F419272

General Info

Members Datasets Scaffolds Average Seq Length
353 149 351 312

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100170644|Ga0070683_1001706442
Length 333
Sequence MADVAERTHEPGTPTARRKAGHRPQRRLADRDNALAWIFLMPSVVYIVALVAIPFFLAVGFALSDVTSGDPSFDFVGFRNFEAIFHDPVFWRSLRNTFVFTAVSMVLIVVLGKVLANILIADFRGKWFVRFLVLLPWTTPATLSAISWLWMLDSIYSPVDWVFRKIGILDDLIVIFSDRQNPGPGENMYWLGEPGLAMASVIIVHVWRLTPLAAVIMMAGLVAIPKDLEEAARVDGAGYWRRMFEVTIPMTMPVIAVAALFGAIFTFTDMAVVDVLTNGGPNNATQVLTSWAFFRGIDGGDVGQGAAIALFLFPLLLAAAIAVLRAVRRMELR

Samples

Sample ID Description Type Environment
1 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
2 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
92 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
93 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
94 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
95 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
96 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
97 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
98 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
99 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
100 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
101 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
102 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
103 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
104 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
131 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
132 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
146 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
147 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.43
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10012649 3300003203 Bacteria 3651
2 JGI25407J50210_10000771 3300003373 Bacteria 6745
3 JGI25407J50210_10000847 3300003373 Bacteria 6582
4 JGI25407J50210_10001192 3300003373 Bacteria 5786
5 JGI25407J50210_10003086 3300003373 Bacteria 3971
6 Ga0070658_10003819 3300005327 Bacteria 12344
7 Ga0070683_100170644 3300005329 Bacteria 2065
8 Ga0068869_100115555 3300005334 Bacteria 2046
9 Ga0070680_100003683 3300005336 Bacteria 11441
10 Ga0068868_100010475 3300005338 Bacteria 6716
11 Ga0070660_100133768 3300005339 Bacteria 1986
12 Ga0070661_100356241 3300005344 Bacteria 1149
13 Ga0070692_10167228 3300005345 Bacteria 1265
14 Ga0070675_100420166 3300005354 Bacteria 1195
15 Ga0070659_100255227 3300005366 Bacteria 1454
16 Ga0070700_100002498 3300005441 Bacteria 9366
17 Ga0070700_100255628 3300005441 Bacteria 1259
18 Ga0070663_100015627 3300005455 Bacteria 4907
19 Ga0070662_100174047 3300005457 Bacteria 1692
20 Ga0070681_10005071 3300005458 Bacteria 12704
21 Ga0070698_100192093 3300005471 Bacteria 1979
22 Ga0070679_100039924 3300005530 Bacteria 4666
23 Ga0070684_100094104 3300005535 Bacteria 2668
24 Ga0070672_100345232 3300005543 Bacteria 1268
25 Ga0070696_100001658 3300005546 Bacteria 14594
26 Ga0070664_100006380 3300005564 Bacteria 9513
27 Ga0068857_100443375 3300005577 Bacteria 1213
28 Ga0068852_100068581 3300005616 Bacteria 3105
29 Ga0068859_100775391 3300005617 Bacteria 1047
30 Ga0068861_100168404 3300005719 Bacteria 1814
31 Ga0068862_100097229 3300005844 Bacteria 2570
32 Ga0081455_10002855 3300005937 Bacteria 20342
33 Ga0081455_10006806 3300005937 Bacteria 12188
34 Ga0081455_10036750 3300005937 Bacteria 4356
35 Ga0081455_10044405 3300005937 Bacteria 3877
36 Ga0081455_10102323 3300005937 Bacteria 2297
37 Ga0081538_10000164 3300005981 Bacteria 70649
38 Ga0081538_10000203 3300005981 Bacteria 66027
39 Ga0081538_10000316 3300005981 Bacteria 55223
40 Ga0081538_10000388 3300005981 Bacteria 49943
41 Ga0081538_10001647 3300005981 Bacteria 22898
42 Ga0081538_10001716 3300005981 Bacteria 22311
43 Ga0081538_10002791 3300005981 Bacteria 16733
44 Ga0081538_10003705 3300005981 Bacteria 14340
45 Ga0081538_10005035 3300005981 Bacteria 12027
46 Ga0081538_10012651 3300005981 Bacteria 6751
47 Ga0081538_10019523 3300005981 Bacteria 5032
48 Ga0081538_10019775 3300005981 Bacteria 4984
49 Ga0081538_10023235 3300005981 Bacteria 4463
50 Ga0081538_10025342 3300005981 Bacteria 4186
51 Ga0081538_10060698 3300005981 Bacteria 2172
52 Ga0081538_10115147 3300005981 Bacteria 1308
53 Ga0081538_10118972 3300005981 Bacteria 1275
54 Ga0081538_10148309 3300005981 Bacteria 1067
55 Ga0081539_10004320 3300005985 Bacteria 15863
56 Ga0081539_10072569 3300005985 Bacteria 1839
57 Ga0075428_100000495 3300006844 Bacteria 39882
58 Ga0075428_100006070 3300006844 Bacteria 13431
59 Ga0075428_100328315 3300006844 Bacteria 1643
60 Ga0075428_100560289 3300006844 Unclassified 1221
61 Ga0075430_100000695 3300006846 Bacteria 25646
62 Ga0075430_100001764 3300006846 Bacteria 17686
63 Ga0075430_100006111 3300006846 Bacteria 10151
64 Ga0075431_100004428 3300006847 Bacteria 13771
65 Ga0075431_100015849 3300006847 Bacteria 7643
66 Ga0075431_100052327 3300006847 Bacteria 4211
67 Ga0075431_100068710 3300006847 Bacteria 3656
68 Ga0075431_100099409 3300006847 Bacteria 3002
69 Ga0075431_100157083 3300006847 Bacteria 2340
70 Ga0075431_100531998 3300006847 Bacteria 1164
71 Ga0075429_100001818 3300006880 Bacteria 17659
72 Ga0075429_100030614 3300006880 Bacteria 4675
73 Ga0097620_100775335 3300006931 Bacteria 1047
74 Ga0111539_10005610 3300009094 Bacteria 16231
75 Ga0105245_10403881 3300009098 Bacteria 1366
76 Ga0114129_10000050 3300009147 Bacteria 102066
77 Ga0114129_10043613 3300009147 Bacteria 6310
78 Ga0114129_10496186 3300009147 Bacteria 1595
79 Ga0105243_10085171 3300009148 Bacteria 2590
80 Ga0105249_10354994 3300009553 Bacteria 1486
81 Ga0105246_10347370 3300011119 Bacteria 1214
82 Ga0157369_10111229 3300013105 Bacteria 2911
83 Ga0157375_10180780 3300013308 Bacteria 2260
84 Ga0157375_10353288 3300013308 Bacteria 1636
85 Ga0157377_10007784 3300014745 Bacteria 5192
86 Ga0207688_10020730 3300025901 Bacteria 3588
87 Ga0207705_10003412 3300025909 Bacteria 12082
88 Ga0207707_10002296 3300025912 Bacteria 17249
89 Ga0207660_10002740 3300025917 Bacteria 11539
90 Ga0207657_10129328 3300025919 Bacteria 2071
91 Ga0207649_10269299 3300025920 Bacteria 1234
92 Ga0207652_10001970 3300025921 Bacteria 17756
93 Ga0207650_10360206 3300025925 Bacteria 1198
94 Ga0207659_10004131 3300025926 Bacteria 8764
95 Ga0207706_10064697 3300025933 Bacteria 3220
96 Ga0207709_10103130 3300025935 Bacteria 1890
97 Ga0207691_10361725 3300025940 Bacteria 1241
98 Ga0207689_10012598 3300025942 Bacteria 7224
99 Ga0207661_10162509 3300025944 Bacteria 1938
100 Ga0207661_10504161 3300025944 Bacteria 1106
101 Ga0207679_10273239 3300025945 Bacteria 1446
102 Ga0207651_10306364 3300025960 Bacteria 1323
103 Ga0207712_10051913 3300025961 Bacteria 2870
104 Ga0207668_10329725 3300025972 Bacteria 1269
105 Ga0207677_10361517 3300026023 Bacteria 1219
106 Ga0207678_10004729 3300026067 Bacteria 12227
107 Ga0207708_10002684 3300026075 Bacteria 13076
108 Ga0207674_10404615 3300026116 Bacteria 1319
109 Ga0207675_100048288 3300026118 Bacteria 3973
110 Ga0207698_10011776 3300026142 Bacteria 5688
111 Ga0207428_10059702 3300027907 Bacteria 3023
112 Ga0268265_10033592 3300028380 Bacteria 3731
113 Ga0316177_1027862 3300030731 Bacteria 1402
114 Ga0307408_100003779 3300031548 Bacteria 10313
115 Ga0307408_100037442 3300031548 Bacteria 3417
116 Ga0307408_100045830 3300031548 Bacteria 3125
117 Ga0307408_100054433 3300031548 Bacteria 2893
118 Ga0307405_10003601 3300031731 Bacteria 7156
119 Ga0307405_10012350 3300031731 Bacteria 4517
120 Ga0307405_10016970 3300031731 Bacteria 3985
121 Ga0307405_10103445 3300031731 Bacteria 1915
122 Ga0307413_10000511 3300031824 Bacteria 12790
123 Ga0307413_10044923 3300031824 Bacteria 2614
124 Ga0307410_10000179 3300031852 Bacteria 23280
125 Ga0307410_10005394 3300031852 Bacteria 6760
126 Ga0307410_10008772 3300031852 Bacteria 5630
127 Ga0307410_10020427 3300031852 Bacteria 4051
128 Ga0307406_10000019 3300031901 Bacteria 98555
129 Ga0307406_10009384 3300031901 Bacteria 5486
130 Ga0307406_10029033 3300031901 Bacteria 3345
131 Ga0307406_10049677 3300031901 Bacteria 2655
132 Ga0307406_10096262 3300031901 Bacteria 2005
133 Ga0307406_10241046 3300031901 Bacteria 1356
134 Ga0307406_10256429 3300031901 Bacteria 1320
135 Ga0307407_10001238 3300031903 Bacteria 9070
136 Ga0307407_10006527 3300031903 Bacteria 5198
137 Ga0307407_10012590 3300031903 Bacteria 4072
138 Ga0307407_10034969 3300031903 Bacteria 2756
139 Ga0307407_10062733 3300031903 Bacteria 2178
140 Ga0307407_10143552 3300031903 Bacteria 1543
141 Ga0307412_10003044 3300031911 Bacteria 9286
142 Ga0307412_10016031 3300031911 Bacteria 4454
143 Ga0307412_10026828 3300031911 Bacteria 3586
144 Ga0307412_10032946 3300031911 Bacteria 3288
145 Ga0307412_10036388 3300031911 Bacteria 3153
146 Ga0307412_10046267 3300031911 Bacteria 2850
147 Ga0307412_10047663 3300031911 Bacteria 2815
148 Ga0307409_100000843 3300031995 Bacteria 14123
149 Ga0307409_100002245 3300031995 Bacteria 9988
150 Ga0307409_100003610 3300031995 Bacteria 8454
151 Ga0307409_100011006 3300031995 Bacteria 5669
152 Ga0307409_100055238 3300031995 Bacteria 3064
153 Ga0307409_100160315 3300031995 Bacteria 1966
154 Ga0307409_100407002 3300031995 Bacteria 1301
155 Ga0307416_100000040 3300032002 Bacteria 132572
156 Ga0307416_100003289 3300032002 Bacteria 9451
157 Ga0307416_100004304 3300032002 Bacteria 8548
158 Ga0307416_100021380 3300032002 Bacteria 4644
159 Ga0307416_100068660 3300032002 Bacteria 2929
160 Ga0307416_100090828 3300032002 Bacteria 2621
161 Ga0307416_100245115 3300032002 Bacteria 1740
162 Ga0307416_100264632 3300032002 Bacteria 1683
163 Ga0307416_100449897 3300032002 Bacteria 1340
164 Ga0307416_100472367 3300032002 Bacteria 1312
165 Ga0307414_10001028 3300032004 Bacteria 14250
166 Ga0307414_10035261 3300032004 Bacteria 3328
167 Ga0307414_10039968 3300032004 Bacteria 3165
168 Ga0307414_10102979 3300032004 Bacteria 2153
169 Ga0307411_10004200 3300032005 Bacteria 6847
170 Ga0307411_10067190 3300032005 Bacteria 2411
171 Ga0307411_10492090 3300032005 Bacteria 1035
172 Ga0307415_100000059 3300032126 Bacteria 46229
173 Ga0307415_100000218 3300032126 Bacteria 25082
174 Ga0307415_100000730 3300032126 Bacteria 14752
175 Ga0307415_100010092 3300032126 Bacteria 5329
176 Ga0307415_100023237 3300032126 Bacteria 3844
177 Ga0307415_100055333 3300032126 Bacteria 2714
178 Ga0307415_100065700 3300032126 Bacteria 2528
179 Ga0307415_100091390 3300032126 Bacteria 2204
180 Ga0307415_100093558 3300032126 Bacteria 2183
181 Ga0307415_100148621 3300032126 Bacteria 1800
182 Ga0307415_100191476 3300032126 Bacteria 1614
183 Ga0307415_100465722 3300032126 Bacteria 1096
184 Ga0395899_0082711 3300037312 Bacteria 2335
185 Ga0395900_0035337 3300037418 Bacteria 5147
186 Ga0395900_0123620 3300037418 Bacteria 2654
187 Ga0395900_0149464 3300037418 Bacteria 2387
188 Ga0395900_0152952 3300037418 Bacteria 2357
189 Ga0395898_0004907 3300037466 Bacteria 14520
190 Ga0395898_0032368 3300037466 Bacteria 5219
191 Ga0395898_0059569 3300037466 Bacteria 3713
192 Ga0395898_0426036 3300037466 Bacteria 1264
193 Ga0395905_0417060 3300037471 Bacteria 1238
194 Ga0395901_0015556 3300038443 Bacteria 7749
195 Ga0395901_0036287 3300038443 Bacteria 5094
196 Ga0395901_0103754 3300038443 Bacteria 2983
197 Ga0395901_0128957 3300038443 Bacteria 2658
198 Ga0395901_0176762 3300038443 Bacteria 2239
199 Ga0395901_0704705 3300038443 Bacteria 1007
200 Ga0439443_007891 3300042003 Bacteria 1490
201 Ga0439445_0004546 3300042004 Bacteria 3143
202 Ga0439448_0005152 3300042005 Bacteria 3720
203 Ga0439450_004686 3300042008 Bacteria 2354
204 Ga0439451_042267 3300042009 Bacteria 914
205 Ga0439454_008996 3300042011 Bacteria 1288
206 Ga0439463_000556 3300042016 Bacteria 10455
207 Ga0439463_002121 3300042016 Bacteria 5129
208 Ga0439463_003292 3300042016 Bacteria 4097
209 Ga0450888_003295 3300042126 Bacteria 1628
210 Ga0450898_003909 3300042134 Bacteria 2171
211 Ga0450900_001864 3300042136 Bacteria 2145
212 Ga0450902_008365 3300042137 Bacteria 1615
213 Ga0439464_0038690 3300042439 Bacteria 1355
214 Ga0439460_0101363 3300042461 Bacteria 925
215 Ga0439440_0000162 3300042993 Bacteria 9973
216 Ga0439440_0001062 3300042993 Bacteria 4893
217 Ga0466960_0007323 3300044901 Bacteria 4476
218 Ga0495596_0076834 3300046500 Bacteria 1297
219 Ga0501031_0000772 3300049568 Bacteria 19242
220 Ga0501031_0010086 3300049568 Bacteria 6157
221 Ga0501031_0011843 3300049568 Bacteria 5687
222 Ga0501031_0226032 3300049568 Bacteria 1218
223 Ga0501032_0012146 3300049569 Bacteria 6164
224 Ga0501032_0045557 3300049569 Bacteria 2966
225 Ga0501033_0006747 3300049570 Bacteria 8968
226 Ga0501033_0031739 3300049570 Bacteria 3966
227 Ga0501034_0003568 3300049571 Bacteria 17669
228 Ga0501034_0232755 3300049571 Bacteria 1791
229 Ga0501036_0000320 3300049572 Bacteria 33468
230 Ga0501036_0002562 3300049572 Bacteria 14298
231 Ga0501036_0005938 3300049572 Bacteria 9891
232 Ga0501036_0007044 3300049572 Bacteria 9148
233 Ga0501036_0057440 3300049572 Bacteria 3296
234 Ga0501037_0044423 3300049573 Bacteria 3263
235 Ga0501037_0044870 3300049573 Bacteria 3245
236 Ga0501037_0077663 3300049573 Bacteria 2409
237 Ga0501037_0126657 3300049573 Bacteria 1833
238 Ga0501038_0001185 3300049574 Bacteria 23677
239 Ga0501038_0018963 3300049574 Bacteria 6208
240 Ga0501038_0021833 3300049574 Bacteria 5742
241 Ga0501038_0026502 3300049574 Bacteria 5162
242 Ga0501039_0000898 3300049575 Bacteria 21645
243 Ga0501039_0003106 3300049575 Bacteria 12411
244 Ga0501039_0036573 3300049575 Bacteria 3789
245 Ga0501039_0043475 3300049575 Bacteria 3470
246 Ga0501040_0000011 3300049576 Bacteria 78260
247 Ga0501040_0000977 3300049576 Bacteria 18081
248 Ga0501040_0003801 3300049576 Bacteria 9793
249 Ga0501040_0062759 3300049576 Bacteria 2556
250 Ga0501041_0001655 3300049577 Bacteria 12469
251 Ga0501041_0007009 3300049577 Bacteria 6612
252 Ga0501041_0110088 3300049577 Bacteria 1709
253 Ga0501042_0000397 3300049578 Bacteria 22050
254 Ga0501042_0000964 3300049578 Bacteria 16242
255 Ga0501042_0014458 3300049578 Bacteria 5389
256 Ga0501042_0030810 3300049578 Bacteria 3792
257 Ga0501042_0077619 3300049578 Bacteria 2378
258 Ga0501042_0320266 3300049578 Bacteria 1120
259 Ga0501043_0015475 3300049579 Bacteria 5975
260 Ga0501043_0016185 3300049579 Bacteria 5850
261 Ga0501046_0000543 3300049580 Bacteria 37452
262 Ga0501046_0001442 3300049580 Bacteria 22869
263 Ga0501046_0232627 3300049580 Bacteria 1361
264 Ga0501047_0033182 3300049581 Bacteria 4983
265 Ga0501047_0304321 3300049581 Bacteria 1436
266 Ga0501048_0000747 3300049582 Bacteria 23809
267 Ga0501048_0011032 3300049582 Bacteria 6739
268 Ga0501048_0011286 3300049582 Bacteria 6661
269 Ga0501048_0031464 3300049582 Bacteria 3838
270 Ga0501048_0341138 3300049582 Bacteria 1068
271 Ga0501068_0012620 3300049584 Bacteria 4794
272 Ga0501068_0018836 3300049584 Bacteria 4000
273 Ga0501068_0024154 3300049584 Bacteria 3568
274 Ga0501069_0015991 3300049585 Bacteria 4024
275 Ga0501069_0056324 3300049585 Bacteria 2190
276 Ga0501069_0075129 3300049585 Bacteria 1898
277 Ga0501071_0002975 3300049587 Bacteria 10474
278 Ga0501071_0003324 3300049587 Bacteria 10044
279 Ga0501071_0010537 3300049587 Bacteria 6200
280 Ga0501071_0031540 3300049587 Bacteria 3757
281 Ga0501072_0000148 3300049588 Bacteria 52735
282 Ga0501072_0003657 3300049588 Bacteria 11584
283 Ga0501072_0009556 3300049588 Bacteria 7375
284 Ga0501072_0237555 3300049588 Bacteria 1451
285 Ga0501072_0314269 3300049588 Bacteria 1245
286 Ga0501072_0352389 3300049588 Unclassified 1169
287 Ga0501073_0081931 3300049589 Bacteria 2244
288 Ga0501074_0001950 3300049590 Bacteria 14194
289 Ga0501074_0007375 3300049590 Bacteria 7951
290 Ga0501074_0011374 3300049590 Bacteria 6470
291 Ga0501075_0003058 3300049591 Bacteria 11185
292 Ga0501075_0005643 3300049591 Bacteria 8562
293 Ga0501076_0000190 3300049592 Bacteria 36750
294 Ga0501076_0003076 3300049592 Bacteria 11616
295 Ga0501076_0008031 3300049592 Bacteria 7710
296 Ga0501076_0038904 3300049592 Bacteria 3733
297 Ga0501077_0000197 3300049593 Bacteria 34793
298 Ga0501077_0000993 3300049593 Bacteria 17082
299 Ga0501077_0135029 3300049593 Bacteria 1565
300 Ga0501077_0248129 3300049593 Bacteria 1132
301 Ga0501216_016640 3300049660 Bacteria 1250
302 Ga0501217_015812 3300049661 Bacteria 1723
303 Ga0501079_0001144 3300049741 Bacteria 18538
304 Ga0501079_0049940 3300049741 Bacteria 3229
305 Ga0501079_0076571 3300049741 Bacteria 2588
306 Ga0501080_0007733 3300049742 Bacteria 9718
307 Ga0501080_0042451 3300049742 Bacteria 4234
308 Ga0501081_0004102 3300049743 Bacteria 9332
309 Ga0501081_0010859 3300049743 Bacteria 5951
310 Ga0501081_0092571 3300049743 Bacteria 2127
311 Ga0501081_0122848 3300049743 Bacteria 1851
312 Ga0501035_0010171 3300049822 Bacteria 8731
313 Ga0501035_0078963 3300049822 Bacteria 2907
314 Ga0501035_0189762 3300049822 Bacteria 1767
315 Ga0501044_0044366 3300049823 Bacteria 4613
316 Ga0501044_0145007 3300049823 Bacteria 2361
317 Ga0501045_0001291 3300049824 Bacteria 16607
318 Ga0501045_0001988 3300049824 Bacteria 13799
319 Ga0501045_0016579 3300049824 Bacteria 5235
320 Ga0501045_0093463 3300049824 Bacteria 2224
321 nmdc:mga05p37_178_c1 3300050507 Bacteria 62028
322 nmdc:mga05p37_22251_c1 3300050507 Bacteria 7686
323 nmdc:mga05p37_332727_c1 3300050507 Bacteria 1793
324 nmdc:mga05p37_983951_c1 3300050507 Bacteria 898
325 nmdc:mga09592_14_c2 3300050508 Bacteria 34534
326 nmdc:mga09592_40872_c1 3300050508 Bacteria 3897
327 nmdc:mga0qj67_1167_c1 3300050509 Bacteria 18189
328 nmdc:mga0qj67_1435_c1 3300050509 Bacteria 16696
329 nmdc:mga0qj67_21152_c1 3300050509 Bacteria 4989
330 nmdc:mga06r32_141946_c1 3300050510 Bacteria 2378
331 nmdc:mga06r32_18_c1 3300050510 Bacteria 34210
332 nmdc:mga06r32_44_c8 3300050510 Bacteria 1424
333 nmdc:mga06r32_5280_c1 3300050510 Bacteria 11621
334 nmdc:mga06r32_67284_c1 3300050510 Bacteria 3458
335 nmdc:mga06r32_81300_c1 3300050510 Bacteria 3156
336 nmdc:mga06r32_865027_c1 3300050510 Bacteria 862
337 nmdc:mga06r32_93112_c1 3300050510 Bacteria 2947
338 nmdc:mga08y16_41810_c1 3300050511 Bacteria 4801
339 Ga0501084_0002454 3300054114 Bacteria 14927
340 Ga0501084_0012988 3300054114 Bacteria 6892
341 Ga0501084_0019366 3300054114 Bacteria 5669
342 Ga0590071_012936 3300059421 Bacteria 1955
343 Ga0590075_001142 3300059424 Bacteria 6739
344 Ga0590077_014093 3300059426 Bacteria 1664
345 Ga0501082_0000269 3300060353 Bacteria 45868
346 Ga0501082_0001302 3300060353 Bacteria 21896
347 Ga0501082_0460811 3300060353 Bacteria 1111
348 Ga0530510_0000196 3300061734 Bacteria 37449
349 Ga0530510_0002609 3300061734 Bacteria 12394
350 Ga0530510_0003306 3300061734 Bacteria 11094
351 Ga0530510_0058555 3300061734 Bacteria 2786

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050510 nmdc:mga06r32_865027_c1 nmdc:mga06r32_865027_c1_12_845 273
2 3300005334 Ga0068869_100115555 Ga0068869_1001155552 278
3 3300005981 Ga0081538_10012651 Ga0081538_100126513 278
4 3300050507 nmdc:mga05p37_983951_c1 nmdc:mga05p37_983951_c1_23_886 278
5 3300050510 nmdc:mga06r32_93112_c1 nmdc:mga06r32_93112_c1_2071_2934 278
6 3300031548 Ga0307408_100037442 Ga0307408_1000374422 280
7 3300042439 Ga0439464_0038690 Ga0439464_0038690_469_1311 280
8 3300042461 Ga0439460_0101363 Ga0439460_0101363_44_886 280
9 3300049660 Ga0501216_016640 Ga0501216_016640_125_967 280
10 3300049661 Ga0501217_015812 Ga0501217_015812_295_1137 280
11 3300005981 Ga0081538_10023235 Ga0081538_100232353 283
12 3300042009 Ga0439451_042267 Ga0439451_042267_44_898 284
13 3300042126 Ga0450888_003295 Ga0450888_003295_18_872 284
14 3300003373 JGI25407J50210_10000771 JGI25407J50210_100007715 285
15 3300005981 Ga0081538_10000203 Ga0081538_1000020312 285
16 3300037466 Ga0395898_0426036 Ga0395898_0426036_66_923 285
17 3300049571 Ga0501034_0003568 Ga0501034_0003568_6419_7336 285
18 3300049572 Ga0501036_0007044 Ga0501036_0007044_6971_7888 285
19 3300049573 Ga0501037_0077663 Ga0501037_0077663_958_1875 285
20 3300049574 Ga0501038_0021833 Ga0501038_0021833_1787_2704 285
21 3300049578 Ga0501042_0030810 Ga0501042_0030810_216_1133 285
22 3300049579 Ga0501043_0015475 Ga0501043_0015475_1306_2223 285
23 3300049581 Ga0501047_0033182 Ga0501047_0033182_530_1447 285
24 3300049582 Ga0501048_0011032 Ga0501048_0011032_1941_2858 285
25 3300049589 Ga0501073_0081931 Ga0501073_0081931_187_1104 285
26 3300049590 Ga0501074_0001950 Ga0501074_0001950_12168_13085 285
27 3300049823 Ga0501044_0044366 Ga0501044_0044366_2755_3672 285
28 3300050510 nmdc:mga06r32_44_c8 nmdc:mga06r32_44_c8_406_1386 288
29 3300009147 Ga0114129_10496186 Ga0114129_104961862 291
30 3300050507 nmdc:mga05p37_332727_c1 nmdc:mga05p37_332727_c1_576_1514 291
31 3300044901 Ga0466960_0007323 Ga0466960_0007323_580_1482 292
32 3300050509 nmdc:mga0qj67_1435_c1 nmdc:mga0qj67_1435_c1_6258_7166 292
33 3300006844 Ga0075428_100006070 Ga0075428_1000060706 293
34 3300006846 Ga0075430_100001764 Ga0075430_1000017646 293
35 3300006847 Ga0075431_100015849 Ga0075431_1000158496 293
36 3300006880 Ga0075429_100001818 Ga0075429_1000018186 293
37 3300009147 Ga0114129_10000050 Ga0114129_1000005046 293
38 3300050507 nmdc:mga05p37_178_c1 nmdc:mga05p37_178_c1_26531_27442 293
39 3300050508 nmdc:mga09592_14_c2 nmdc:mga09592_14_c2_19916_20827 293
40 3300050509 nmdc:mga0qj67_1167_c1 nmdc:mga0qj67_1167_c1_3798_4709 293
41 3300050510 nmdc:mga06r32_18_c1 nmdc:mga06r32_18_c1_13382_14293 293
42 3300006847 Ga0075431_100052327 Ga0075431_1000523274 294
43 3300006847 Ga0075431_100157083 Ga0075431_1001570833 294
44 3300050510 nmdc:mga06r32_141946_c1 nmdc:mga06r32_141946_c1_436_1350 294
45 3300005981 Ga0081538_10000316 Ga0081538_1000031619 295
46 3300003373 JGI25407J50210_10001192 JGI25407J50210_100011922 296
47 3300005441 Ga0070700_100255628 Ga0070700_1002556281 296
48 3300005617 Ga0068859_100775391 Ga0068859_1007753912 296
49 3300006844 Ga0075428_100000495 Ga0075428_10000049514 296
50 3300006931 Ga0097620_100775335 Ga0097620_1007753352 296
51 3300049593 Ga0501077_0248129 Ga0501077_0248129_171_1067 296
52 3300030731 Ga0316177_1027862 Ga0316177_10278622 297
53 3300006844 Ga0075428_100560289 Ga0075428_1005602892 298
54 3300006847 Ga0075431_100531998 Ga0075431_1005319982 298
55 3300005471 Ga0070698_100192093 Ga0070698_1001920932 299
56 3300006847 Ga0075431_100068710 Ga0075431_1000687102 299
57 3300038443 Ga0395901_0704705 Ga0395901_0704705_74_982 299
58 3300042003 Ga0439443_007891 Ga0439443_007891_120_1073 299
59 3300049588 Ga0501072_0237555 Ga0501072_0237555_479_1387 299
60 3300059426 Ga0590077_014093 Ga0590077_014093_333_1235 299
61 3300003373 JGI25407J50210_10003086 JGI25407J50210_100030866 300
62 3300005981 Ga0081538_10005035 Ga0081538_100050357 300
63 3300005981 Ga0081538_10019523 Ga0081538_100195233 300
64 3300005981 Ga0081538_10148309 Ga0081538_101483091 300
65 3300006844 Ga0075428_100328315 Ga0075428_1003283152 300
66 3300006846 Ga0075430_100006111 Ga0075430_1000061112 300
67 3300006847 Ga0075431_100099409 Ga0075431_1000994093 300
68 3300006880 Ga0075429_100030614 Ga0075429_1000306145 300
69 3300009147 Ga0114129_10043613 Ga0114129_100436136 300
70 3300031731 Ga0307405_10012350 Ga0307405_100123502 300
71 3300031852 Ga0307410_10005394 Ga0307410_100053943 300
72 3300031852 Ga0307410_10020427 Ga0307410_100204273 300
73 3300031901 Ga0307406_10029033 Ga0307406_100290334 300
74 3300031903 Ga0307407_10143552 Ga0307407_101435522 300
75 3300031911 Ga0307412_10016031 Ga0307412_100160313 300
76 3300031995 Ga0307409_100055238 Ga0307409_1000552383 300
77 3300032002 Ga0307416_100003289 Ga0307416_1000032896 300
78 3300049568 Ga0501031_0226032 Ga0501031_0226032_93_998 300
79 3300049578 Ga0501042_0320266 Ga0501042_0320266_178_1083 300
80 3300049582 Ga0501048_0341138 Ga0501048_0341138_80_985 300
81 3300049588 Ga0501072_0314269 Ga0501072_0314269_279_1184 300
82 3300049593 Ga0501077_0135029 Ga0501077_0135029_109_1014 300
83 3300050507 nmdc:mga05p37_22251_c1 nmdc:mga05p37_22251_c1_4527_5459 300
84 3300050508 nmdc:mga09592_40872_c1 nmdc:mga09592_40872_c1_2394_3326 300
85 3300050509 nmdc:mga0qj67_21152_c1 nmdc:mga0qj67_21152_c1_113_1045 300
86 3300050510 nmdc:mga06r32_81300_c1 nmdc:mga06r32_81300_c1_515_1447 300
87 3300060353 Ga0501082_0460811 Ga0501082_0460811_148_1053 300
88 3300049823 Ga0501044_0145007 Ga0501044_0145007_1395_2312 301
89 3300032002 Ga0307416_100472367 Ga0307416_1004723672 302
90 3300032126 Ga0307415_100191476 Ga0307415_1001914762 302
91 3300032126 Ga0307415_100465722 Ga0307415_1004657222 302
92 3300049569 Ga0501032_0045557 Ga0501032_0045557_707_1618 302
93 3300049572 Ga0501036_0005938 Ga0501036_0005938_7766_8677 302
94 3300049574 Ga0501038_0026502 Ga0501038_0026502_2914_3825 302
95 3300049575 Ga0501039_0036573 Ga0501039_0036573_26_937 302
96 3300049576 Ga0501040_0062759 Ga0501040_0062759_1606_2517 302
97 3300049578 Ga0501042_0077619 Ga0501042_0077619_47_958 302
98 3300049582 Ga0501048_0031464 Ga0501048_0031464_1461_2372 302
99 3300049585 Ga0501069_0056324 Ga0501069_0056324_222_1133 302
100 3300049587 Ga0501071_0002975 Ga0501071_0002975_7212_8123 302
101 3300049592 Ga0501076_0038904 Ga0501076_0038904_2601_3512 302
102 3300049743 Ga0501081_0122848 Ga0501081_0122848_222_1133 302
103 3300049822 Ga0501035_0078963 Ga0501035_0078963_1137_2048 302
104 3300049824 Ga0501045_0016579 Ga0501045_0016579_1296_2207 302
105 3300061734 Ga0530510_0058555 Ga0530510_0058555_1487_2398 302
106 3300005981 Ga0081538_10118972 Ga0081538_101189721 303
107 3300005981 Ga0081538_10003705 Ga0081538_100037058 304
108 3300031548 Ga0307408_100045830 Ga0307408_1000458302 306
109 3300031901 Ga0307406_10256429 Ga0307406_102564292 306
110 3300031903 Ga0307407_10034969 Ga0307407_100349692 306
111 3300031911 Ga0307412_10046267 Ga0307412_100462673 306
112 3300031995 Ga0307409_100000843 Ga0307409_10000084312 306
113 3300032126 Ga0307415_100000059 Ga0307415_10000005940 306
114 3300031824 Ga0307413_10000511 Ga0307413_100005118 307
115 3300032126 Ga0307415_100093558 Ga0307415_1000935582 307
116 3300037312 Ga0395899_0082711 Ga0395899_0082711_136_1107 307
117 3300037466 Ga0395898_0059569 Ga0395898_0059569_1282_2253 307
118 3300038443 Ga0395901_0036287 Ga0395901_0036287_2773_3744 307
119 3300006846 Ga0075430_100000695 Ga0075430_10000069518 308
120 3300025940 Ga0207691_10361725 Ga0207691_103617252 308
121 3300031901 Ga0307406_10241046 Ga0307406_102410461 308
122 3300032002 Ga0307416_100449897 Ga0307416_1004498972 308
123 3300037418 Ga0395900_0152952 Ga0395900_0152952_179_1117 308
124 3300003373 JGI25407J50210_10000847 JGI25407J50210_100008474 309
125 3300005327 Ga0070658_10003819 Ga0070658_1000381910 309
126 3300005329 Ga0070683_100170644 Ga0070683_1001706442 309
127 3300005336 Ga0070680_100003683 Ga0070680_1000036834 309
128 3300005338 Ga0068868_100010475 Ga0068868_1000104755 309
129 3300005339 Ga0070660_100133768 Ga0070660_1001337682 309
130 3300005344 Ga0070661_100356241 Ga0070661_1003562411 309
131 3300005345 Ga0070692_10167228 Ga0070692_101672282 309
132 3300005354 Ga0070675_100420166 Ga0070675_1004201661 309
133 3300005366 Ga0070659_100255227 Ga0070659_1002552271 309
134 3300005441 Ga0070700_100002498 Ga0070700_1000024987 309
135 3300005455 Ga0070663_100015627 Ga0070663_1000156275 309
136 3300005457 Ga0070662_100174047 Ga0070662_1001740472 309
137 3300005458 Ga0070681_10005071 Ga0070681_100050716 309
138 3300005530 Ga0070679_100039924 Ga0070679_1000399244 309
139 3300005535 Ga0070684_100094104 Ga0070684_1000941042 309
140 3300005543 Ga0070672_100345232 Ga0070672_1003452321 309
141 3300005546 Ga0070696_100001658 Ga0070696_1000016589 309
142 3300005564 Ga0070664_100006380 Ga0070664_1000063808 309
143 3300005577 Ga0068857_100443375 Ga0068857_1004433751 309
144 3300005616 Ga0068852_100068581 Ga0068852_1000685813 309
145 3300005719 Ga0068861_100168404 Ga0068861_1001684042 309
146 3300005844 Ga0068862_100097229 Ga0068862_1000972292 309
147 3300005981 Ga0081538_10000164 Ga0081538_1000016476 309
148 3300005981 Ga0081538_10001716 Ga0081538_100017163 309
149 3300009094 Ga0111539_10005610 Ga0111539_1000561012 309
150 3300009098 Ga0105245_10403881 Ga0105245_104038812 309
151 3300009148 Ga0105243_10085171 Ga0105243_100851713 309
152 3300009553 Ga0105249_10354994 Ga0105249_103549941 309
153 3300011119 Ga0105246_10347370 Ga0105246_103473701 309
154 3300013105 Ga0157369_10111229 Ga0157369_101112292 309
155 3300013308 Ga0157375_10180780 Ga0157375_101807802 309
156 3300013308 Ga0157375_10353288 Ga0157375_103532882 309
157 3300014745 Ga0157377_10007784 Ga0157377_100077844 309
158 3300025901 Ga0207688_10020730 Ga0207688_100207303 309
159 3300025909 Ga0207705_10003412 Ga0207705_100034124 309
160 3300025912 Ga0207707_10002296 Ga0207707_1000229612 309
161 3300025917 Ga0207660_10002740 Ga0207660_100027408 309
162 3300025919 Ga0207657_10129328 Ga0207657_101293282 309
163 3300025920 Ga0207649_10269299 Ga0207649_102692991 309
164 3300025921 Ga0207652_10001970 Ga0207652_100019706 309
165 3300025925 Ga0207650_10360206 Ga0207650_103602062 309
166 3300025926 Ga0207659_10004131 Ga0207659_100041317 309
167 3300025933 Ga0207706_10064697 Ga0207706_100646972 309
168 3300025935 Ga0207709_10103130 Ga0207709_101031301 309
169 3300025942 Ga0207689_10012598 Ga0207689_100125982 309
170 3300025944 Ga0207661_10162509 Ga0207661_101625092 309
171 3300025944 Ga0207661_10504161 Ga0207661_105041611 309
172 3300025945 Ga0207679_10273239 Ga0207679_102732391 309
173 3300025960 Ga0207651_10306364 Ga0207651_103063642 309
174 3300025961 Ga0207712_10051913 Ga0207712_100519132 309
175 3300025972 Ga0207668_10329725 Ga0207668_103297251 309
176 3300026023 Ga0207677_10361517 Ga0207677_103615171 309
177 3300026067 Ga0207678_10004729 Ga0207678_100047299 309
178 3300026075 Ga0207708_10002684 Ga0207708_100026845 309
179 3300026116 Ga0207674_10404615 Ga0207674_104046152 309
180 3300026118 Ga0207675_100048288 Ga0207675_1000482882 309
181 3300026142 Ga0207698_10011776 Ga0207698_100117762 309
182 3300027907 Ga0207428_10059702 Ga0207428_100597023 309
183 3300028380 Ga0268265_10033592 Ga0268265_100335923 309
184 3300031903 Ga0307407_10062733 Ga0307407_100627332 309
185 3300032002 Ga0307416_100090828 Ga0307416_1000908282 309
186 3300032002 Ga0307416_100245115 Ga0307416_1002451152 309
187 3300032005 Ga0307411_10492090 Ga0307411_104920902 309
188 3300032126 Ga0307415_100055333 Ga0307415_1000553333 309
189 3300032126 Ga0307415_100148621 Ga0307415_1001486212 309
190 3300037418 Ga0395900_0035337 Ga0395900_0035337_1332_2300 309
191 3300037466 Ga0395898_0032368 Ga0395898_0032368_3120_4088 309
192 3300038443 Ga0395901_0015556 Ga0395901_0015556_748_1686 309
193 3300038443 Ga0395901_0128957 Ga0395901_0128957_1398_2366 309
194 3300050510 nmdc:mga06r32_67284_c1 nmdc:mga06r32_67284_c1_1293_2261 309
195 3300050511 nmdc:mga08y16_41810_c1 nmdc:mga08y16_41810_c1_3740_4741 309
196 3300042011 Ga0439454_008996 Ga0439454_008996_73_1005 310
197 3300049577 Ga0501041_0110088 Ga0501041_0110088_42_1016 310
198 iso_pu_bacteria 2816332139 2816504742 310
199 3300003203 JGI25406J46586_10012649 JGI25406J46586_100126492 311
200 3300005937 Ga0081455_10002855 Ga0081455_1000285517 311
201 3300005937 Ga0081455_10006806 Ga0081455_100068063 311
202 3300005937 Ga0081455_10036750 Ga0081455_100367502 311
203 3300005937 Ga0081455_10044405 Ga0081455_100444052 311
204 3300005937 Ga0081455_10102323 Ga0081455_101023233 311
205 3300005981 Ga0081538_10000388 Ga0081538_1000038829 311
206 3300005981 Ga0081538_10001647 Ga0081538_100016472 311
207 3300005981 Ga0081538_10002791 Ga0081538_100027912 311
208 3300005981 Ga0081538_10019775 Ga0081538_100197752 311
209 3300005981 Ga0081538_10025342 Ga0081538_100253424 311
210 3300005981 Ga0081538_10060698 Ga0081538_100606982 311
211 3300005981 Ga0081538_10115147 Ga0081538_101151472 311
212 3300005985 Ga0081539_10004320 Ga0081539_100043206 311
213 3300005985 Ga0081539_10072569 Ga0081539_100725692 311
214 3300006847 Ga0075431_100004428 Ga0075431_1000044288 311
215 3300031548 Ga0307408_100003779 Ga0307408_1000037794 311
216 3300031548 Ga0307408_100054433 Ga0307408_1000544333 311
217 3300031731 Ga0307405_10003601 Ga0307405_100036018 311
218 3300031731 Ga0307405_10016970 Ga0307405_100169703 311
219 3300031731 Ga0307405_10103445 Ga0307405_101034452 311
220 3300031824 Ga0307413_10044923 Ga0307413_100449233 311
221 3300031852 Ga0307410_10000179 Ga0307410_100001798 311
222 3300031852 Ga0307410_10008772 Ga0307410_100087724 311
223 3300031901 Ga0307406_10000019 Ga0307406_1000001985 311
224 3300031901 Ga0307406_10009384 Ga0307406_100093845 311
225 3300031901 Ga0307406_10049677 Ga0307406_100496772 311
226 3300031901 Ga0307406_10096262 Ga0307406_100962622 311
227 3300031903 Ga0307407_10001238 Ga0307407_100012382 311
228 3300031903 Ga0307407_10006527 Ga0307407_100065275 311
229 3300031903 Ga0307407_10012590 Ga0307407_100125903 311
230 3300031911 Ga0307412_10003044 Ga0307412_100030447 311
231 3300031911 Ga0307412_10026828 Ga0307412_100268284 311
232 3300031911 Ga0307412_10032946 Ga0307412_100329462 311
233 3300031911 Ga0307412_10036388 Ga0307412_100363883 311
234 3300031911 Ga0307412_10047663 Ga0307412_100476632 311
235 3300031995 Ga0307409_100002245 Ga0307409_10000224512 311
236 3300031995 Ga0307409_100003610 Ga0307409_1000036107 311
237 3300031995 Ga0307409_100011006 Ga0307409_1000110062 311
238 3300031995 Ga0307409_100160315 Ga0307409_1001603152 311
239 3300031995 Ga0307409_100407002 Ga0307409_1004070022 311
240 3300032002 Ga0307416_100000040 Ga0307416_10000004024 311
241 3300032002 Ga0307416_100004304 Ga0307416_1000043049 311
242 3300032002 Ga0307416_100021380 Ga0307416_1000213803 311
243 3300032002 Ga0307416_100068660 Ga0307416_1000686603 311
244 3300032002 Ga0307416_100264632 Ga0307416_1002646322 311
245 3300032004 Ga0307414_10001028 Ga0307414_100010285 311
246 3300032004 Ga0307414_10035261 Ga0307414_100352613 311
247 3300032004 Ga0307414_10039968 Ga0307414_100399683 311
248 3300032004 Ga0307414_10102979 Ga0307414_101029792 311
249 3300032005 Ga0307411_10004200 Ga0307411_100042005 311
250 3300032005 Ga0307411_10067190 Ga0307411_100671903 311
251 3300032126 Ga0307415_100000218 Ga0307415_10000021827 311
252 3300032126 Ga0307415_100000730 Ga0307415_10000073011 311
253 3300032126 Ga0307415_100010092 Ga0307415_1000100923 311
254 3300032126 Ga0307415_100023237 Ga0307415_1000232372 311
255 3300032126 Ga0307415_100065700 Ga0307415_1000657002 311
256 3300032126 Ga0307415_100091390 Ga0307415_1000913902 311
257 3300037418 Ga0395900_0123620 Ga0395900_0123620_1576_2514 311
258 3300037418 Ga0395900_0149464 Ga0395900_0149464_681_1619 311
259 3300037466 Ga0395898_0004907 Ga0395898_0004907_4433_5374 311
260 3300037471 Ga0395905_0417060 Ga0395905_0417060_224_1162 311
261 3300038443 Ga0395901_0103754 Ga0395901_0103754_1109_2047 311
262 3300038443 Ga0395901_0176762 Ga0395901_0176762_326_1264 311
263 3300042004 Ga0439445_0004546 Ga0439445_0004546_883_1818 311
264 3300042005 Ga0439448_0005152 Ga0439448_0005152_1680_2633 311
265 3300042008 Ga0439450_004686 Ga0439450_004686_847_1800 311
266 3300042016 Ga0439463_000556 Ga0439463_000556_8747_9700 311
267 3300042016 Ga0439463_002121 Ga0439463_002121_4090_5028 311
268 3300042016 Ga0439463_003292 Ga0439463_003292_2664_3599 311
269 3300042134 Ga0450898_003909 Ga0450898_003909_720_1655 311
270 3300042136 Ga0450900_001864 Ga0450900_001864_134_1069 311
271 3300042137 Ga0450902_008365 Ga0450902_008365_587_1522 311
272 3300042993 Ga0439440_0000162 Ga0439440_0000162_8495_9430 311
273 3300042993 Ga0439440_0001062 Ga0439440_0001062_689_1642 311
274 3300046500 Ga0495596_0076834 Ga0495596_0076834_284_1237 311
275 3300049568 Ga0501031_0000772 Ga0501031_0000772_14419_15357 311
276 3300049568 Ga0501031_0010086 Ga0501031_0010086_3850_4785 311
277 3300049568 Ga0501031_0011843 Ga0501031_0011843_333_1280 311
278 3300049569 Ga0501032_0012146 Ga0501032_0012146_3388_4326 311
279 3300049570 Ga0501033_0006747 Ga0501033_0006747_865_1800 311
280 3300049570 Ga0501033_0031739 Ga0501033_0031739_307_1245 311
281 3300049571 Ga0501034_0232755 Ga0501034_0232755_416_1354 311
282 3300049572 Ga0501036_0000320 Ga0501036_0000320_3878_4816 311
283 3300049572 Ga0501036_0002562 Ga0501036_0002562_1991_2926 311
284 3300049572 Ga0501036_0057440 Ga0501036_0057440_2023_2970 311
285 3300049573 Ga0501037_0044423 Ga0501037_0044423_865_1800 311
286 3300049573 Ga0501037_0044870 Ga0501037_0044870_575_1513 311
287 3300049573 Ga0501037_0126657 Ga0501037_0126657_102_1049 311
288 3300049574 Ga0501038_0001185 Ga0501038_0001185_16215_17153 311
289 3300049574 Ga0501038_0018963 Ga0501038_0018963_2952_3887 311
290 3300049575 Ga0501039_0000898 Ga0501039_0000898_10104_11039 311
291 3300049575 Ga0501039_0003106 Ga0501039_0003106_7381_8319 311
292 3300049575 Ga0501039_0043475 Ga0501039_0043475_2318_3265 311
293 3300049576 Ga0501040_0000011 Ga0501040_0000011_16590_17528 311
294 3300049576 Ga0501040_0000977 Ga0501040_0000977_5398_6333 311
295 3300049576 Ga0501040_0003801 Ga0501040_0003801_4585_5532 311
296 3300049577 Ga0501041_0001655 Ga0501041_0001655_652_1587 311
297 3300049577 Ga0501041_0007009 Ga0501041_0007009_1245_2192 311
298 3300049578 Ga0501042_0000397 Ga0501042_0000397_4636_5574 311
299 3300049578 Ga0501042_0000964 Ga0501042_0000964_10142_11077 311
300 3300049578 Ga0501042_0014458 Ga0501042_0014458_4260_5207 311
301 3300049579 Ga0501043_0016185 Ga0501043_0016185_4696_5631 311
302 3300049580 Ga0501046_0000543 Ga0501046_0000543_26585_27523 311
303 3300049580 Ga0501046_0001442 Ga0501046_0001442_11640_12575 311
304 3300049580 Ga0501046_0232627 Ga0501046_0232627_102_1049 311
305 3300049581 Ga0501047_0304321 Ga0501047_0304321_451_1386 311
306 3300049582 Ga0501048_0000747 Ga0501048_0000747_16344_17282 311
307 3300049582 Ga0501048_0011286 Ga0501048_0011286_3890_4825 311
308 3300049584 Ga0501068_0012620 Ga0501068_0012620_407_1345 311
309 3300049584 Ga0501068_0018836 Ga0501068_0018836_2206_3141 311
310 3300049584 Ga0501068_0024154 Ga0501068_0024154_1413_2360 311
311 3300049585 Ga0501069_0015991 Ga0501069_0015991_2250_3185 311
312 3300049585 Ga0501069_0075129 Ga0501069_0075129_418_1365 311
313 3300049587 Ga0501071_0003324 Ga0501071_0003324_216_1151 311
314 3300049587 Ga0501071_0010537 Ga0501071_0010537_903_1850 311
315 3300049587 Ga0501071_0031540 Ga0501071_0031540_1836_2774 311
316 3300049588 Ga0501072_0000148 Ga0501072_0000148_2298_3236 311
317 3300049588 Ga0501072_0003657 Ga0501072_0003657_974_1909 311
318 3300049588 Ga0501072_0009556 Ga0501072_0009556_2022_2969 311
319 3300049588 Ga0501072_0352389 Ga0501072_0352389_131_1102 311
320 3300049590 Ga0501074_0007375 Ga0501074_0007375_2846_3781 311
321 3300049590 Ga0501074_0011374 Ga0501074_0011374_2612_3559 311
322 3300049591 Ga0501075_0003058 Ga0501075_0003058_1391_2326 311
323 3300049591 Ga0501075_0005643 Ga0501075_0005643_2805_3743 311
324 3300049592 Ga0501076_0000190 Ga0501076_0000190_24287_25225 311
325 3300049592 Ga0501076_0003076 Ga0501076_0003076_10649_11584 311
326 3300049592 Ga0501076_0008031 Ga0501076_0008031_2802_3749 311
327 3300049593 Ga0501077_0000197 Ga0501077_0000197_18428_19366 311
328 3300049593 Ga0501077_0000993 Ga0501077_0000993_7097_8032 311
329 3300049741 Ga0501079_0001144 Ga0501079_0001144_10073_11008 311
330 3300049741 Ga0501079_0049940 Ga0501079_0049940_1338_2285 311
331 3300049741 Ga0501079_0076571 Ga0501079_0076571_738_1676 311
332 3300049742 Ga0501080_0007733 Ga0501080_0007733_5457_6395 311
333 3300049742 Ga0501080_0042451 Ga0501080_0042451_1408_2343 311
334 3300049743 Ga0501081_0004102 Ga0501081_0004102_1803_2738 311
335 3300049743 Ga0501081_0010859 Ga0501081_0010859_1900_2838 311
336 3300049743 Ga0501081_0092571 Ga0501081_0092571_249_1196 311
337 3300049822 Ga0501035_0010171 Ga0501035_0010171_863_1798 311
338 3300049822 Ga0501035_0189762 Ga0501035_0189762_447_1394 311
339 3300049824 Ga0501045_0001291 Ga0501045_0001291_3890_4828 311
340 3300049824 Ga0501045_0001988 Ga0501045_0001988_8285_9220 311
341 3300049824 Ga0501045_0093463 Ga0501045_0093463_964_1911 311
342 3300050510 nmdc:mga06r32_5280_c1 nmdc:mga06r32_5280_c1_3759_4703 311
343 3300054114 Ga0501084_0002454 Ga0501084_0002454_4017_4952 311
344 3300054114 Ga0501084_0012988 Ga0501084_0012988_1568_2506 311
345 3300054114 Ga0501084_0019366 Ga0501084_0019366_1338_2285 311
346 3300059421 Ga0590071_012936 Ga0590071_012936_369_1307 311
347 3300059424 Ga0590075_001142 Ga0590075_001142_1862_2797 311
348 3300060353 Ga0501082_0000269 Ga0501082_0000269_10383_11318 311
349 3300060353 Ga0501082_0001302 Ga0501082_0001302_16293_17231 311
350 3300061734 Ga0530510_0000196 Ga0530510_0000196_5051_5989 311
351 3300061734 Ga0530510_0002609 Ga0530510_0002609_1466_2413 311
352 3300061734 Ga0530510_0003306 Ga0530510_0003306_1857_2792 311
353 iso_pu_bacteria 3002998708 3003005493 311

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

108

332

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8638 25 304
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.8579 25 305
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8534 25 304
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8496 25 304
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8464 25 305
ID Description Score Start End Superfamily
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8635 67 309 1.10.3720.10
af_P0AFR7_53_289_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8509 67 306 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8507 67 309 1.10.3720.10
af_P10905_52_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8469 67 308 1.10.3720.10
af_I6XFF3_60_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8464 67 309 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7Y9EMB7-F1-model_v4 ABC-type sugar transport system permease subunit 0.8917 33 306 GO:0005886
GO:0055085
AF-A0A081D0S7-F1-model_v4 Putative ABC transporter permease protein 0.8903 31 306 GO:0005886
GO:0055085
AF-A0A4Q2LXS6-F1-model_v4 Sugar ABC transporter permease 0.8892 20 305 GO:0005886
GO:0055085
AF-A0A7C6DPG6-F1-model_v4 Sugar ABC transporter permease 0.8885 24 308 GO:0005886
GO:0055085
AF-A0A368WNQ2-F1-model_v4 Carbohydrate ABC transporter membrane protein 1 (CUT1 family) 0.8869 19 309 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
76.78 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map