Ga0495626_0010236 3300048091 Bacteria 5020
266 Ga0496101_0549058 3300048904 Bacteria 913
267 Ga0496102_0001107 3300048905 Bacteria 24730
268 Ga0496103_0000647 3300048906 Bacteria 26335
269 Ga0496104_0137718 3300048907 Bacteria 2345
270 Ga0496105_0001897 3300048908 Bacteria 15004
271 Ga0496110_0034874 3300048913 Bacteria 4362
272 Ga0496111_0027957 3300048914 Bacteria 3995
273 Ga0496112_0644738 3300048915 Bacteria 989
274 Ga0496113_0172302 3300048916 Bacteria 1714
275 Ga0496115_0000416 3300048918 Bacteria 34725
276 Ga0496116_0000017 3300048919 Bacteria 554463
277 Ga0496116_0003681 3300048919 Bacteria 15022
278 Ga0496117_0001241 3300048920 Bacteria 38164
279 Ga0496117_0135880 3300048920 Bacteria 1481
280 Ga0496118_0000332 3300048921 Bacteria 80480
281 Ga0496118_0000580 3300048921 Bacteria 60421
282 Ga0496118_0228535 3300048921 Bacteria 1076
283 Ga0496119_0020594 3300048922 Bacteria 4805
284 Ga0496120_0008489 3300048923 Bacteria 7449
285 Ga0496121_0001577 3300048924 Bacteria 37973
286 Ga0496121_0005774 3300048924 Bacteria 15700
287 Ga0496122_0013061 3300048925 Bacteria 8177
288 Ga0496122_0021169 3300048925 Bacteria 5834
289 Ga0496122_0185957 3300048925 Bacteria 1232
290 Ga0496123_0003105 3300048926 Bacteria 19060
291 Ga0496123_0013046 3300048926 Bacteria 7014
292 Ga0496123_0032109 3300048926 Bacteria 3809
293 Ga0496124_0000626 3300048927 Bacteria 58823
294 Ga0496124_0011607 3300048927 Bacteria 8792
295 Ga0496124_0028845 3300048927 Bacteria 4956
296 Ga0496124_0114480 3300048927 Bacteria 2166
297 Ga0496125_0001330 3300048928 Bacteria 36490
298 Ga0496125_0031228 3300048928 Bacteria 4750
299 Ga0496126_0000359 3300048929 Bacteria 94946
300 Ga0496126_0000752 3300048929 Bacteria 58828
301 Ga0496126_0179669 3300048929 Bacteria 1798
302 Ga0496126_0396600 3300048929 Bacteria 1120
303 Ga0501032_0215160 3300049569 Bacteria 1252
304 Ga0501037_0196901 3300049573 Bacteria 1425
305 Ga0501073_0074889 3300049589 Bacteria 2357
306 Ga0501249_000162 3300049679 Bacteria 20650
307 Ga0501259_017350 3300049688 Bacteria 1247
308 Ga0501262_005187 3300049759 Bacteria 1533
309 Ga0501044_0001405 3300049823 Bacteria 28253
310 Ga0501204_006130 3300049850 Bacteria 1330
311 nmdc:mga03683_6348_c1 3300050489 Bacteria 4043
312 nmdc:mga03n38_8463_c1 3300050490 Bacteria 3694
313 nmdc:mga00v17_100066_c1 3300050491 Bacteria 1829
314 nmdc:mga00v17_375317_c1 3300050491 Bacteria 925
315 nmdc:mga00v17_375321_c1 3300050491 Bacteria 925
316 nmdc:mga0yw44_232954_c1 3300050492 Bacteria 1223
317 nmdc:mga0k408_148417_c1 3300050493 Bacteria 1396
318 nmdc:mga06z11_327_c1 3300050494 Bacteria 18014
319 nmdc:mga04h51_165_c1 3300050495 Bacteria 18963
320 nmdc:mga07m45_38812_c1 3300050496 Bacteria 2659
321 nmdc:mga07m45_439336_c1 3300050496 Bacteria 757
322 nmdc:mga07m45_4_c1 3300050496 Bacteria 409607
323 nmdc:mga0n895_541021_c1 3300050512 Bacteria 1171
324 nmdc:mga0sz30_22949_c1 3300050516 Bacteria 2535
325 nmdc:mga0sz30_26105_c2 3300050516 Bacteria 1693
326 nmdc:mga0sz30_305_c1 3300050516 Bacteria 18882
327 Ga0500610_0002602 3300053079 Bacteria 6700
328 Ga0500592_002078 3300053116 Bacteria 3227
329 Ga0500595_000230 3300053119 Bacteria 37914
330 Ga0500607_000766 3300053121 Bacteria 30929
331 Ga0500618_009187 3300053125 Bacteria 2712
332 Ga0500642_0006747 3300053130 Bacteria 3808
333 Ga0500619_011070 3300053154 Bacteria 2305
334 Ga0500645_000011 3300053730 Bacteria 169616
335 Ga0500645_020584 3300053730 Bacteria 2044
336 Ga0500596_001467 3300053735 Bacteria 4768
337 Ga0500661_005809 3300055283 Bacteria 2302

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006051 Ga0075364_10697931 Ga0075364_106979311 188
2 3300005548 Ga0070665_101439221 Ga0070665_1014392211 194
3 3300028379 Ga0268266_11267837 Ga0268266_112678371 194
4 3300046558 Ga0495633_0168148 Ga0495633_0168148_331_954 194
5 3300050489 nmdc:mga03683_6348_c1 nmdc:mga03683_6348_c1_2327_2917 196
6 3300050490 nmdc:mga03n38_8463_c1 nmdc:mga03n38_8463_c1_2936_3526 196
7 3300050491 nmdc:mga00v17_375321_c1 nmdc:mga00v17_375321_c1_103_693 196
8 3300050492 nmdc:mga0yw44_232954_c1 nmdc:mga0yw44_232954_c1_128_718 196
9 3300050494 nmdc:mga06z11_327_c1 nmdc:mga06z11_327_c1_12287_12877 196
10 3300050495 nmdc:mga04h51_165_c1 nmdc:mga04h51_165_c1_14382_14972 196
11 3300050496 nmdc:mga07m45_4_c1 nmdc:mga07m45_4_c1_131868_132458 196
12 iso_pu_bacteria 2739367664 2739650012 198
13 iso_pu_bacteria 2739367865 2740028485 198
14 iso_pu_bacteria 2751185897 2753765272 198
15 iso_pu_bacteria 2582581305 2585260030 199
16 iso_pu_bacteria 2643221541 2643730672 199
17 iso_pu_bacteria 2643221560 2643820570 199
18 iso_pu_bacteria 2643221605 2644040760 199
19 iso_pu_bacteria 2643221606 2644044674 199
20 iso_pu_bacteria 2643221671 2644391401 199
21 iso_pu_bacteria 2757320392 2757570976 199
22 iso_pu_bacteria 2990265787 2990269100 199
23 iso_pu_bacteria 2993693658 2993694803 199
24 3300005548 Ga0070665_100243680 Ga0070665_1002436802 201
25 3300005842 Ga0068858_100092176 Ga0068858_1000921764 201
26 3300006177 Ga0075362_10149761 Ga0075362_101497612 201
27 3300006186 Ga0075369_10057399 Ga0075369_100573992 201
28 3300013306 Ga0163162_10019962 Ga0163162_100199621 201
29 3300026035 Ga0207703_10226504 Ga0207703_102265043 201
30 3300028379 Ga0268266_10444011 Ga0268266_104440112 201
31 3300050516 nmdc:mga0sz30_26105_c2 nmdc:mga0sz30_26105_c2_411_1016 201
32 3300005289 Ga0065704_10148496 Ga0065704_101484962 202
33 3300005347 Ga0070668_100115565 Ga0070668_1001155652 202
34 3300006058 Ga0075432_10001579 Ga0075432_100015795 202
35 3300006186 Ga0075369_10032500 Ga0075369_100325002 202
36 3300006195 Ga0075366_10014289 Ga0075366_100142892 202
37 3300006353 Ga0075370_10031362 Ga0075370_100313624 202
38 3300006353 Ga0075370_10324975 Ga0075370_103249751 202
39 3300009177 Ga0105248_10001360 Ga0105248_100013603 202
40 3300025923 Ga0207681_10304017 Ga0207681_103040172 202
41 3300025941 Ga0207711_10055575 Ga0207711_100555752 202
42 3300025972 Ga0207668_10019975 Ga0207668_100199754 202
43 3300027907 Ga0207428_10289689 Ga0207428_102896892 202
44 3300031911 Ga0307412_10064377 Ga0307412_100643773 202
45 3300046453 Ga0495627_000132 Ga0495627_000132_11973_12581 202
46 3300046491 Ga0495584_0092820 Ga0495584_0092820_417_1025 202
47 3300046512 Ga0495610_0000071 Ga0495610_0000071_16291_16899 202
48 3300046512 Ga0495610_0000433 Ga0495610_0000433_40793_41416 202
49 3300046519 Ga0495632_0000211 Ga0495632_0000211_20921_21529 202
50 3300046520 Ga0495637_0000725 Ga0495637_0000725_9929_10537 202
51 3300046520 Ga0495637_0052319 Ga0495637_0052319_327_935 202
52 3300046522 Ga0495643_0000053 Ga0495643_0000053_115382_115990 202
53 3300046524 Ga0495648_0122756 Ga0495648_0122756_113_721 202
54 3300046524 Ga0495648_0265315 Ga0495648_0265315_31_639 202
55 3300046525 Ga0495663_0000020 Ga0495663_0000020_86415_87023 202
56 3300046558 Ga0495633_0001684 Ga0495633_0001684_13145_13753 202
57 3300046558 Ga0495633_0026695 Ga0495633_0026695_1341_1949 202
58 3300046558 Ga0495633_0080767 Ga0495633_0080767_160_768 202
59 3300046665 Ga0495661_0039100 Ga0495661_0039100_269_877 202
60 3300046692 Ga0495671_0000031 Ga0495671_0000031_86041_86649 202
61 3300047320 Ga0495672_0271553 Ga0495672_0271553_20_628 202
62 3300047470 Ga0495681_0000228 Ga0495681_0000228_34147_34755 202
63 3300047470 Ga0495681_0012134 Ga0495681_0012134_54_662 202
64 3300047472 Ga0495686_0026386 Ga0495686_0026386_521_1129 202
65 3300047472 Ga0495686_0102824 Ga0495686_0102824_755_1363 202
66 3300050491 nmdc:mga00v17_100066_c1 nmdc:mga00v17_100066_c1_382_990 202
67 3300050496 nmdc:mga07m45_38812_c1 nmdc:mga07m45_38812_c1_89_712 202
68 3300050496 nmdc:mga07m45_439336_c1 nmdc:mga07m45_439336_c1_104_712 202
69 3300050516 nmdc:mga0sz30_22949_c1 nmdc:mga0sz30_22949_c1_1248_1856 202
70 3300001915 JGI24741J21665_1000486 JGI24741J21665_10004864 203
71 3300001979 JGI24740J21852_10023526 JGI24740J21852_100235262 203
72 3300001989 JGI24739J22299_10025215 JGI24739J22299_100252152 203
73 3300001990 JGI24737J22298_10008346 JGI24737J22298_100083466 203
74 3300003187 JGI25151J46595_10101123 JGI25151J46595_101011231 203
75 3300003215 JGI25153J46596_10000113 JGI25153J46596_1000011322 203
76 3300003323 rootH1_10266815 rootH1_102668153 203
77 3300003759 Ga0055525_1000051 Ga0055525_1000051205 203
78 3300003762 Ga0055542_1000677 Ga0055542_10006773 203
79 3300003763 Ga0055529_1000016 Ga0055529_100001623 203
80 3300003781 Ga0055536_1000542 Ga0055536_100054215 203
81 3300003784 Ga0055534_1010821 Ga0055534_10108212 203
82 3300003791 Ga0055530_10000187 Ga0055530_1000018746 203
83 3300003794 Ga0055531_10000760 Ga0055531_100007609 203
84 3300005327 Ga0070658_10000697 Ga0070658_100006974 203
85 3300005335 Ga0070666_10003475 Ga0070666_100034755 203
86 3300005339 Ga0070660_100011785 Ga0070660_1000117853 203
87 3300005339 Ga0070660_100012000 Ga0070660_1000120004 203
88 3300005344 Ga0070661_100003943 Ga0070661_1000039437 203
89 3300005344 Ga0070661_100146857 Ga0070661_1001468573 203
90 3300005367 Ga0070667_100000528 Ga0070667_10000052824 203
91 3300005445 Ga0070708_100052193 Ga0070708_1000521933 203
92 3300005456 Ga0070678_100013099 Ga0070678_1000130993 203
93 3300005456 Ga0070678_100390974 Ga0070678_1003909742 203
94 3300005457 Ga0070662_100012795 Ga0070662_1000127952 203
95 3300005459 Ga0068867_101021183 Ga0068867_1010211831 203
96 3300005467 Ga0070706_100013897 Ga0070706_1000138978 203
97 3300005467 Ga0070706_100584931 Ga0070706_1005849312 203
98 3300005468 Ga0070707_100077510 Ga0070707_1000775101 203
99 3300005468 Ga0070707_101118025 Ga0070707_1011180251 203
100 3300005471 Ga0070698_100159168 Ga0070698_1001591683 203
101 3300005518 Ga0070699_100031727 Ga0070699_1000317272 203
102 3300005535 Ga0070684_100484284 Ga0070684_1004842841 203
103 3300005536 Ga0070697_100006959 Ga0070697_1000069593 203
104 3300005536 Ga0070697_100042224 Ga0070697_1000422245 203
105 3300005539 Ga0068853_100018741 Ga0068853_1000187411 203
106 3300005543 Ga0070672_100220711 Ga0070672_1002207112 203
107 3300005546 Ga0070696_100295079 Ga0070696_1002950792 203
108 3300005548 Ga0070665_100000044 Ga0070665_100000044245 203
109 3300005548 Ga0070665_100091577 Ga0070665_1000915774 203
110 3300005549 Ga0070704_100074520 Ga0070704_1000745202 203
111 3300005564 Ga0070664_100351097 Ga0070664_1003510971 203
112 3300005578 Ga0068854_100510774 Ga0068854_1005107741 203
113 3300005614 Ga0068856_100098542 Ga0068856_1000985423 203
114 3300005617 Ga0068859_100153646 Ga0068859_1001536462 203
115 3300005618 Ga0068864_100000017 Ga0068864_100000017196 203
116 3300005834 Ga0068851_10036787 Ga0068851_100367874 203
117 3300005841 Ga0068863_100000018 Ga0068863_100000018116 203
118 3300005841 Ga0068863_100023975 Ga0068863_1000239754 203
119 3300005842 Ga0068858_100336900 Ga0068858_1003369002 203
120 3300005844 Ga0068862_100000010 Ga0068862_100000010115 203
121 3300005844 Ga0068862_100023143 Ga0068862_1000231432 203
122 3300005844 Ga0068862_100177003 Ga0068862_1001770032 203
123 3300005985 Ga0081539_10046000 Ga0081539_100460002 203
124 3300006038 Ga0075365_10002078 Ga0075365_100020784 203
125 3300006042 Ga0075368_10000503 Ga0075368_100005032 203
126 3300006048 Ga0075363_100001970 Ga0075363_1000019704 203
127 3300006051 Ga0075364_10027259 Ga0075364_100272592 203
128 3300006177 Ga0075362_10001342 Ga0075362_100013425 203
129 3300006178 Ga0075367_10001466 Ga0075367_100014664 203
130 3300006186 Ga0075369_10002228 Ga0075369_100022285 203
131 3300006186 Ga0075369_10269764 Ga0075369_102697641 203
132 3300006195 Ga0075366_10011070 Ga0075366_100110705 203
133 3300006195 Ga0075366_10326135 Ga0075366_103261352 203
134 3300006353 Ga0075370_10160025 Ga0075370_101600252 203
135 3300006931 Ga0097620_100153646 Ga0097620_1001536462 203
136 3300007076 Ga0075435_100258733 Ga0075435_1002587332 203
137 3300009011 Ga0105251_10007273 Ga0105251_100072737 203
138 3300009093 Ga0105240_10864930 Ga0105240_108649302 203
139 3300009094 Ga0111539_10068660 Ga0111539_100686602 203
140 3300009101 Ga0105247_10027497 Ga0105247_100274973 203
141 3300009147 Ga0114129_11133368 Ga0114129_111333682 203
142 3300009148 Ga0105243_10000782 Ga0105243_100007824 203
143 3300009174 Ga0105241_10001365 Ga0105241_1000136512 203
144 3300009177 Ga0105248_10000105 Ga0105248_1000010520 203
145 3300009551 Ga0105238_10123941 Ga0105238_101239412 203
146 3300009553 Ga0105249_10000207 Ga0105249_1000020756 203
147 3300009553 Ga0105249_10229625 Ga0105249_102296252 203
148 3300011119 Ga0105246_10185112 Ga0105246_101851123 203
149 3300012513 Ga0157326_1000752 Ga0157326_10007522 203
150 3300012513 Ga0157326_1006565 Ga0157326_10065652 203
151 3300013102 Ga0157371_10000146 Ga0157371_1000014689 203
152 3300013104 Ga0157370_10098391 Ga0157370_100983913 203
153 3300013104 Ga0157370_10107410 Ga0157370_101074102 203
154 3300013296 Ga0157374_10391078 Ga0157374_103910783 203
155 3300013306 Ga0163162_10143842 Ga0163162_101438422 203
156 3300013306 Ga0163162_10893827 Ga0163162_108938272 203
157 3300013307 Ga0157372_10139286 Ga0157372_101392863 203
158 3300014325 Ga0163163_10184792 Ga0163163_101847922 203
159 3300014968 Ga0157379_10040747 Ga0157379_100407476 203
160 3300014969 Ga0157376_10502299 Ga0157376_105022992 203
161 3300025230 Ga0209563_100019 Ga0209563_100019301 203
162 3300025245 Ga0207425_1017287 Ga0207425_10172872 203
163 3300025254 Ga0209148_1000017 Ga0209148_1000017724 203
164 3300025272 Ga0209455_1000005 Ga0209455_1000005724 203
165 3300025291 Ga0209675_1000196 Ga0209675_100019621 203
166 3300025294 Ga0209025_1017648 Ga0209025_10176483 203
167 3300025297 Ga0209758_1000035 Ga0209758_1000035421 203
168 3300025298 Ga0209050_1000218 Ga0209050_100021813 203
169 3300025304 Ga0209257_1000130 Ga0209257_1000130121 203
170 3300025304 Ga0209257_1004144 Ga0209257_10041445 203
171 3300025321 Ga0207656_10002030 Ga0207656_100020306 203
172 3300025735 Ga0207713_1024768 Ga0207713_10247682 203
173 3300025900 Ga0207710_10015171 Ga0207710_100151713 203
174 3300025909 Ga0207705_10000220 Ga0207705_1000022045 203
175 3300025910 Ga0207684_10120894 Ga0207684_101208942 203
176 3300025911 Ga0207654_10000650 Ga0207654_100006505 203
177 3300025919 Ga0207657_10020851 Ga0207657_100208513 203
178 3300025920 Ga0207649_10006153 Ga0207649_100061534 203
179 3300025920 Ga0207649_10081116 Ga0207649_100811162 203
180 3300025920 Ga0207649_10172195 Ga0207649_101721952 203
181 3300025922 Ga0207646_10190931 Ga0207646_101909313 203
182 3300025923 Ga0207681_10174819 Ga0207681_101748192 203
183 3300025924 Ga0207694_10131270 Ga0207694_101312703 203
184 3300025925 Ga0207650_10000057 Ga0207650_1000005794 203
185 3300025926 Ga0207659_10434026 Ga0207659_104340262 203
186 3300025933 Ga0207706_10045680 Ga0207706_100456803 203
187 3300025935 Ga0207709_10000031 Ga0207709_10000031304 203
188 3300025937 Ga0207669_10000057 Ga0207669_100000573 203
189 3300025937 Ga0207669_10038360 Ga0207669_100383603 203
190 3300025939 Ga0207665_10148968 Ga0207665_101489681 203
191 3300025940 Ga0207691_10031042 Ga0207691_100310422 203
192 3300025941 Ga0207711_10000031 Ga0207711_10000031115 203
193 3300025944 Ga0207661_10542009 Ga0207661_105420092 203
194 3300025949 Ga0207667_10001207 Ga0207667_1000120711 203
195 3300025961 Ga0207712_10000234 Ga0207712_1000023411 203
196 3300025981 Ga0207640_10006429 Ga0207640_100064294 203
197 3300025986 Ga0207658_10001935 Ga0207658_1000193511 203
198 3300025986 Ga0207658_10516081 Ga0207658_105160812 203
199 3300026041 Ga0207639_10001334 Ga0207639_100013342 203
200 3300026067 Ga0207678_10015599 Ga0207678_100155994 203
201 3300026078 Ga0207702_10004382 Ga0207702_1000438210 203
202 3300026088 Ga0207641_10000002 Ga0207641_10000002371 203
203 3300026095 Ga0207676_10000005 Ga0207676_10000005437 203
204 3300026121 Ga0207683_10020674 Ga0207683_100206743 203
205 3300026121 Ga0207683_10375598 Ga0207683_103755982 203
206 3300026142 Ga0207698_10000969 Ga0207698_100009695 203
207 3300027866 Ga0209813_10000147 Ga0209813_1000014713 203
208 3300027907 Ga0207428_10057843 Ga0207428_100578431 203
209 3300028379 Ga0268266_10000002 Ga0268266_100000022132 203
210 3300028380 Ga0268265_10000003 Ga0268265_10000003619 203
211 3300028380 Ga0268265_10197436 Ga0268265_101974362 203
212 3300028794 Ga0307515_10120496 Ga0307515_101204963 203
213 3300031456 Ga0307513_10012899 Ga0307513_100128995 203
214 3300031456 Ga0307513_10196008 Ga0307513_101960082 203
215 3300031995 Ga0307409_100737123 Ga0307409_1007371232 203
216 3300032004 Ga0307414_10298246 Ga0307414_102982462 203
217 3300032005 Ga0307411_10047814 Ga0307411_100478142 203
218 3300033180 Ga0307510_10004156 Ga0307510_100041565 203
219 3300033180 Ga0307510_10180289 Ga0307510_101802892 203
220 3300033180 Ga0307510_10185091 Ga0307510_101850912 203
221 3300037312 Ga0395899_0206229 Ga0395899_0206229_305_916 203
222 3300037471 Ga0395905_0104377 Ga0395905_0104377_1875_2486 203
223 3300041441 Ga0451787_337081 Ga0451787_337081_643_1254 203
224 3300042001 Ga0439441_085719 Ga0439441_085719_32_649 203
225 3300044694 Ga0466963_0067649 Ga0466963_0067649_176_787 203
226 3300044765 Ga0466970_0117147 Ga0466970_0117147_704_1315 203
227 3300046460 Ga0495638_0000033 Ga0495638_0000033_275471_276082 203
228 3300046460 Ga0495638_0107171 Ga0495638_0107171_580_1191 203
229 3300046471 Ga0495650_0005480 Ga0495650_0005480_7582_8193 203
230 3300046492 Ga0495585_0004745 Ga0495585_0004745_2290_2901 203
231 3300046492 Ga0495585_0081081 Ga0495585_0081081_510_1121 203
232 3300046506 Ga0495583_0000673 Ga0495583_0000673_27520_28131 203
233 3300046506 Ga0495583_0002180 Ga0495583_0002180_11954_12565 203
234 3300046506 Ga0495583_0004636 Ga0495583_0004636_6765_7376 203
235 3300046506 Ga0495583_0022332 Ga0495583_0022332_2559_3170 203
236 3300046506 Ga0495583_0040163 Ga0495583_0040163_1532_2143 203
237 3300046507 Ga0495606_0000434 Ga0495606_0000434_18889_19500 203
238 3300046512 Ga0495610_0177285 Ga0495610_0177285_112_723 203
239 3300046513 Ga0495616_0043656 Ga0495616_0043656_708_1319 203
240 3300046518 Ga0495631_0012132 Ga0495631_0012132_2843_3454 203
241 3300046519 Ga0495632_0001135 Ga0495632_0001135_10056_10667 203
242 3300046522 Ga0495643_0000991 Ga0495643_0000991_4652_5263 203
243 3300046522 Ga0495643_0009995 Ga0495643_0009995_825_1436 203
244 3300046522 Ga0495643_0142769 Ga0495643_0142769_12_623 203
245 3300046522 Ga0495643_0214494 Ga0495643_0214494_250_861 203
246 3300046524 Ga0495648_0000014 Ga0495648_0000014_12284_12895 203
247 3300046524 Ga0495648_0000750 Ga0495648_0000750_25857_26468 203
248 3300046524 Ga0495648_0138948 Ga0495648_0138948_555_1166 203
249 3300046525 Ga0495663_0002604 Ga0495663_0002604_340_951 203
250 3300046528 Ga0495642_0234580 Ga0495642_0234580_82_693 203
251 3300046536 Ga0495587_0057640 Ga0495587_0057640_1568_2179 203
252 3300046557 Ga0495622_0003260 Ga0495622_0003260_3200_3811 203
253 3300046558 Ga0495633_0002265 Ga0495633_0002265_10217_10828 203
254 3300046616 Ga0495668_0000004 Ga0495668_0000004_488076_488687 203
255 3300046616 Ga0495668_0000007 Ga0495668_0000007_24713_25324 203
256 3300046616 Ga0495668_0290151 Ga0495668_0290151_195_806 203
257 3300046616 Ga0495668_0303583 Ga0495668_0303583_98_709 203
258 3300046648 Ga0495611_0036591 Ga0495611_0036591_247_858 203
259 3300046660 Ga0495625_0000167 Ga0495625_0000167_97017_97628 203
260 3300046660 Ga0495625_0081418 Ga0495625_0081418_791_1402 203
261 3300046660 Ga0495625_0197537 Ga0495625_0197537_60_671 203
262 3300046660 Ga0495625_0433988 Ga0495625_0433988_142_753 203
263 3300046684 Ga0495669_0000197 Ga0495669_0000197_14474_15085 203
264 3300046691 Ga0495670_0013329 Ga0495670_0013329_622_1233 203
265 3300046691 Ga0495670_0025963 Ga0495670_0025963_2005_2616 203
266 3300046692 Ga0495671_0000019 Ga0495671_0000019_275475_276086 203
267 3300046694 Ga0495649_0020566 Ga0495649_0020566_503_1114 203
268 3300046694 Ga0495649_0027783 Ga0495649_0027783_1421_2032 203
269 3300046809 Ga0495600_0032388 Ga0495600_0032388_836_1447 203
270 3300046810 Ga0495660_0027657 Ga0495660_0027657_2490_3101 203
271 3300047323 Ga0495683_0023859 Ga0495683_0023859_2475_3086 203
272 3300047323 Ga0495683_0078228 Ga0495683_0078228_821_1432 203
273 3300047443 Ga0495687_000178 Ga0495687_000178_68589_69200 203
274 3300047443 Ga0495687_001516 Ga0495687_001516_8782_9393 203
275 3300047445 Ga0495677_0020444 Ga0495677_0020444_991_1602 203
276 3300047469 Ga0495673_0000042 Ga0495673_0000042_275248_275859 203
277 3300047470 Ga0495681_0007987 Ga0495681_0007987_151_762 203
278 3300047472 Ga0495686_0000191 Ga0495686_0000191_67980_68591 203
279 3300048904 Ga0496101_0549058 Ga0496101_0549058_292_903 203
280 3300048905 Ga0496102_0001107 Ga0496102_0001107_13061_13672 203
281 3300048906 Ga0496103_0000647 Ga0496103_0000647_12992_13603 203
282 3300048907 Ga0496104_0137718 Ga0496104_0137718_1476_2087 203
283 3300048908 Ga0496105_0001897 Ga0496105_0001897_13730_14341 203
284 3300048913 Ga0496110_0034874 Ga0496110_0034874_3239_3850 203
285 3300048914 Ga0496111_0027957 Ga0496111_0027957_350_961 203
286 3300048915 Ga0496112_0644738 Ga0496112_0644738_80_691 203
287 3300048916 Ga0496113_0172302 Ga0496113_0172302_342_953 203
288 3300048918 Ga0496115_0000416 Ga0496115_0000416_13132_13743 203
289 3300048919 Ga0496116_0003681 Ga0496116_0003681_6498_7109 203
290 3300048920 Ga0496117_0001241 Ga0496117_0001241_24546_25157 203
291 3300048920 Ga0496117_0135880 Ga0496117_0135880_461_1072 203
292 3300048921 Ga0496118_0000332 Ga0496118_0000332_29152_29763 203
293 3300048921 Ga0496118_0000580 Ga0496118_0000580_33651_34262 203
294 3300048921 Ga0496118_0228535 Ga0496118_0228535_184_795 203
295 3300048922 Ga0496119_0020594 Ga0496119_0020594_2967_3578 203
296 3300048923 Ga0496120_0008489 Ga0496120_0008489_2517_3128 203
297 3300048924 Ga0496121_0001577 Ga0496121_0001577_34445_35056 203
298 3300048925 Ga0496122_0185957 Ga0496122_0185957_27_638 203
299 3300048926 Ga0496123_0032109 Ga0496123_0032109_2734_3345 203
300 3300048927 Ga0496124_0000626 Ga0496124_0000626_33659_34270 203
301 3300048928 Ga0496125_0001330 Ga0496125_0001330_9688_10299 203
302 3300048929 Ga0496126_0000752 Ga0496126_0000752_33670_34281 203
303 3300048929 Ga0496126_0179669 Ga0496126_0179669_949_1560 203
304 3300048929 Ga0496126_0396600 Ga0496126_0396600_169_783 203
305 3300049569 Ga0501032_0215160 Ga0501032_0215160_107_751 203
306 3300049573 Ga0501037_0196901 Ga0501037_0196901_660_1271 203
307 3300049589 Ga0501073_0074889 Ga0501073_0074889_449_1093 203
308 3300049679 Ga0501249_000162 Ga0501249_000162_808_1419 203
309 3300049688 Ga0501259_017350 Ga0501259_017350_228_839 203
310 3300049759 Ga0501262_005187 Ga0501262_005187_646_1257 203
311 3300049823 Ga0501044_0001405 Ga0501044_0001405_11221_11832 203
312 3300050491 nmdc:mga00v17_375317_c1 nmdc:mga00v17_375317_c1_212_823 203
313 3300050512 nmdc:mga0n895_541021_c1 nmdc:mga0n895_541021_c1_475_1095 203
314 3300050516 nmdc:mga0sz30_305_c1 nmdc:mga0sz30_305_c1_12273_12884 203
315 3300053079 Ga0500610_0002602 Ga0500610_0002602_1507_2118 203
316 3300053116 Ga0500592_002078 Ga0500592_002078_842_1453 203
317 3300053119 Ga0500595_000230 Ga0500595_000230_1592_2203 203
318 3300053121 Ga0500607_000766 Ga0500607_000766_8504_9115 203
319 3300053125 Ga0500618_009187 Ga0500618_009187_1795_2406 203
320 3300053130 Ga0500642_0006747 Ga0500642_0006747_247_858 203
321 3300053154 Ga0500619_011070 Ga0500619_011070_1551_2162 203
322 3300053730 Ga0500645_000011 Ga0500645_000011_143245_143856 203
323 3300053730 Ga0500645_020584 Ga0500645_020584_229_840 203
324 3300053735 Ga0500596_001467 Ga0500596_001467_2931_3542 203
325 3300055283 Ga0500661_005809 Ga0500661_005809_1502_2113 203
326 iso_pu_bacteria 2510917021 2511128422 203
327 iso_pu_bacteria 2818991438 2819550861 203
328 iso_pu_bacteria 8054302542 8054307128 203
329 3300049850 Ga0501204_006130 Ga0501204_006130_232_900 206
330 3300050493 nmdc:mga0k408_148417_c1 nmdc:mga0k408_148417_c1_572_1195 206
331 2162886007 SwRhRL2b_contig_2237776 SwRhRL2b_0434.00007740 207
332 3300003791 Ga0055530_10005657 Ga0055530_100056574 207
333 3300005289 Ga0065704_10070144 Ga0065704_10070144275 207
334 3300025298 Ga0209050_1000279 Ga0209050_100027916 207
335 3300046506 Ga0495583_0075241 Ga0495583_0075241_23_646 207
336 3300046522 Ga0495643_0000027 Ga0495643_0000027_25553_26176 207
337 3300046522 Ga0495643_0019966 Ga0495643_0019966_2561_3184 207
338 3300046538 Ga0495609_0008194 Ga0495609_0008194_2433_3056 207
339 3300046616 Ga0495668_0142816 Ga0495668_0142816_124_753 207
340 3300046692 Ga0495671_0223752 Ga0495671_0223752_238_861 207
341 3300048091 Ga0495626_0010236 Ga0495626_0010236_2609_3247 207
342 3300048919 Ga0496116_0000017 Ga0496116_0000017_145669_146292 207
343 3300048924 Ga0496121_0005774 Ga0496121_0005774_12201_12824 207
344 3300048925 Ga0496122_0013061 Ga0496122_0013061_6129_6752 207
345 3300048925 Ga0496122_0021169 Ga0496122_0021169_918_1556 207
346 3300048926 Ga0496123_0003105 Ga0496123_0003105_13876_14499 207
347 3300048926 Ga0496123_0013046 Ga0496123_0013046_910_1548 207
348 3300048927 Ga0496124_0011607 Ga0496124_0011607_414_1037 207
349 3300048927 Ga0496124_0028845 Ga0496124_0028845_403_1026 207
350 3300048927 Ga0496124_0114480 Ga0496124_0114480_609_1247 207
351 3300048928 Ga0496125_0031228 Ga0496125_0031228_1042_1665 207
352 3300048929 Ga0496126_0000359 Ga0496126_0000359_15075_15698 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

20

93

0.95

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

25

99

0.92

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

29

94

0.91

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

141

206

0.87

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

124

211

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kh7-assembly3.cif.gz_B crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione 0.9627 6 207
6nxv-assembly2.cif.gz_B crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form 0.958 4 207
6nxv-assembly4.cif.gz_D crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form 0.9541 4 207
6nv6-assembly2.cif.gz_B crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri with glutathione bound 0.9497 4 207
6nxv-assembly2.cif.gz_B crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form 0.948 4 207
ID Description Score Start End Superfamily
4ke3D01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9659 6 81 3.40.30.10
3zmkC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9515 6 80 3.40.30.10
af_P0ACA7_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9504 6 80 3.40.30.10
4ielA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.95 6 81 3.40.30.10
3lykA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.929 7 81 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7W6C1L3-F1-model_v4 Glutathione S-transferase (EC 2.5.1.18) 0.9899 6 207 GO:0004364
AF-A0A0W1GGI7-F1-model_v4 Glutathione S-transferase 0.9889 6 207 GO:0016740
AF-A0A084EGD0-F1-model_v4 Glutathione S-transferase 0.9873 6 207 GO:0016740
AF-T0I5R6-F1-model_v4 Glutathione S-transferase 0.9853 6 207 GO:0016740
AF-W0A8R7-F1-model_v4 Glutathione S-transferase 0.9851 6 207

Feature Viewer

pLDDT pTM Quality
95.53 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map