F419224

General Info

Members Datasets Scaffolds Average Seq Length
352 302 246 359

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2775506901|2776263875
Length 429
Sequence IHVGRVFETGVASSIPSAIHLSRKKSTSCNNTTMTGAGRKSMISCMRLPSALAWLVDAASTVAGADTFLATLGEQLITEGLPLAGGALTLAAPHPIIARRTWLWRAETGAVIEAIGFGSLGPAGPEQGNVGRDWLVGLGTGMVVEGVAGSEPDGPTSGSPGSNSPVLGWALLRPLTAAEAGLLHQAARFAAPPLAVLATRSTLAALLEAYLGRRSAAQVLAGQLRRGSGETIRAVLLYGDLRGFTALSEALPAEAVVAALDAWFDRIAGAVHAFGGEVLKFTGDGILAIFPIGQRIPSEACDAALRSVSAAQAGMAHLNQARRREGRPPLPFGMALHLGEMMWGNIGTASRLDFTAIGPAVNLVCRLEGLCRPLGRSVLISGAVAAEMTTALMPLGEHVLRGIATPCAVFTLPDEGDAPVGLQTTSPGA

Samples

Sample ID Description Type Environment
1 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
2 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
3 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
4 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
5 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
6 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
7 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
8 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
9 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
10 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
11 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
12 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
13 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
14 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
15 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
16 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
17 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
18 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
19 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
20 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
21 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
22 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
23 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
24 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
25 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
26 2643221557 Ensifer sp. Root558 Isolate Unclassified
27 2643221610 Ensifer sp. Root74 Isolate Unclassified
28 2643221668 Ensifer sp. Root423 Isolate Unclassified
29 2643221675 Ensifer sp. Root1298 Isolate Unclassified
30 2643221680 Ensifer sp. Root1312 Isolate Unclassified
31 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
32 2643221726 Ensifer sp. Root954 Isolate Unclassified
33 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
34 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
35 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
36 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
37 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
38 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
39 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
40 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
41 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
42 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
43 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
44 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
45 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
46 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
47 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
48 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
49 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
50 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
51 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
52 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
53 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
54 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
55 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
56 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
57 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
58 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
59 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
60 2904699407
61 2906610324
62 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
63 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
64 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
65 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
66 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
67 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
68 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
69 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
70 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
71 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
72 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
73 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
74 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
75 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
76 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
77 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
78 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
79 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
80 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
81 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
82 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
83 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
84 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
85 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
86 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
87 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
88 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
89 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
90 2996887358 Rhizobium sp. R711 Isolate Nodule
91 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
92 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
93 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
94 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
95 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
96 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
97 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
98 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
99 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
100 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
101 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
102 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
103 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
104 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
105 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
106 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
107 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
108 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
109 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
110 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
111 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
112 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
113 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
114 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
115 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
116 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
117 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
118 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
119 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
120 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
121 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
122 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
127 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
135 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
138 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
139 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
140 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
141 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
143 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
144 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
145 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
147 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
148 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
151 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
167 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
169 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
170 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
171 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
178 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
179 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
180 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
195 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
196 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
197 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
198 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
199 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
235 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
256 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
257 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
258 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
282 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
283 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
284 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
285 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
286 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
287 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
288 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
289 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
290 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
291 8005258706 Rhizobium sp. R693 Isolate Nodule
292 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
293 8005321885 Rhizobium sp. R72 Isolate Nodule
294 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
295 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
296 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
297 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
298 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
299 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
300 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
301 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
302 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.29
Metatranscriptomes 0
Isolates 29.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.09
Nodule 23.58
Rhizoplane 2.84
Rhizosphere 48.3
Stem 0
Stem Tuber 0
Unclassified 16.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000052 3300001979 Bacteria 37186
2 JGI25155J39150_1000001 3300002704 Bacteria 354543
3 JGI25156J39149_1000001 3300002705 Bacteria 354557
4 JGI25162J39368_1000209 3300002737 Bacteria 61889
5 JGI25154J39366_1000011 3300002738 Bacteria 296007
6 JGI25158J39367_1000040 3300002739 Bacteria 29856
7 JGI25157J39369_1000030 3300002741 Bacteria 146112
8 JGI25159J45721_1000011 3300002987 Bacteria 158027
9 JGI25165J46597_1000302 3300003214 Bacteria 61889
10 JGI25153J46596_10011750 3300003215 Bacteria 3843
11 rootH1_10097826 3300003323 Bacteria 5854
12 rootH1_10185878 3300003323 Bacteria 2448
13 Ga0055524_1000609 3300003775 Bacteria 25646
14 Ga0055531_10012427 3300003794 Bacteria 4006
15 Ga0070667_100258293 3300005367 Bacteria 1559
16 Ga0070709_10013814 3300005434 Bacteria 4550
17 Ga0070709_10017006 3300005434 Bacteria 4164
18 Ga0070709_10208022 3300005434 Bacteria 1389
19 Ga0070714_100017466 3300005435 Bacteria 5812
20 Ga0070714_100263042 3300005435 Bacteria 1598
21 Ga0070710_10016221 3300005437 Bacteria 3786
22 Ga0070711_100113201 3300005439 Bacteria 1995
23 Ga0070708_100055146 3300005445 Bacteria 3534
24 Ga0070708_100141972 3300005445 Bacteria 2227
25 Ga0070699_100047436 3300005518 Bacteria 3717
26 Ga0068854_100028691 3300005578 Bacteria 3848
27 Ga0068856_100185559 3300005614 Bacteria 2094
28 Ga0081540_1026881 3300005983 Bacteria 3274
29 Ga0081539_10000444 3300005985 Bacteria 88011
30 Ga0081539_10002339 3300005985 Bacteria 27248
31 Ga0070717_10020586 3300006028 Bacteria 5191
32 Ga0070715_10001657 3300006163 Bacteria 6602
33 Ga0070716_100011070 3300006173 Bacteria 4537
34 Ga0075430_100093044 3300006846 Bacteria 2520
35 Ga0075431_100160010 3300006847 Bacteria 2316
36 Ga0099794_10018200 3300007265 Bacteria 3146
37 Ga0105240_10000005 3300009093 Bacteria 702630
38 Ga0105240_10104984 3300009093 Bacteria 3430
39 Ga0114129_10203885 3300009147 Bacteria 2677
40 Ga0114129_10256630 3300009147 Bacteria 2345
41 Ga0105237_10002054 3300009545 Bacteria 25563
42 Ga0105237_10156142 3300009545 Bacteria 2279
43 Ga0123342_1012737 3300009766 Bacteria 8659
44 Ga0099796_10064443 3300010159 Bacteria 1308
45 Ga0105239_10001069 3300010375 Bacteria 38061
46 Ga0105239_10105398 3300010375 Bacteria 3122
47 Ga0157370_10000046 3300013104 Bacteria 125612
48 Ga0171463_1002 3300013249 Bacteria 1274851
49 Ga0182008_10030676 3300014497 Bacteria 2709
50 Ga0182008_10040031 3300014497 Bacteria 2341
51 Ga0157379_10357017 3300014968 Bacteria 1339
52 Ga0182007_10005797 3300015262 Bacteria 5370
53 Ga0182005_1014072 3300015265 Bacteria 2243
54 Ga0213874_10017338 3300021377 Bacteria 1930
55 Ga0213876_10011273 3300021384 Bacteria 4775
56 Ga0213871_10036700 3300021441 Bacteria 1301
57 Ga0228711_1000005 3300022739 Bacteria 215594
58 Ga0228710_1000141 3300022740 Bacteria 66299
59 Ga0209435_100012 3300025206 Bacteria 401621
60 Ga0209672_105057 3300025228 Bacteria 2325
61 Ga0209437_100047 3300025233 Bacteria 405163
62 Ga0209646_1000026 3300025246 Bacteria 401621
63 Ga0209026_1000014 3300025250 Bacteria 401621
64 Ga0209677_100522 3300025253 Bacteria 21397
65 Ga0209677_100656 3300025253 Bacteria 18202
66 Ga0209759_1000012 3300025256 Bacteria 401621
67 Ga0209233_1000048 3300025261 Bacteria 453669
68 Ga0209233_1000195 3300025261 Bacteria 125863
69 Ga0209233_1003450 3300025261 Bacteria 5567
70 Ga0209673_1015458 3300025273 Bacteria 2899
71 Ga0209025_1043735 3300025294 Bacteria 1882
72 Ga0209025_1044646 3300025294 Bacteria 1848
73 Ga0209758_1002977 3300025297 Bacteria 16239
74 Ga0209758_1008762 3300025297 Bacteria 6454
75 Ga0209758_1013460 3300025297 Bacteria 4456
76 Ga0209256_1008395 3300025299 Bacteria 4804
77 Ga0209257_1000657 3300025304 Bacteria 54593
78 Ga0207692_10019488 3300025898 Bacteria 3067
79 Ga0207685_10002119 3300025905 Bacteria 4448
80 Ga0207699_10081369 3300025906 Bacteria 2009
81 Ga0207707_10145153 3300025912 Bacteria 2074
82 Ga0207695_10000011 3300025913 Bacteria 910221
83 Ga0207695_10189014 3300025913 Bacteria 1977
84 Ga0207671_10000241 3300025914 Bacteria 81847
85 Ga0207671_10098693 3300025914 Bacteria 2209
86 Ga0207693_10042569 3300025915 Bacteria 3574
87 Ga0207693_10045856 3300025915 Bacteria 3434
88 Ga0207700_10051192 3300025928 Bacteria 3081
89 Ga0207664_10045690 3300025929 Bacteria 3435
90 Ga0207664_10258085 3300025929 Bacteria 1523
91 Ga0207665_10004662 3300025939 Bacteria 9108
92 Ga0207640_10027318 3300025981 Bacteria 3476
93 Ga0207658_10230529 3300025986 Bacteria 1563
94 Ga0207702_10060334 3300026078 Bacteria 3233
95 Ga0207702_10272159 3300026078 Bacteria 1598
96 Ga0209281_1000111 3300027111 Bacteria 215615
97 Ga0209371_1009668 3300027312 Bacteria 3043
98 Ga0209589_1000001 3300027357 Bacteria 794224
99 Ga0209489_100001 3300027361 Bacteria 794224
100 Ga0209700_100001 3300027363 Bacteria 794224
101 Ga0209282_1000012 3300027666 Bacteria 215614
102 Ga0265331_10007663 3300031250 Bacteria 6216
103 Ga0307513_10020569 3300031456 Bacteria 7824
104 Ga0265313_10000127 3300031595 Bacteria 76864
105 Ga0265314_10039831 3300031711 Bacteria 3380
106 Ga0265342_10011360 3300031712 Bacteria 6101
107 Ga0315914_1000007 3300031967 Bacteria 215597
108 Ga0315913_1000003 3300033430 Bacteria 215608
109 Ga0315911_1000006 3300033442 Bacteria 414563
110 Ga0315915_1000011 3300033464 Bacteria 215597
111 Ga0373923_0024174 3300035111 Bacteria 2397
112 Ga0373936_0049976 3300035113 Bacteria 1690
113 Ga0373957_0045601 3300035120 Bacteria 1662
114 Ga0373943_0016232 3300035170 Bacteria 3394
115 Ga0373935_0002559 3300035692 Bacteria 10440
116 Ga0373927_0001007 3300035695 Bacteria 21494
117 Ga0373947_0000308 3300035725 Bacteria 27609
118 Ga0373947_0031214 3300035725 Bacteria 3135
119 Ga0373947_0047858 3300035725 Bacteria 2564
120 Ga0373937_0064341 3300036401 Bacteria 3373
121 Ga0373937_0297529 3300036401 Bacteria 1525
122 Ga0373925_0003517 3300037068 Bacteria 12101
123 Ga0373925_0153260 3300037068 Bacteria 1811
124 Ga0395901_0458022 3300038443 Bacteria 1304
125 Ga0436365_1277951 3300039437 Bacteria 2953
126 Ga0436365_1348118 3300039437 Bacteria 2896
127 Ga0436365_1540042 3300039437 Bacteria 70665
128 Ga0436360_0145658 3300039438 Bacteria 2112
129 Ga0436360_0604050 3300039438 Bacteria 1526
130 Ga0436363_0629124 3300039450 Bacteria 1753
131 Ga0436363_1072504 3300039450 Bacteria 18743
132 Ga0436363_1082739 3300039450 Bacteria 17610
133 Ga0439436_0009046 3300041404 Bacteria 3054
134 Ga0439466_0035160 3300041411 Bacteria 1695
135 Ga0439465_0000636 3300041413 Bacteria 10709
136 Ga0439462_0005250 3300042015 Bacteria 3190
137 Ga0439434_0007930 3300042435 Bacteria 3113
138 Ga0450918_000960 3300042531 Bacteria 6005
139 Ga0466972_0005593 3300044658 Bacteria 6297
140 Ga0466963_0066932 3300044694 Bacteria 2410
141 Ga0466968_0003762 3300044735 Bacteria 5620
142 Ga0466968_0042605 3300044735 Bacteria 1920
143 Ga0466970_0000517 3300044765 Bacteria 19001
144 Ga0466957_0035148 3300044842 Bacteria 3007
145 Ga0466958_0080715 3300045836 Bacteria 2001
146 Ga0495592_0050837 3300046454 Bacteria 3079
147 Ga0495629_0000355 3300046459 Bacteria 39013
148 Ga0495638_0015508 3300046460 Bacteria 5115
149 Ga0495638_0141564 3300046460 Bacteria 1403
150 Ga0495641_0005223 3300046461 Bacteria 8855
151 Ga0495651_0097611 3300046462 Bacteria 2193
152 Ga0495651_0161898 3300046462 Bacteria 1602
153 Ga0495580_0000744 3300046472 Bacteria 27906
154 Ga0495580_0178434 3300046472 Bacteria 1467
155 Ga0495582_0000130 3300046473 Bacteria 40201
156 Ga0495605_0011323 3300046474 Bacteria 4982
157 Ga0495639_0000061 3300046475 Bacteria 48670
158 Ga0495662_0000232 3300046476 Bacteria 23279
159 Ga0495664_0030653 3300046477 Bacteria 3151
160 Ga0495594_0000317 3300046499 Bacteria 23861
161 Ga0495607_0013410 3300046501 Bacteria 5372
162 Ga0495606_0032616 3300046507 Bacteria 3605
163 Ga0495616_0032165 3300046513 Bacteria 2743
164 Ga0495618_0154128 3300046514 Bacteria 1467
165 Ga0495620_0012302 3300046515 Bacteria 4430
166 Ga0495628_0018524 3300046516 Bacteria 5765
167 Ga0495630_0004499 3300046517 Bacteria 9765
168 Ga0495632_0010057 3300046519 Bacteria 5637
169 Ga0495643_0005757 3300046522 Bacteria 8293
170 Ga0495666_0016968 3300046526 Bacteria 3624
171 Ga0495652_0016163 3300046529 Bacteria 6673
172 Ga0495652_0036083 3300046529 Bacteria 4300
173 Ga0495652_0157536 3300046529 Bacteria 1766
174 Ga0495665_0005979 3300046531 Bacteria 6559
175 Ga0495640_0001092 3300046533 Bacteria 21130
176 Ga0495597_0021419 3300046542 Bacteria 3005
177 Ga0495622_0004779 3300046557 Bacteria 6277
178 Ga0495667_0027698 3300046559 Bacteria 3816
179 Ga0495668_0037597 3300046616 Bacteria 2708
180 Ga0495625_0021251 3300046660 Bacteria 5000
181 Ga0495635_0002547 3300046663 Bacteria 12479
182 Ga0495646_0084194 3300046680 Bacteria 1847
183 Ga0495647_0001033 3300046681 Bacteria 8489
184 Ga0495658_0000047 3300046683 Bacteria 59626
185 Ga0495658_0191727 3300046683 Bacteria 1271
186 Ga0495613_0001104 3300046689 Bacteria 20593
187 Ga0495624_0000188 3300046690 Bacteria 46706
188 Ga0495600_0054011 3300046809 Bacteria 2624
189 Ga0495581_0000152 3300047315 Bacteria 30800
190 Ga0495674_0004757 3300047319 Bacteria 13050
191 Ga0495676_0044464 3300047321 Bacteria 3625
192 Ga0495686_0040634 3300047472 Bacteria 2965
193 Ga0495593_0000144 3300047673 Bacteria 34869
194 Ga0496101_0050149 3300048904 Bacteria 3003
195 Ga0496101_0061620 3300048904 Bacteria 2725
196 Ga0496102_0002015 3300048905 Bacteria 17545
197 Ga0496102_0062421 3300048905 Bacteria 3412
198 Ga0496103_0006503 3300048906 Bacteria 6970
199 Ga0496106_0190700 3300048909 Bacteria 1630
200 Ga0496112_0139443 3300048915 Bacteria 2394
201 Ga0496113_0029971 3300048916 Bacteria 3935
202 Ga0496116_0002733 3300048919 Bacteria 18133
203 Ga0496117_0000353 3300048920 Bacteria 81061
204 Ga0496117_0037829 3300048920 Bacteria 3589
205 Ga0496118_0000204 3300048921 Bacteria 104260
206 Ga0496118_0068301 3300048921 Bacteria 2582
207 Ga0496119_0022006 3300048922 Bacteria 4583
208 Ga0496119_0022426 3300048922 Bacteria 4520
209 Ga0496119_0037813 3300048922 Bacteria 3129
210 Ga0496120_0003039 3300048923 Bacteria 15831
211 Ga0496121_0000378 3300048924 Bacteria 91381
212 Ga0496121_0005175 3300048924 Bacteria 16922
213 Ga0496122_0008819 3300048925 Bacteria 10769
214 Ga0496123_0002174 3300048926 Bacteria 25015
215 Ga0496124_0006326 3300048927 Bacteria 12927
216 Ga0496125_0002169 3300048928 Bacteria 26237
217 Ga0496126_0103636 3300048929 Bacteria 2486
218 Ga0496126_0160175 3300048929 Bacteria 1923
219 Ga0496126_0245780 3300048929 Bacteria 1493
220 Ga0501038_0155505 3300049574 Bacteria 1862
221 Ga0501046_0049616 3300049580 Bacteria 3319
222 Ga0501047_0032495 3300049581 Bacteria 5037
223 Ga0501047_0257688 3300049581 Bacteria 1592
224 Ga0501070_0042890 3300049586 Bacteria 3766
225 Ga0501073_0023432 3300049589 Bacteria 4433
226 Ga0501074_0039565 3300049590 Bacteria 3415
227 Ga0501079_0146530 3300049741 Bacteria 1840
228 Ga0501080_0031400 3300049742 Bacteria 4949
229 Ga0501035_0002289 3300049822 Bacteria 18933
230 Ga0501035_0360099 3300049822 Bacteria 1216
231 Ga0501044_0256400 3300049823 Bacteria 1688
232 nmdc:mga0yw44_132698_c1 3300050492 Bacteria 1613
233 nmdc:mga09592_338587_c1 3300050508 Bacteria 1302
234 nmdc:mga0qj67_11852_c1 3300050509 Bacteria 6545
235 nmdc:mga06r32_33684_c1 3300050510 Bacteria 4825
236 nmdc:mga0rr50_94505_c1 3300050513 Bacteria 2335
237 Ga0495601_0110205 3300053077 Bacteria 1782
238 Ga0500651_0052952 3300053093 Bacteria 2545
239 Ga0500569_002799 3300053109 Bacteria 3481
240 Ga0500594_0024212 3300053118 Bacteria 1545
241 Ga0500595_001560 3300053119 Bacteria 12119
242 Ga0500618_006262 3300053125 Bacteria 3514
243 Ga0500659_0091463 3300053135 Bacteria 1588
244 Ga0500568_0000104 3300053139 Bacteria 78075
245 Ga0500616_0008446 3300053153 Bacteria 6391
246 Ga0500616_0031098 3300053153 Bacteria 2926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053135 Ga0500659_0091463 Ga0500659_0091463_413_1405 260
2 3300049822 Ga0501035_0360099 Ga0501035_0360099_253_1206 279
3 3300003323 rootH1_10097826 rootH1_100978264 302
4 3300025928 Ga0207700_10051192 Ga0207700_100511922 306
5 3300053118 Ga0500594_0024212 Ga0500594_0024212_10_1104 312
6 3300049590 Ga0501074_0039565 Ga0501074_0039565_1664_2767 315
7 3300049742 Ga0501080_0031400 Ga0501080_0031400_1951_3054 315
8 3300044735 Ga0466968_0042605 Ga0466968_0042605_326_1405 316
9 3300035120 Ga0373957_0045601 Ga0373957_0045601_43_1137 321
10 3300035725 Ga0373947_0031214 Ga0373947_0031214_1908_3002 321
11 3300046683 Ga0495658_0191727 Ga0495658_0191727_108_1202 321
12 3300046514 Ga0495618_0154128 Ga0495618_0154128_157_1251 322
13 3300046529 Ga0495652_0036083 Ga0495652_0036083_391_1485 322
14 3300053077 Ga0495601_0110205 Ga0495601_0110205_324_1418 322
15 3300038443 Ga0395901_0458022 Ga0395901_0458022_26_1147 323
16 3300053125 Ga0500618_006262 Ga0500618_006262_548_1606 326
17 3300009093 Ga0105240_10104984 Ga0105240_101049843 327
18 3300009545 Ga0105237_10156142 Ga0105237_101561422 327
19 3300010375 Ga0105239_10105398 Ga0105239_101053983 327
20 3300014497 Ga0182008_10030676 Ga0182008_100306763 327
21 3300014968 Ga0157379_10357017 Ga0157379_103570171 327
22 3300025914 Ga0207671_10098693 Ga0207671_100986933 327
23 3300027357 Ga0209589_1000001 Ga0209589_100000197 327
24 3300027361 Ga0209489_100001 Ga0209489_10000197 327
25 3300027363 Ga0209700_100001 Ga0209700_10000197 327
26 3300048915 Ga0496112_0139443 Ga0496112_0139443_524_1672 327
27 3300049580 Ga0501046_0049616 Ga0501046_0049616_1804_2907 327
28 3300049589 Ga0501073_0023432 Ga0501073_0023432_3234_4337 327
29 iso_pu_bacteria 2728368998 2728749560 328
30 3300003215 JGI25153J46596_10011750 JGI25153J46596_100117505 329
31 3300025273 Ga0209673_1015458 Ga0209673_10154581 329
32 3300025297 Ga0209758_1013460 Ga0209758_10134606 329
33 3300025299 Ga0209256_1008395 Ga0209256_10083954 329
34 3300046460 Ga0495638_0141564 Ga0495638_0141564_97_1215 329
35 3300046474 Ga0495605_0011323 Ga0495605_0011323_1198_2316 329
36 3300046501 Ga0495607_0013410 Ga0495607_0013410_3582_4700 329
37 3300046507 Ga0495606_0032616 Ga0495606_0032616_1417_2535 329
38 3300046513 Ga0495616_0032165 Ga0495616_0032165_1475_2593 329
39 3300046515 Ga0495620_0012302 Ga0495620_0012302_2667_3785 329
40 3300046519 Ga0495632_0010057 Ga0495632_0010057_2998_4116 329
41 3300046522 Ga0495643_0005757 Ga0495643_0005757_625_1743 329
42 3300046542 Ga0495597_0021419 Ga0495597_0021419_418_1536 329
43 3300046616 Ga0495668_0037597 Ga0495668_0037597_979_2097 329
44 3300047472 Ga0495686_0040634 Ga0495686_0040634_788_1906 329
45 3300049581 Ga0501047_0032495 Ga0501047_0032495_1047_2150 329
46 3300049586 Ga0501070_0042890 Ga0501070_0042890_896_1999 329
47 3300049741 Ga0501079_0146530 Ga0501079_0146530_698_1801 329
48 3300049823 Ga0501044_0256400 Ga0501044_0256400_410_1513 329
49 3300053093 Ga0500651_0052952 Ga0500651_0052952_895_2013 329
50 3300053109 Ga0500569_002799 Ga0500569_002799_2289_3407 329
51 3300053153 Ga0500616_0008446 Ga0500616_0008446_2985_4103 329
52 3300044658 Ga0466972_0005593 Ga0466972_0005593_3106_4197 330
53 3300005439 Ga0070711_100113201 Ga0070711_1001132012 331
54 3300005445 Ga0070708_100055146 Ga0070708_1000551465 333
55 3300044735 Ga0466968_0003762 Ga0466968_0003762_299_1390 333
56 3300005445 Ga0070708_100141972 Ga0070708_1001419722 337
57 3300033442 Ga0315911_1000006 Ga0315911_100000643 337
58 3300005434 Ga0070709_10017006 Ga0070709_100170064 338
59 3300005435 Ga0070714_100263042 Ga0070714_1002630421 338
60 3300021441 Ga0213871_10036700 Ga0213871_100367001 338
61 3300025929 Ga0207664_10258085 Ga0207664_102580852 338
62 3300039438 Ga0436360_0604050 Ga0436360_0604050_265_1353 338
63 3300007265 Ga0099794_10018200 Ga0099794_100182003 339
64 3300010159 Ga0099796_10064443 Ga0099796_100644431 339
65 3300025228 Ga0209672_105057 Ga0209672_1050572 339
66 3300025253 Ga0209677_100522 Ga0209677_1005229 340
67 3300036401 Ga0373937_0297529 Ga0373937_0297529_131_1225 340
68 3300048921 Ga0496118_0068301 Ga0496118_0068301_562_1719 340
69 3300048922 Ga0496119_0037813 Ga0496119_0037813_1104_2261 340
70 3300005434 Ga0070709_10208022 Ga0070709_102080221 341
71 3300005985 Ga0081539_10002339 Ga0081539_1000233921 341
72 3300025906 Ga0207699_10081369 Ga0207699_100813692 341
73 3300025929 Ga0207664_10045690 Ga0207664_100456903 341
74 3300027312 Ga0209371_1009668 Ga0209371_10096682 341
75 3300039437 Ga0436365_1277951 Ga0436365_1277951_47_1153 341
76 3300046454 Ga0495592_0050837 Ga0495592_0050837_364_1458 342
77 3300046462 Ga0495651_0097611 Ga0495651_0097611_153_1247 342
78 3300046529 Ga0495652_0157536 Ga0495652_0157536_283_1377 342
79 3300046680 Ga0495646_0084194 Ga0495646_0084194_364_1458 342
80 iso_pu_bacteria 2643221689 2644496969 343
81 iso_pu_bacteria 2894652903 2894657030 343
82 iso_pu_bacteria 2904699407 2904702358 343
83 iso_pu_bacteria 2915980308 2915982111 343
84 3300036401 Ga0373937_0064341 Ga0373937_0064341_2182_3222 344
85 iso_pu_bacteria 2775507266 2778174111 344
86 3300046660 Ga0495625_0021251 Ga0495625_0021251_1623_2717 345
87 iso_pu_bacteria 2513237096 2513657974 345
88 iso_pu_bacteria 2513237137 2513855676 345
89 iso_pu_bacteria 2513237145 2513919933 345
90 iso_pu_bacteria 2517572143 2517892213 345
91 iso_pu_bacteria 2667528175 2671120537 345
92 iso_pu_bacteria 2791355197 2793068716 345
93 iso_pu_bacteria 2885374607 2885381962 345
94 iso_pu_bacteria 2903748898 2903751582 345
95 iso_pu_bacteria 2904690495 2904694650 345
96 iso_pu_bacteria 2906610324 2906617335 345
97 iso_pu_bacteria 2906635258 2906643092 345
98 iso_pu_bacteria 2906660503 2906666183 345
99 iso_pu_bacteria 2908739725 2908742490 345
100 iso_pu_bacteria 2908756301 2908760200 345
101 iso_pu_bacteria 3005474847 3005480398 345
102 iso_pu_bacteria 8006933436 8006940476 345
103 iso_pu_bacteria 8019555841 8019556548 345
104 iso_pu_bacteria 8019565922 8019568761 345
105 iso_pu_bacteria 8056689827 8056691332 345
106 3300005985 Ga0081539_10000444 Ga0081539_1000044466 346
107 iso_pu_bacteria 2510917028 2511186730 346
108 iso_pu_bacteria 2513237088 2513595929 346
109 iso_pu_bacteria 2513237146 2513928336 346
110 iso_pu_bacteria 2582581308 2585277301 346
111 iso_pu_bacteria 2582581316 2585331663 346
112 iso_pu_bacteria 2585427527 2585533965 346
113 iso_pu_bacteria 2585427530 2585552185 346
114 iso_pu_bacteria 2599185170 2599419153 346
115 iso_pu_bacteria 2615840626 2616308678 346
116 iso_pu_bacteria 2615840698 2616557016 346
117 iso_pu_bacteria 2643221557 2643804616 346
118 iso_pu_bacteria 2643221610 2644065425 346
119 iso_pu_bacteria 2643221668 2644375585 346
120 iso_pu_bacteria 2643221675 2644417027 346
121 iso_pu_bacteria 2643221680 2644448221 346
122 iso_pu_bacteria 2643221726 2644686626 346
123 iso_pu_bacteria 2667528174 2671111623 346
124 iso_pu_bacteria 2818991448 2819608960 346
125 iso_pu_bacteria 2818991453 2819637811 346
126 iso_pu_bacteria 2838029111 2838029994 346
127 iso_pu_bacteria 2838035591 2838037162 346
128 iso_pu_bacteria 2838042994 2838043800 346
129 iso_pu_bacteria 2838661181 2838663662 346
130 iso_pu_bacteria 2842475841 2842476721 346
131 iso_pu_bacteria 2842482326 2842484740 346
132 iso_pu_bacteria 2842502639 2842503522 346
133 iso_pu_bacteria 2842521101 2842525699 346
134 iso_pu_bacteria 2919408235 2919411594 346
135 iso_pu_bacteria 2996887358 2996887832 346
136 iso_pu_bacteria 643692032 643822204 346
137 iso_pu_bacteria 8005258706 8005259185 346
138 iso_pu_bacteria 8005321885 8005322359 346
139 iso_pu_bacteria 8005645114 8005649771 346
140 iso_pu_bacteria 8005682033 8005683089 346
141 iso_pu_bacteria 8024486573 8024492926 346
142 3300022739 Ga0228711_1000005 Ga0228711_1000005160 347
143 3300022740 Ga0228710_1000141 Ga0228710_100014120 347
144 3300027111 Ga0209281_1000111 Ga0209281_1000111160 347
145 3300027666 Ga0209282_1000012 Ga0209282_1000012160 347
146 3300031967 Ga0315914_1000007 Ga0315914_100000754 347
147 3300033430 Ga0315913_1000003 Ga0315913_1000003160 347
148 3300033464 Ga0315915_1000011 Ga0315915_100001154 347
149 iso_pu_bacteria 2512875026 2512968855 347
150 iso_pu_bacteria 2513237089 2513606464 347
151 iso_pu_bacteria 2513237156 2513986733 347
152 iso_pu_bacteria 2513237160 2514006094 347
153 iso_pu_bacteria 2517487022 2517566393 347
154 iso_pu_bacteria 2582581283 2585164749 347
155 iso_pu_bacteria 2582581306 2585265126 347
156 iso_pu_bacteria 2582581865 2585385742 347
157 iso_pu_bacteria 2802428858 2802719701 347
158 iso_pu_bacteria 2802428859 2802728321 347
159 iso_pu_bacteria 2802428860 2802733531 347
160 iso_pu_bacteria 2802428861 2802738761 347
161 iso_pu_bacteria 2802428862 2802745639 347
162 iso_pu_bacteria 2802428863 2802751404 347
163 iso_pu_bacteria 2921250672 2921256729 347
164 iso_pu_bacteria 2937029754 2937033730 347
165 iso_pu_bacteria 2937036028 2937040269 347
166 iso_pu_bacteria 2937078374 2937084606 347
167 iso_pu_bacteria 2957375807 2957381146 347
168 iso_pu_bacteria 2957437181 2957441825 347
169 iso_pu_bacteria 2960591022 2960597018 347
170 iso_pu_bacteria 2960631154 2960631481 347
171 iso_pu_bacteria 2960680706 2960682222 347
172 iso_pu_bacteria 2960693952 2960697976 347
173 iso_pu_bacteria 2967686174 2967689528 347
174 iso_pu_bacteria 2967728569 2967730299 347
175 iso_pu_bacteria 2970026789 2970028954 347
176 iso_pu_bacteria 2970122695 2970125692 347
177 iso_pu_bacteria 2970143518 2970149443 347
178 iso_pu_bacteria 2977530762 2977534607 347
179 iso_pu_bacteria 2977544691 2977548916 347
180 iso_pu_bacteria 2996336353 2996337538 347
181 iso_pu_bacteria 8003999396 8004004864 347
182 3300025294 Ga0209025_1043735 Ga0209025_10437352 348
183 3300037068 Ga0373925_0153260 Ga0373925_0153260_70_1185 348
184 3300025261 Ga0209233_1003450 Ga0209233_10034505 349
185 3300025913 Ga0207695_10189014 Ga0207695_101890142 349
186 3300031250 Ga0265331_10007663 Ga0265331_100076632 349
187 3300031595 Ga0265313_10000127 Ga0265313_1000012761 349
188 3300031711 Ga0265314_10039831 Ga0265314_100398312 349
189 3300031712 Ga0265342_10011360 Ga0265342_100113604 349
190 3300039437 Ga0436365_1348118 Ga0436365_1348118_597_1721 349
191 3300048916 Ga0496113_0029971 Ga0496113_0029971_1104_2225 349
192 3300048920 Ga0496117_0037829 Ga0496117_0037829_2430_3521 349
193 3300053119 Ga0500595_001560 Ga0500595_001560_6265_7356 349
194 iso_pu_bacteria 2935630451 2935631475 349
195 iso_pu_bacteria 2941507105 2941510217 349
196 iso_pu_bacteria 2941515067 2941518697 349
197 iso_pu_bacteria 2941523033 2941525616 349
198 iso_pu_bacteria 8006973647 8006980165 349
199 3300001979 JGI24740J21852_10000052 JGI24740J21852_100000521 350
200 3300002704 JGI25155J39150_1000001 JGI25155J39150_1000001108 350
201 3300002705 JGI25156J39149_1000001 JGI25156J39149_1000001224 350
202 3300002737 JGI25162J39368_1000209 JGI25162J39368_100020919 350
203 3300002738 JGI25154J39366_1000011 JGI25154J39366_1000011159 350
204 3300002739 JGI25158J39367_1000040 JGI25158J39367_10000402 350
205 3300002741 JGI25157J39369_1000030 JGI25157J39369_100003026 350
206 3300002987 JGI25159J45721_1000011 JGI25159J45721_100001117 350
207 3300003214 JGI25165J46597_1000302 JGI25165J46597_100030219 350
208 3300003323 rootH1_10185878 rootH1_101858782 350
209 3300003775 Ga0055524_1000609 Ga0055524_100060917 350
210 3300003794 Ga0055531_10012427 Ga0055531_100124274 350
211 3300005367 Ga0070667_100258293 Ga0070667_1002582931 350
212 3300005434 Ga0070709_10013814 Ga0070709_100138143 350
213 3300005435 Ga0070714_100017466 Ga0070714_1000174662 350
214 3300005437 Ga0070710_10016221 Ga0070710_100162213 350
215 3300005518 Ga0070699_100047436 Ga0070699_1000474363 350
216 3300005578 Ga0068854_100028691 Ga0068854_1000286913 350
217 3300005614 Ga0068856_100185559 Ga0068856_1001855591 350
218 3300005983 Ga0081540_1026881 Ga0081540_10268812 350
219 3300006028 Ga0070717_10020586 Ga0070717_100205866 350
220 3300006163 Ga0070715_10001657 Ga0070715_100016574 350
221 3300006173 Ga0070716_100011070 Ga0070716_1000110703 350
222 3300006846 Ga0075430_100093044 Ga0075430_1000930443 350
223 3300006847 Ga0075431_100160010 Ga0075431_1001600104 350
224 3300009093 Ga0105240_10000005 Ga0105240_10000005694 350
225 3300009147 Ga0114129_10203885 Ga0114129_102038852 350
226 3300009147 Ga0114129_10256630 Ga0114129_102566302 350
227 3300009545 Ga0105237_10002054 Ga0105237_100020543 350
228 3300009766 Ga0123342_1012737 Ga0123342_10127377 350
229 3300010375 Ga0105239_10001069 Ga0105239_1000106927 350
230 3300013104 Ga0157370_10000046 Ga0157370_1000004682 350
231 3300013249 Ga0171463_1002 Ga0171463_1002195 350
232 3300014497 Ga0182008_10040031 Ga0182008_100400311 350
233 3300015262 Ga0182007_10005797 Ga0182007_100057973 350
234 3300015265 Ga0182005_1014072 Ga0182005_10140722 350
235 3300021377 Ga0213874_10017338 Ga0213874_100173382 350
236 3300021384 Ga0213876_10011273 Ga0213876_100112735 350
237 3300025206 Ga0209435_100012 Ga0209435_100012158 350
238 3300025233 Ga0209437_100047 Ga0209437_100047133 350
239 3300025246 Ga0209646_1000026 Ga0209646_1000026158 350
240 3300025250 Ga0209026_1000014 Ga0209026_1000014158 350
241 3300025253 Ga0209677_100656 Ga0209677_1006564 350
242 3300025256 Ga0209759_1000012 Ga0209759_1000012158 350
243 3300025261 Ga0209233_1000048 Ga0209233_1000048269 350
244 3300025261 Ga0209233_1000195 Ga0209233_1000195113 350
245 3300025294 Ga0209025_1044646 Ga0209025_10446462 350
246 3300025297 Ga0209758_1002977 Ga0209758_10029775 350
247 3300025297 Ga0209758_1008762 Ga0209758_10087622 350
248 3300025304 Ga0209257_1000657 Ga0209257_100065746 350
249 3300025898 Ga0207692_10019488 Ga0207692_100194884 350
250 3300025905 Ga0207685_10002119 Ga0207685_100021194 350
251 3300025912 Ga0207707_10145153 Ga0207707_101451533 350
252 3300025913 Ga0207695_10000011 Ga0207695_10000011223 350
253 3300025914 Ga0207671_10000241 Ga0207671_1000024130 350
254 3300025915 Ga0207693_10042569 Ga0207693_100425693 350
255 3300025915 Ga0207693_10045856 Ga0207693_100458563 350
256 3300025939 Ga0207665_10004662 Ga0207665_100046624 350
257 3300025981 Ga0207640_10027318 Ga0207640_100273182 350
258 3300025986 Ga0207658_10230529 Ga0207658_102305291 350
259 3300026078 Ga0207702_10060334 Ga0207702_100603343 350
260 3300026078 Ga0207702_10272159 Ga0207702_102721591 350
261 3300031456 Ga0307513_10020569 Ga0307513_100205697 350
262 3300035111 Ga0373923_0024174 Ga0373923_0024174_936_2018 350
263 3300035113 Ga0373936_0049976 Ga0373936_0049976_252_1334 350
264 3300035170 Ga0373943_0016232 Ga0373943_0016232_335_1417 350
265 3300035692 Ga0373935_0002559 Ga0373935_0002559_988_2070 350
266 3300035695 Ga0373927_0001007 Ga0373927_0001007_14041_15123 350
267 3300035725 Ga0373947_0000308 Ga0373947_0000308_21433_22515 350
268 3300035725 Ga0373947_0047858 Ga0373947_0047858_1257_2351 350
269 3300037068 Ga0373925_0003517 Ga0373925_0003517_7181_8263 350
270 3300039437 Ga0436365_1540042 Ga0436365_1540042_3604_4731 350
271 3300039438 Ga0436360_0145658 Ga0436360_0145658_793_1908 350
272 3300039450 Ga0436363_0629124 Ga0436363_0629124_234_1343 350
273 3300039450 Ga0436363_1072504 Ga0436363_1072504_14536_15663 350
274 3300039450 Ga0436363_1082739 Ga0436363_1082739_15376_16512 350
275 3300041404 Ga0439436_0009046 Ga0439436_0009046_1944_3002 350
276 3300041411 Ga0439466_0035160 Ga0439466_0035160_130_1188 350
277 3300041413 Ga0439465_0000636 Ga0439465_0000636_7601_8659 350
278 3300042015 Ga0439462_0005250 Ga0439462_0005250_1217_2275 350
279 3300042435 Ga0439434_0007930 Ga0439434_0007930_1252_2310 350
280 3300042531 Ga0450918_000960 Ga0450918_000960_1174_2232 350
281 3300044694 Ga0466963_0066932 Ga0466963_0066932_95_1147 350
282 3300044765 Ga0466970_0000517 Ga0466970_0000517_4833_5885 350
283 3300044842 Ga0466957_0035148 Ga0466957_0035148_1067_2119 350
284 3300045836 Ga0466958_0080715 Ga0466958_0080715_129_1181 350
285 3300046459 Ga0495629_0000355 Ga0495629_0000355_24227_25309 350
286 3300046460 Ga0495638_0015508 Ga0495638_0015508_692_1801 350
287 3300046461 Ga0495641_0005223 Ga0495641_0005223_4836_5918 350
288 3300046462 Ga0495651_0161898 Ga0495651_0161898_217_1299 350
289 3300046472 Ga0495580_0000744 Ga0495580_0000744_23740_24822 350
290 3300046472 Ga0495580_0178434 Ga0495580_0178434_11_1105 350
291 3300046473 Ga0495582_0000130 Ga0495582_0000130_6208_7290 350
292 3300046475 Ga0495639_0000061 Ga0495639_0000061_24782_25864 350
293 3300046476 Ga0495662_0000232 Ga0495662_0000232_4880_6082 350
294 3300046477 Ga0495664_0030653 Ga0495664_0030653_1583_2665 350
295 3300046499 Ga0495594_0000317 Ga0495594_0000317_10656_11738 350
296 3300046516 Ga0495628_0018524 Ga0495628_0018524_3551_4633 350
297 3300046517 Ga0495630_0004499 Ga0495630_0004499_4685_5767 350
298 3300046526 Ga0495666_0016968 Ga0495666_0016968_1678_2760 350
299 3300046529 Ga0495652_0016163 Ga0495652_0016163_281_1363 350
300 3300046531 Ga0495665_0005979 Ga0495665_0005979_1600_2682 350
301 3300046533 Ga0495640_0001092 Ga0495640_0001092_2851_3933 350
302 3300046557 Ga0495622_0004779 Ga0495622_0004779_660_1742 350
303 3300046559 Ga0495667_0027698 Ga0495667_0027698_2723_3805 350
304 3300046663 Ga0495635_0002547 Ga0495635_0002547_5259_6341 350
305 3300046681 Ga0495647_0001033 Ga0495647_0001033_2775_3857 350
306 3300046683 Ga0495658_0000047 Ga0495658_0000047_2127_3209 350
307 3300046689 Ga0495613_0001104 Ga0495613_0001104_3918_5000 350
308 3300046690 Ga0495624_0000188 Ga0495624_0000188_20077_21159 350
309 3300046809 Ga0495600_0054011 Ga0495600_0054011_641_1723 350
310 3300047315 Ga0495581_0000152 Ga0495581_0000152_22935_24017 350
311 3300047319 Ga0495674_0004757 Ga0495674_0004757_11295_12377 350
312 3300047321 Ga0495676_0044464 Ga0495676_0044464_1980_3062 350
313 3300047673 Ga0495593_0000144 Ga0495593_0000144_28440_29522 350
314 3300048904 Ga0496101_0050149 Ga0496101_0050149_1360_2484 350
315 3300048904 Ga0496101_0061620 Ga0496101_0061620_1487_2596 350
316 3300048905 Ga0496102_0002015 Ga0496102_0002015_13781_14905 350
317 3300048905 Ga0496102_0062421 Ga0496102_0062421_1426_2535 350
318 3300048906 Ga0496103_0006503 Ga0496103_0006503_2447_3571 350
319 3300048909 Ga0496106_0190700 Ga0496106_0190700_43_1152 350
320 3300048919 Ga0496116_0002733 Ga0496116_0002733_2002_3126 350
321 3300048920 Ga0496117_0000353 Ga0496117_0000353_27669_28793 350
322 3300048921 Ga0496118_0000204 Ga0496118_0000204_53021_54145 350
323 3300048922 Ga0496119_0022006 Ga0496119_0022006_1787_2839 350
324 3300048922 Ga0496119_0022426 Ga0496119_0022426_2333_3457 350
325 3300048923 Ga0496120_0003039 Ga0496120_0003039_1064_2188 350
326 3300048924 Ga0496121_0000378 Ga0496121_0000378_61160_62284 350
327 3300048924 Ga0496121_0005175 Ga0496121_0005175_14583_15674 350
328 3300048925 Ga0496122_0008819 Ga0496122_0008819_8761_9885 350
329 3300048926 Ga0496123_0002174 Ga0496123_0002174_14327_15451 350
330 3300048927 Ga0496124_0006326 Ga0496124_0006326_10858_11982 350
331 3300048928 Ga0496125_0002169 Ga0496125_0002169_22141_23265 350
332 3300048929 Ga0496126_0103636 Ga0496126_0103636_59_1153 350
333 3300048929 Ga0496126_0160175 Ga0496126_0160175_665_1789 350
334 3300048929 Ga0496126_0245780 Ga0496126_0245780_197_1291 350
335 3300049574 Ga0501038_0155505 Ga0501038_0155505_42_1133 350
336 3300049581 Ga0501047_0257688 Ga0501047_0257688_14_1108 350
337 3300049822 Ga0501035_0002289 Ga0501035_0002289_5708_6799 350
338 3300050492 nmdc:mga0yw44_132698_c1 nmdc:mga0yw44_132698_c1_252_1310 350
339 3300050508 nmdc:mga09592_338587_c1 nmdc:mga09592_338587_c1_113_1225 350
340 3300050509 nmdc:mga0qj67_11852_c1 nmdc:mga0qj67_11852_c1_182_1294 350
341 3300050510 nmdc:mga06r32_33684_c1 nmdc:mga06r32_33684_c1_214_1326 350
342 3300050513 nmdc:mga0rr50_94505_c1 nmdc:mga0rr50_94505_c1_694_1803 350
343 3300053139 Ga0500568_0000104 Ga0500568_0000104_22038_23129 350
344 3300053153 Ga0500616_0031098 Ga0500616_0031098_884_1981 350
345 iso_pu_bacteria 2513237159 2513999706 350
346 iso_pu_bacteria 2582581315 2585323689 350
347 iso_pu_bacteria 2617270742 2617385775 350
348 iso_pu_bacteria 2690316117 2692318120 350
349 iso_pu_bacteria 2775506901 2776263875 350
350 iso_pu_bacteria 3005416602 3005420007 350
351 iso_pu_bacteria 8005314921 8005316958 350
352 iso_pu_bacteria 8005484373 8005485245 350

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00211

Guanylate_cyc

Adenylate and Guanylate cyclase catalytic domain

229

406

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mbg-assembly1.cif.gz_A-2 structure of a bacterial light-regulated adenylyl cyclase 0.8757 168 350
1wc1-assembly2.cif.gz_B soluble adenylyl cyclase cyac from s. platensis in complex with rp- atpalphas 0.8671 167 350
1wc5-assembly1.cif.gz_D soluble adenylyl cyclase cyac from s. platensis in complex with alpha, beta-methylene-atp in presence of bicarbonate 0.8632 167 350
3r5g-assembly2.cif.gz_B crystal structure of the adenylyl cyclase cyab from p. aeruginosa 0.8577 165 350
2bw7-assembly1.cif.gz_B a novel mechanism for adenylyl cyclase inhibition from the crystal structure of its complex with catechol estrogen 0.8519 165 350
ID Description Score Start End Superfamily
af_O06572_14_160_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.9064 171 276 3.30.70.1230
af_Q55F68_1579_1775_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8857 171 349 3.30.70.1230
3r5gA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8673 168 350 3.30.70.1230
af_Q4CLR1_298_428_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8525 167 279 3.30.70.1230
1wc5A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8513 165 349 3.30.70.1230
ID Description Score Start End GO Terms
AF-A0A531KHQ1-F1-model_v4 deleted 0.9318 173 350
AF-A0A211ZK27-F1-model_v4 Guanylyl cyclase 0.9223 1 100
AF-A0A537YX39-F1-model_v4 Adenylate/guanylate cyclase domain-containing protein 0.9179 167 279 GO:0004016
GO:0009190
GO:0035556
AF-A0A531KHQ1-F1-model_v4 deleted 0.9067 173 350
AF-A0A3D3WHF7-F1-model_v4 Adenylate/guanylate cyclase domain-containing protein 0.9008 167 346 GO:0004016
GO:0005886
GO:0006171
GO:0035556
GO:0051536

Feature Viewer

pLDDT pTM Quality
88.17 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map