F419346

General Info

Members Datasets Scaffolds Average Seq Length
353 208 353 139

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_101084613|Ga0075430_1010846132
Length 165
Sequence MTDSFFSRPQGQKKRALARFFHEDGDMVSTIQADIEARLSEVEPAVEVLLAEIVGGRLVRLFIDHPDGVTLALCERVTNQLPEVRERYALEVSSPGADRPLTKPEHFRRFLGHRARVRTRGDHDGRRSFTGELLEAGDEAVTVAAETGVVSIAYSDIHRSNLLGD

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 1.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 8.22
Rhizosphere 89.8
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10026394 3300003203 Bacteria 2240
2 JGI25407J50210_10022735 3300003373 Bacteria 1630
3 Ga0070658_10224406 3300005327 Bacteria 1590
4 Ga0070658_10264013 3300005327 Bacteria 1463
5 Ga0070683_100749824 3300005329 Bacteria 935
6 Ga0070683_102072131 3300005329 Bacteria 546
7 Ga0070670_101628167 3300005331 Unclassified 594
8 Ga0070677_10263459 3300005333 Bacteria 861
9 Ga0068869_100186438 3300005334 Bacteria 1629
10 Ga0068869_101941206 3300005334 Bacteria 528
11 Ga0070680_101810328 3300005336 Unclassified 529
12 Ga0068868_100694862 3300005338 Bacteria 910
13 Ga0068868_101269530 3300005338 Bacteria 683
14 Ga0070660_100040758 3300005339 Bacteria 3536
15 Ga0070660_100044282 3300005339 Bacteria 3403
16 Ga0070691_10472317 3300005341 Bacteria 720
17 Ga0070661_100296062 3300005344 Bacteria 1258
18 Ga0070668_100207476 3300005347 Bacteria 1610
19 Ga0070669_100409838 3300005353 Bacteria 1110
20 Ga0070675_100404745 3300005354 Bacteria 1218
21 Ga0070671_100624632 3300005355 Bacteria 932
22 Ga0070674_100353549 3300005356 Bacteria 1187
23 Ga0070688_100354785 3300005365 Bacteria 1074
24 Ga0070659_100000052 3300005366 Bacteria 96862
25 Ga0070659_101238171 3300005366 Bacteria 661
26 Ga0070659_101844721 3300005366 Bacteria 542
27 Ga0070710_10000004 3300005437 Bacteria 270399
28 Ga0070701_10380957 3300005438 Bacteria 889
29 Ga0070701_10404679 3300005438 Bacteria 866
30 Ga0070711_100795028 3300005439 Bacteria 802
31 Ga0070705_101017837 3300005440 Bacteria 673
32 Ga0070700_100122535 3300005441 Bacteria 1744
33 Ga0070700_100290348 3300005441 Bacteria 1189
34 Ga0070678_100312397 3300005456 Bacteria 1339
35 Ga0070662_100230763 3300005457 Bacteria 1480
36 Ga0070662_100292208 3300005457 Bacteria 1321
37 Ga0070679_100250194 3300005530 Bacteria 1729
38 Ga0070679_101128406 3300005530 Bacteria 729
39 Ga0070679_101137435 3300005530 Unclassified 726
40 Ga0070684_100476118 3300005535 Bacteria 1155
41 Ga0070684_102044447 3300005535 Bacteria 541
42 Ga0070684_102060582 3300005535 Unclassified 538
43 Ga0068853_100744234 3300005539 Bacteria 937
44 Ga0068853_100963723 3300005539 Bacteria 820
45 Ga0070672_100436048 3300005543 Bacteria 1127
46 Ga0070686_100168452 3300005544 Bacteria 1547
47 Ga0070693_100560870 3300005547 Bacteria 819
48 Ga0070665_100728063 3300005548 Bacteria 1005
49 Ga0070664_100161496 3300005564 Bacteria 1983
50 Ga0070664_100835942 3300005564 Bacteria 862
51 Ga0068857_100841729 3300005577 Bacteria 877
52 Ga0068856_100293588 3300005614 Bacteria 1642
53 Ga0068852_100224391 3300005616 Bacteria 1788
54 Ga0068859_100551003 3300005617 Bacteria 1248
55 Ga0068859_102175315 3300005617 Bacteria 612
56 Ga0068864_100579495 3300005618 Bacteria 1087
57 Ga0068866_10140774 3300005718 Bacteria 1384
58 Ga0068861_100330768 3300005719 Bacteria 1330
59 Ga0068851_10335205 3300005834 Bacteria 877
60 Ga0068851_10488138 3300005834 Bacteria 737
61 Ga0068851_10502864 3300005834 Bacteria 727
62 Ga0068870_10287677 3300005840 Bacteria 1033
63 Ga0068870_10951336 3300005840 Bacteria 610
64 Ga0068870_11388517 3300005840 Bacteria 514
65 Ga0068858_100859752 3300005842 Bacteria 886
66 Ga0068858_100885229 3300005842 Bacteria 873
67 Ga0068860_100290554 3300005843 Bacteria 1599
68 Ga0068860_101775211 3300005843 Unclassified 639
69 Ga0081455_10220031 3300005937 Bacteria 1408
70 Ga0081455_10234298 3300005937 Unclassified 1353
71 Ga0081455_10440674 3300005937 Bacteria 893
72 Ga0081538_10004147 3300005981 Bacteria 13446
73 Ga0081538_10070134 3300005981 Bacteria 1937
74 Ga0081538_10085301 3300005981 Bacteria 1660
75 Ga0081538_10087779 3300005981 Bacteria 1622
76 Ga0081538_10108792 3300005981 Bacteria 1368
77 Ga0081538_10127419 3300005981 Bacteria 1206
78 Ga0081540_1006943 3300005983 Bacteria 8160
79 Ga0081539_10001679 3300005985 Bacteria 35825
80 Ga0081539_10101555 3300005985 Bacteria 1465
81 Ga0081539_10110349 3300005985 Bacteria 1386
82 Ga0075365_10165039 3300006038 Bacteria 1545
83 Ga0075432_10113836 3300006058 Bacteria 1011
84 Ga0097621_100889733 3300006237 Bacteria 829
85 Ga0075430_100400074 3300006846 Bacteria 1133
86 Ga0075430_101084613 3300006846 Bacteria 659
87 Ga0075434_101320660 3300006871 Bacteria 732
88 Ga0075429_100792888 3300006880 Unclassified 830
89 Ga0068865_100256903 3300006881 Bacteria 1381
90 Ga0097620_100551021 3300006931 Bacteria 1248
91 Ga0097620_102175371 3300006931 Bacteria 612
92 Ga0111539_11400166 3300009094 Bacteria 811
93 Ga0105245_10891395 3300009098 Bacteria 931
94 Ga0105245_11662603 3300009098 Bacteria 690
95 Ga0105247_10529236 3300009101 Unclassified 863
96 Ga0114129_11270293 3300009147 Bacteria 914
97 Ga0114129_11577802 3300009147 Bacteria 804
98 Ga0105243_10442515 3300009148 Bacteria 1217
99 Ga0105243_10576442 3300009148 Bacteria 1079
100 Ga0105243_10755830 3300009148 Bacteria 953
101 Ga0105242_10623403 3300009176 Bacteria 1045
102 Ga0105242_11113546 3300009176 Bacteria 804
103 Ga0105238_10399243 3300009551 Bacteria 1368
104 Ga0105238_10820706 3300009551 Bacteria 946
105 Ga0105249_10919184 3300009553 Bacteria 942
106 Ga0105249_11838111 3300009553 Bacteria 678
107 Ga0105239_10879864 3300010375 Bacteria 1028
108 Ga0105246_10225191 3300011119 Bacteria 1473
109 Ga0157374_10827857 3300013296 Unclassified 942
110 Ga0163162_10804637 3300013306 Bacteria 1057
111 Ga0163162_10897032 3300013306 Unclassified 1000
112 Ga0157372_10570396 3300013307 Bacteria 1319
113 Ga0157372_10705801 3300013307 Bacteria 1174
114 Ga0157372_10834063 3300013307 Unclassified 1070
115 Ga0157372_10868007 3300013307 Bacteria 1047
116 Ga0157375_10845412 3300013308 Bacteria 1062
117 Ga0157375_10951687 3300013308 Bacteria 1000
118 Ga0163163_11285968 3300014325 Bacteria 794
119 Ga0157380_10895685 3300014326 Bacteria 913
120 Ga0157379_10643398 3300014968 Bacteria 992
121 Ga0157376_11365818 3300014969 Bacteria 739
122 Ga0163161_10444379 3300017792 Bacteria 1047
123 Ga0163161_10619896 3300017792 Bacteria 894
124 Ga0197907_10961319 3300020069 Bacteria 593
125 Ga0206349_1884914 3300020075 Bacteria 544
126 Ga0206352_10261639 3300020078 Bacteria 574
127 Ga0206354_11672298 3300020081 Bacteria 719
128 Ga0207656_10178102 3300025321 Bacteria 1019
129 Ga0207656_10308951 3300025321 Bacteria 784
130 Ga0207692_10000002 3300025898 Bacteria 453100
131 Ga0207642_10084746 3300025899 Bacteria 1549
132 Ga0207642_10774367 3300025899 Bacteria 609
133 Ga0207710_10321101 3300025900 Bacteria 785
134 Ga0207688_10170564 3300025901 Bacteria 1294
135 Ga0207645_10394821 3300025907 Bacteria 930
136 Ga0207645_10441914 3300025907 Bacteria 877
137 Ga0207643_10274383 3300025908 Bacteria 1044
138 Ga0207643_10962005 3300025908 Bacteria 553
139 Ga0207705_10214496 3300025909 Bacteria 1460
140 Ga0207705_10447265 3300025909 Bacteria 1002
141 Ga0207663_10588812 3300025916 Bacteria 873
142 Ga0207660_10402429 3300025917 Unclassified 1103
143 Ga0207660_11075811 3300025917 Bacteria 655
144 Ga0207657_10024110 3300025919 Bacteria 5649
145 Ga0207657_10055141 3300025919 Bacteria 3435
146 Ga0207657_10060940 3300025919 Bacteria 3237
147 Ga0207657_10154233 3300025919 Bacteria 1869
148 Ga0207657_10209524 3300025919 Bacteria 1565
149 Ga0207649_10789437 3300025920 Bacteria 741
150 Ga0207652_10227138 3300025921 Bacteria 1683
151 Ga0207681_10110502 3300025923 Bacteria 1999
152 Ga0207681_10419555 3300025923 Bacteria 1084
153 Ga0207650_10943338 3300025925 Bacteria 733
154 Ga0207687_11094924 3300025927 Bacteria 684
155 Ga0207664_10643347 3300025929 Bacteria 953
156 Ga0207690_10000061 3300025932 Bacteria 98910
157 Ga0207690_10089886 3300025932 Bacteria 2166
158 Ga0207706_10262563 3300025933 Bacteria 1507
159 Ga0207706_10270343 3300025933 Bacteria 1483
160 Ga0207706_10459872 3300025933 Bacteria 1100
161 Ga0207709_10504457 3300025935 Bacteria 945
162 Ga0207709_10681281 3300025935 Unclassified 821
163 Ga0207670_10616768 3300025936 Bacteria 892
164 Ga0207669_10149308 3300025937 Bacteria 1635
165 Ga0207669_10320439 3300025937 Bacteria 1186
166 Ga0207669_10350269 3300025937 Unclassified 1141
167 Ga0207704_10302688 3300025938 Bacteria 1226
168 Ga0207704_10719094 3300025938 Bacteria 828
169 Ga0207704_11586258 3300025938 Bacteria 562
170 Ga0207691_10367056 3300025940 Bacteria 1230
171 Ga0207689_10077418 3300025942 Bacteria 2734
172 Ga0207689_10746287 3300025942 Bacteria 826
173 Ga0207661_10755211 3300025944 Bacteria 895
174 Ga0207679_10200740 3300025945 Bacteria 1665
175 Ga0207679_10339174 3300025945 Bacteria 1307
176 Ga0207667_12159521 3300025949 Bacteria 514
177 Ga0207668_10092585 3300025972 Bacteria 2225
178 Ga0207640_10418691 3300025981 Bacteria 1096
179 Ga0207640_10421665 3300025981 Unclassified 1092
180 Ga0207640_11845674 3300025981 Bacteria 547
181 Ga0207677_10651640 3300026023 Bacteria 929
182 Ga0207639_10481145 3300026041 Bacteria 1131
183 Ga0207708_10141643 3300026075 Bacteria 1887
184 Ga0207708_10329371 3300026075 Bacteria 1248
185 Ga0207708_10351602 3300026075 Bacteria 1209
186 Ga0207702_10059249 3300026078 Bacteria 3261
187 Ga0207702_10433017 3300026078 Bacteria 1273
188 Ga0207702_10858728 3300026078 Bacteria 898
189 Ga0207648_10291926 3300026089 Bacteria 1460
190 Ga0207648_10560850 3300026089 Bacteria 1050
191 Ga0207676_10779164 3300026095 Unclassified 932
192 Ga0207674_10564848 3300026116 Bacteria 1099
193 Ga0207674_10781927 3300026116 Bacteria 921
194 Ga0207675_100348986 3300026118 Bacteria 1450
195 Ga0207675_100642329 3300026118 Bacteria 1067
196 Ga0207683_10546439 3300026121 Unclassified 1071
197 Ga0207683_10614791 3300026121 Bacteria 1006
198 Ga0207698_10413608 3300026142 Bacteria 1292
199 Ga0207428_11140770 3300027907 Bacteria 544
200 Ga0268266_10227446 3300028379 Bacteria 1717
201 Ga0268264_10774399 3300028381 Bacteria 957
202 Ga0307405_10833970 3300031731 Bacteria 775
203 Ga0307413_10443068 3300031824 Unclassified 1029
204 Ga0307413_10484134 3300031824 Bacteria 990
205 Ga0307413_11331200 3300031824 Bacteria 629
206 Ga0307410_10161800 3300031852 Bacteria 1678
207 Ga0307410_10512038 3300031852 Bacteria 989
208 Ga0307410_10520587 3300031852 Bacteria 981
209 Ga0307410_10556580 3300031852 Bacteria 951
210 Ga0307410_11413350 3300031852 Bacteria 611
211 Ga0307406_10393512 3300031901 Bacteria 1096
212 Ga0307406_10526444 3300031901 Bacteria 963
213 Ga0307407_10145676 3300031903 Bacteria 1533
214 Ga0307407_10368693 3300031903 Bacteria 1022
215 Ga0307407_10505000 3300031903 Bacteria 887
216 Ga0307412_11391164 3300031911 Bacteria 635
217 Ga0307409_100135717 3300031995 Bacteria 2111
218 Ga0307409_100233450 3300031995 Bacteria 1669
219 Ga0307409_100466423 3300031995 Bacteria 1222
220 Ga0307409_100650109 3300031995 Bacteria 1048
221 Ga0307409_100970256 3300031995 Unclassified 867
222 Ga0307409_101860786 3300031995 Bacteria 631
223 Ga0307409_101947336 3300031995 Unclassified 617
224 Ga0307416_100826699 3300032002 Bacteria 1023
225 Ga0307416_101538864 3300032002 Bacteria 771
226 Ga0307416_101635937 3300032002 Bacteria 749
227 Ga0307414_10567029 3300032004 Unclassified 1014
228 Ga0307411_10680627 3300032005 Bacteria 894
229 Ga0307411_11222627 3300032005 Bacteria 682
230 Ga0307415_100517135 3300032126 Bacteria 1047
231 Ga0307415_100542096 3300032126 Bacteria 1025
232 Ga0307415_100569990 3300032126 Bacteria 1002
233 Ga0307415_101573938 3300032126 Unclassified 631
234 Ga0451789_0430967 3300041443 Bacteria 752
235 Ga0451853_2383160 3300041512 Unclassified 645
236 Ga0466966_0224872 3300044684 Bacteria 1133
237 Ga0466966_0254665 3300044684 Bacteria 1057
238 Ga0466961_0273723 3300044693 Bacteria 1034
239 Ga0466963_0200374 3300044694 Bacteria 1396
240 Ga0466963_0236651 3300044694 Bacteria 1280
241 Ga0466963_0648870 3300044694 Bacteria 745
242 Ga0466964_0145414 3300044706 Bacteria 1094
243 Ga0466964_0227992 3300044706 Bacteria 908
244 Ga0466964_0372858 3300044706 Bacteria 739
245 Ga0466971_0100022 3300044719 Bacteria 1332
246 Ga0466968_0181190 3300044735 Bacteria 980
247 Ga0466957_0596649 3300044842 Bacteria 773
248 Ga0466960_0203253 3300044901 Bacteria 1083
249 Ga0466960_0219184 3300044901 Bacteria 1046
250 Ga0466960_0247665 3300044901 Bacteria 989
251 Ga0466967_0037815 3300045976 Bacteria 4134
252 Ga0466967_0113149 3300045976 Bacteria 2496
253 Ga0466967_0172982 3300045976 Bacteria 2033
254 Ga0466967_0412347 3300045976 Bacteria 1315
255 Ga0466967_0427711 3300045976 Bacteria 1291
256 Ga0466967_1366714 3300045976 Bacteria 705
257 Ga0466967_1543110 3300045976 Bacteria 661
258 Ga0495584_0532029 3300046491 Archaea 599
259 Ga0495596_0091200 3300046500 Archaea 1183
260 Ga0495596_0216543 3300046500 Bacteria 744
261 Ga0495616_0243108 3300046513 Unclassified 776
262 Ga0495631_0083031 3300046518 Bacteria 1381
263 Ga0495643_0249139 3300046522 Bacteria 830
264 Ga0495643_0254621 3300046522 Bacteria 818
265 Ga0495644_0144530 3300046523 Archaea 909
266 Ga0495656_0775232 3300046615 Bacteria 518
267 Ga0495661_0213356 3300046665 Bacteria 1004
268 Ga0495589_0087313 3300046794 Bacteria 1515
269 Ga0496100_0188762 3300048903 Bacteria 1495
270 Ga0496101_0001147 3300048904 Bacteria 15845
271 Ga0496101_0338691 3300048904 Bacteria 1181
272 Ga0496102_0041443 3300048905 Bacteria 4169
273 Ga0496103_0077029 3300048906 Bacteria 2093
274 Ga0496104_0067023 3300048907 Bacteria 3409
275 Ga0496104_0580958 3300048907 Bacteria 1031
276 Ga0496105_0062075 3300048908 Bacteria 3084
277 Ga0496106_0069479 3300048909 Bacteria 2688
278 Ga0496107_0215948 3300048910 Bacteria 1426
279 Ga0496108_0001875 3300048911 Bacteria 16829
280 Ga0496108_0364918 3300048911 Bacteria 1261
281 Ga0496108_0428295 3300048911 Bacteria 1156
282 Ga0496109_0017648 3300048912 Bacteria 6259
283 Ga0496109_0447719 3300048912 Unclassified 1220
284 Ga0496109_1792978 3300048912 Bacteria 547
285 Ga0496110_0072720 3300048913 Bacteria 3051
286 Ga0496110_0467466 3300048913 Bacteria 1149
287 Ga0496110_0468302 3300048913 Bacteria 1148
288 Ga0496111_0019588 3300048914 Bacteria 4704
289 Ga0496111_0699439 3300048914 Unclassified 737
290 Ga0496112_0011404 3300048915 Bacteria 8116
291 Ga0496113_0026837 3300048916 Bacteria 4122
292 Ga0496113_0314715 3300048916 Bacteria 1254
293 Ga0496113_0668267 3300048916 Unclassified 830
294 Ga0496113_1157722 3300048916 Bacteria 605
295 Ga0496114_0608449 3300048917 Bacteria 963
296 Ga0496115_0867997 3300048918 Bacteria 698
297 Ga0496121_0008296 3300048924 Bacteria 12286
298 Ga0496121_0696775 3300048924 Bacteria 612
299 Ga0496126_0767085 3300048929 Unclassified 743
300 Ga0501031_0331636 3300049568 Bacteria 985
301 Ga0501032_0468062 3300049569 Bacteria 807
302 Ga0501036_0234097 3300049572 Bacteria 1541
303 Ga0501036_0322132 3300049572 Bacteria 1291
304 Ga0501037_0577015 3300049573 Bacteria 757
305 Ga0501038_0622642 3300049574 Bacteria 815
306 Ga0501039_1127799 3300049575 Bacteria 607
307 Ga0501040_0134505 3300049576 Bacteria 1740
308 Ga0501040_0356201 3300049576 Bacteria 1048
309 Ga0501041_0036442 3300049577 Bacteria 2980
310 Ga0501041_0508876 3300049577 Bacteria 766
311 Ga0501042_0076369 3300049578 Bacteria 2398
312 Ga0501042_0468559 3300049578 Bacteria 914
313 Ga0501042_0478414 3300049578 Bacteria 904
314 Ga0501046_0153558 3300049580 Bacteria 1736
315 Ga0501046_0429576 3300049580 Bacteria 952
316 Ga0501046_0554431 3300049580 Bacteria 819
317 Ga0501047_0080169 3300049581 Bacteria 3138
318 Ga0501048_0210900 3300049582 Bacteria 1377
319 Ga0501048_0569152 3300049582 Bacteria 813
320 Ga0501068_0041480 3300049584 Bacteria 2766
321 Ga0501069_0275055 3300049585 Bacteria 985
322 Ga0501071_1603706 3300049587 Unclassified 502
323 Ga0501072_0035322 3300049588 Bacteria 3917
324 Ga0501072_0100154 3300049588 Bacteria 2303
325 Ga0501074_0188805 3300049590 Bacteria 1469
326 Ga0501075_0558537 3300049591 Bacteria 873
327 Ga0501076_0103785 3300049592 Bacteria 2293
328 Ga0501076_0918762 3300049592 Bacteria 721
329 Ga0501077_0263375 3300049593 Bacteria 1096
330 Ga0501077_0699167 3300049593 Bacteria 652
331 Ga0501079_0064143 3300049741 Bacteria 2834
332 Ga0501080_0019628 3300049742 Bacteria 6261
333 Ga0501080_0386717 3300049742 Bacteria 1260
334 Ga0501081_0051752 3300049743 Bacteria 2832
335 Ga0501035_0235551 3300049822 Bacteria 1559
336 Ga0501044_0246777 3300049823 Bacteria 1728
337 Ga0501045_0142498 3300049824 Bacteria 1782
338 nmdc:mga0yw44_197347_c1 3300050492 Unclassified 1328
339 nmdc:mga0yw44_345767_c1 3300050492 Bacteria 1001
340 nmdc:mga05p37_964755_c1 3300050507 Bacteria 910
341 nmdc:mga09592_762778_c1 3300050508 Unclassified 820
342 nmdc:mga0qj67_337882_c1 3300050509 Bacteria 1218
343 nmdc:mga0qj67_853633_c1 3300050509 Bacteria 719
344 nmdc:mga08y16_738059_c1 3300050511 Bacteria 982
345 nmdc:mga08y16_749530_c1 3300050511 Bacteria 973
346 nmdc:mga08y16_975860_c1 3300050511 Bacteria 829
347 Ga0495655_0160468 3300053083 Bacteria 713
348 Ga0501084_0511914 3300054114 Bacteria 1015
349 Ga0501084_1066198 3300054114 Bacteria 679
350 Ga0501082_0113394 3300060353 Bacteria 2347
351 Ga0501082_0381725 3300060353 Bacteria 1229
352 Ga0466962_0203083 3300061719 Bacteria 969
353 Ga0530510_0107540 3300061734 Bacteria 2041

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_11270293 Ga0114129_112702932 127
2 3300050509 nmdc:mga0qj67_337882_c1 nmdc:mga0qj67_337882_c1_344_781 127
3 3300044901 Ga0466960_0247665 Ga0466960_0247665_65_502 129
4 3300048916 Ga0496113_0026837 Ga0496113_0026837_3033_3464 130
5 3300013296 Ga0157374_10827857 Ga0157374_108278571 131
6 3300046500 Ga0495596_0091200 Ga0495596_0091200_342_809 131
7 3300046523 Ga0495644_0144530 Ga0495644_0144530_253_720 131
8 3300031903 Ga0307407_10368693 Ga0307407_103686932 133
9 3300031995 Ga0307409_100135717 Ga0307409_1001357172 133
10 3300032005 Ga0307411_10680627 Ga0307411_106806271 133
11 3300025919 Ga0207657_10154233 Ga0207657_101542331 135
12 3300005981 Ga0081538_10085301 Ga0081538_100853013 136
13 3300005327 Ga0070658_10224406 Ga0070658_102244061 137
14 3300005339 Ga0070660_100044282 Ga0070660_1000442823 137
15 3300005366 Ga0070659_100000052 Ga0070659_100000052101 137
16 3300005437 Ga0070710_10000004 Ga0070710_10000004195 137
17 3300013307 Ga0157372_10705801 Ga0157372_107058012 137
18 3300025898 Ga0207692_10000002 Ga0207692_1000000286 137
19 3300025909 Ga0207705_10214496 Ga0207705_102144963 137
20 3300025919 Ga0207657_10024110 Ga0207657_100241102 137
21 3300025919 Ga0207657_10060940 Ga0207657_100609403 137
22 3300025932 Ga0207690_10000061 Ga0207690_1000006194 137
23 3300025949 Ga0207667_12159521 Ga0207667_121595211 137
24 3300032126 Ga0307415_101573938 Ga0307415_1015739381 137
25 3300044901 Ga0466960_0203253 Ga0466960_0203253_500_913 137
26 3300049590 Ga0501074_0188805 Ga0501074_0188805_780_1193 137
27 3300049741 Ga0501079_0064143 Ga0501079_0064143_2147_2560 137
28 3300049742 Ga0501080_0019628 Ga0501080_0019628_1313_1726 137
29 3300003203 JGI25406J46586_10026394 JGI25406J46586_100263942 138
30 3300003373 JGI25407J50210_10022735 JGI25407J50210_100227352 138
31 3300005327 Ga0070658_10264013 Ga0070658_102640132 138
32 3300005329 Ga0070683_100749824 Ga0070683_1007498242 138
33 3300005329 Ga0070683_102072131 Ga0070683_1020721311 138
34 3300005331 Ga0070670_101628167 Ga0070670_1016281671 138
35 3300005333 Ga0070677_10263459 Ga0070677_102634591 138
36 3300005334 Ga0068869_100186438 Ga0068869_1001864381 138
37 3300005334 Ga0068869_101941206 Ga0068869_1019412061 138
38 3300005336 Ga0070680_101810328 Ga0070680_1018103281 138
39 3300005338 Ga0068868_100694862 Ga0068868_1006948622 138
40 3300005338 Ga0068868_101269530 Ga0068868_1012695301 138
41 3300005339 Ga0070660_100040758 Ga0070660_1000407583 138
42 3300005341 Ga0070691_10472317 Ga0070691_104723171 138
43 3300005344 Ga0070661_100296062 Ga0070661_1002960622 138
44 3300005347 Ga0070668_100207476 Ga0070668_1002074762 138
45 3300005353 Ga0070669_100409838 Ga0070669_1004098381 138
46 3300005354 Ga0070675_100404745 Ga0070675_1004047452 138
47 3300005355 Ga0070671_100624632 Ga0070671_1006246322 138
48 3300005356 Ga0070674_100353549 Ga0070674_1003535492 138
49 3300005365 Ga0070688_100354785 Ga0070688_1003547851 138
50 3300005366 Ga0070659_101238171 Ga0070659_1012381711 138
51 3300005366 Ga0070659_101844721 Ga0070659_1018447211 138
52 3300005438 Ga0070701_10380957 Ga0070701_103809572 138
53 3300005438 Ga0070701_10404679 Ga0070701_104046792 138
54 3300005439 Ga0070711_100795028 Ga0070711_1007950282 138
55 3300005440 Ga0070705_101017837 Ga0070705_1010178371 138
56 3300005441 Ga0070700_100122535 Ga0070700_1001225353 138
57 3300005441 Ga0070700_100290348 Ga0070700_1002903482 138
58 3300005456 Ga0070678_100312397 Ga0070678_1003123972 138
59 3300005457 Ga0070662_100230763 Ga0070662_1002307632 138
60 3300005457 Ga0070662_100292208 Ga0070662_1002922082 138
61 3300005530 Ga0070679_100250194 Ga0070679_1002501942 138
62 3300005530 Ga0070679_101128406 Ga0070679_1011284061 138
63 3300005530 Ga0070679_101137435 Ga0070679_1011374351 138
64 3300005535 Ga0070684_100476118 Ga0070684_1004761182 138
65 3300005535 Ga0070684_102044447 Ga0070684_1020444471 138
66 3300005535 Ga0070684_102060582 Ga0070684_1020605821 138
67 3300005539 Ga0068853_100744234 Ga0068853_1007442341 138
68 3300005539 Ga0068853_100963723 Ga0068853_1009637231 138
69 3300005543 Ga0070672_100436048 Ga0070672_1004360482 138
70 3300005544 Ga0070686_100168452 Ga0070686_1001684522 138
71 3300005547 Ga0070693_100560870 Ga0070693_1005608701 138
72 3300005548 Ga0070665_100728063 Ga0070665_1007280632 138
73 3300005564 Ga0070664_100161496 Ga0070664_1001614962 138
74 3300005564 Ga0070664_100835942 Ga0070664_1008359422 138
75 3300005577 Ga0068857_100841729 Ga0068857_1008417292 138
76 3300005614 Ga0068856_100293588 Ga0068856_1002935881 138
77 3300005616 Ga0068852_100224391 Ga0068852_1002243912 138
78 3300005617 Ga0068859_100551003 Ga0068859_1005510032 138
79 3300005617 Ga0068859_102175315 Ga0068859_1021753151 138
80 3300005618 Ga0068864_100579495 Ga0068864_1005794952 138
81 3300005718 Ga0068866_10140774 Ga0068866_101407742 138
82 3300005719 Ga0068861_100330768 Ga0068861_1003307682 138
83 3300005834 Ga0068851_10335205 Ga0068851_103352051 138
84 3300005834 Ga0068851_10488138 Ga0068851_104881382 138
85 3300005834 Ga0068851_10502864 Ga0068851_105028641 138
86 3300005840 Ga0068870_10287677 Ga0068870_102876772 138
87 3300005840 Ga0068870_10951336 Ga0068870_109513362 138
88 3300005840 Ga0068870_11388517 Ga0068870_113885171 138
89 3300005842 Ga0068858_100859752 Ga0068858_1008597522 138
90 3300005842 Ga0068858_100885229 Ga0068858_1008852292 138
91 3300005843 Ga0068860_100290554 Ga0068860_1002905542 138
92 3300005843 Ga0068860_101775211 Ga0068860_1017752111 138
93 3300005937 Ga0081455_10220031 Ga0081455_102200312 138
94 3300005937 Ga0081455_10234298 Ga0081455_102342982 138
95 3300005937 Ga0081455_10440674 Ga0081455_104406742 138
96 3300005981 Ga0081538_10004147 Ga0081538_100041472 138
97 3300005981 Ga0081538_10070134 Ga0081538_100701343 138
98 3300005981 Ga0081538_10087779 Ga0081538_100877792 138
99 3300005981 Ga0081538_10108792 Ga0081538_101087922 138
100 3300005981 Ga0081538_10127419 Ga0081538_101274192 138
101 3300005983 Ga0081540_1006943 Ga0081540_10069438 138
102 3300005985 Ga0081539_10001679 Ga0081539_1000167934 138
103 3300005985 Ga0081539_10101555 Ga0081539_101015552 138
104 3300005985 Ga0081539_10110349 Ga0081539_101103492 138
105 3300006038 Ga0075365_10165039 Ga0075365_101650393 138
106 3300006058 Ga0075432_10113836 Ga0075432_101138362 138
107 3300006237 Ga0097621_100889733 Ga0097621_1008897332 138
108 3300006846 Ga0075430_100400074 Ga0075430_1004000742 138
109 3300006846 Ga0075430_101084613 Ga0075430_1010846132 138
110 3300006871 Ga0075434_101320660 Ga0075434_1013206602 138
111 3300006880 Ga0075429_100792888 Ga0075429_1007928882 138
112 3300006881 Ga0068865_100256903 Ga0068865_1002569032 138
113 3300006931 Ga0097620_100551021 Ga0097620_1005510212 138
114 3300006931 Ga0097620_102175371 Ga0097620_1021753712 138
115 3300009094 Ga0111539_11400166 Ga0111539_114001661 138
116 3300009098 Ga0105245_10891395 Ga0105245_108913952 138
117 3300009098 Ga0105245_11662603 Ga0105245_116626031 138
118 3300009101 Ga0105247_10529236 Ga0105247_105292361 138
119 3300009147 Ga0114129_11577802 Ga0114129_115778022 138
120 3300009148 Ga0105243_10442515 Ga0105243_104425152 138
121 3300009148 Ga0105243_10576442 Ga0105243_105764422 138
122 3300009148 Ga0105243_10755830 Ga0105243_107558301 138
123 3300009176 Ga0105242_10623403 Ga0105242_106234032 138
124 3300009176 Ga0105242_11113546 Ga0105242_111135461 138
125 3300009551 Ga0105238_10399243 Ga0105238_103992432 138
126 3300009551 Ga0105238_10820706 Ga0105238_108207062 138
127 3300009553 Ga0105249_10919184 Ga0105249_109191842 138
128 3300009553 Ga0105249_11838111 Ga0105249_118381112 138
129 3300010375 Ga0105239_10879864 Ga0105239_108798642 138
130 3300011119 Ga0105246_10225191 Ga0105246_102251912 138
131 3300013306 Ga0163162_10804637 Ga0163162_108046372 138
132 3300013306 Ga0163162_10897032 Ga0163162_108970322 138
133 3300013307 Ga0157372_10570396 Ga0157372_105703962 138
134 3300013307 Ga0157372_10834063 Ga0157372_108340632 138
135 3300013307 Ga0157372_10868007 Ga0157372_108680072 138
136 3300013308 Ga0157375_10845412 Ga0157375_108454122 138
137 3300013308 Ga0157375_10951687 Ga0157375_109516872 138
138 3300014325 Ga0163163_11285968 Ga0163163_112859681 138
139 3300014326 Ga0157380_10895685 Ga0157380_108956852 138
140 3300014968 Ga0157379_10643398 Ga0157379_106433981 138
141 3300014969 Ga0157376_11365818 Ga0157376_113658181 138
142 3300017792 Ga0163161_10444379 Ga0163161_104443792 138
143 3300017792 Ga0163161_10619896 Ga0163161_106198962 138
144 3300020069 Ga0197907_10961319 Ga0197907_109613192 138
145 3300020075 Ga0206349_1884914 Ga0206349_18849141 138
146 3300020078 Ga0206352_10261639 Ga0206352_102616391 138
147 3300020081 Ga0206354_11672298 Ga0206354_116722981 138
148 3300025321 Ga0207656_10178102 Ga0207656_101781022 138
149 3300025321 Ga0207656_10308951 Ga0207656_103089512 138
150 3300025899 Ga0207642_10084746 Ga0207642_100847462 138
151 3300025899 Ga0207642_10774367 Ga0207642_107743672 138
152 3300025900 Ga0207710_10321101 Ga0207710_103211012 138
153 3300025901 Ga0207688_10170564 Ga0207688_101705642 138
154 3300025907 Ga0207645_10394821 Ga0207645_103948212 138
155 3300025907 Ga0207645_10441914 Ga0207645_104419142 138
156 3300025908 Ga0207643_10274383 Ga0207643_102743832 138
157 3300025908 Ga0207643_10962005 Ga0207643_109620051 138
158 3300025909 Ga0207705_10447265 Ga0207705_104472652 138
159 3300025916 Ga0207663_10588812 Ga0207663_105888122 138
160 3300025917 Ga0207660_10402429 Ga0207660_104024293 138
161 3300025917 Ga0207660_11075811 Ga0207660_110758111 138
162 3300025919 Ga0207657_10055141 Ga0207657_100551413 138
163 3300025919 Ga0207657_10209524 Ga0207657_102095242 138
164 3300025920 Ga0207649_10789437 Ga0207649_107894372 138
165 3300025921 Ga0207652_10227138 Ga0207652_102271382 138
166 3300025923 Ga0207681_10110502 Ga0207681_101105023 138
167 3300025923 Ga0207681_10419555 Ga0207681_104195552 138
168 3300025925 Ga0207650_10943338 Ga0207650_109433381 138
169 3300025927 Ga0207687_11094924 Ga0207687_110949242 138
170 3300025929 Ga0207664_10643347 Ga0207664_106433471 138
171 3300025932 Ga0207690_10089886 Ga0207690_100898862 138
172 3300025933 Ga0207706_10262563 Ga0207706_102625632 138
173 3300025933 Ga0207706_10270343 Ga0207706_102703432 138
174 3300025933 Ga0207706_10459872 Ga0207706_104598722 138
175 3300025935 Ga0207709_10504457 Ga0207709_105044572 138
176 3300025935 Ga0207709_10681281 Ga0207709_106812811 138
177 3300025936 Ga0207670_10616768 Ga0207670_106167682 138
178 3300025937 Ga0207669_10149308 Ga0207669_101493083 138
179 3300025937 Ga0207669_10320439 Ga0207669_103204392 138
180 3300025937 Ga0207669_10350269 Ga0207669_103502693 138
181 3300025938 Ga0207704_10302688 Ga0207704_103026882 138
182 3300025938 Ga0207704_10719094 Ga0207704_107190942 138
183 3300025938 Ga0207704_11586258 Ga0207704_115862581 138
184 3300025940 Ga0207691_10367056 Ga0207691_103670562 138
185 3300025942 Ga0207689_10077418 Ga0207689_100774182 138
186 3300025942 Ga0207689_10746287 Ga0207689_107462872 138
187 3300025944 Ga0207661_10755211 Ga0207661_107552111 138
188 3300025945 Ga0207679_10200740 Ga0207679_102007402 138
189 3300025945 Ga0207679_10339174 Ga0207679_103391742 138
190 3300025972 Ga0207668_10092585 Ga0207668_100925852 138
191 3300025981 Ga0207640_10418691 Ga0207640_104186912 138
192 3300025981 Ga0207640_10421665 Ga0207640_104216651 138
193 3300025981 Ga0207640_11845674 Ga0207640_118456741 138
194 3300026023 Ga0207677_10651640 Ga0207677_106516401 138
195 3300026041 Ga0207639_10481145 Ga0207639_104811452 138
196 3300026075 Ga0207708_10141643 Ga0207708_101416432 138
197 3300026075 Ga0207708_10329371 Ga0207708_103293712 138
198 3300026075 Ga0207708_10351602 Ga0207708_103516022 138
199 3300026078 Ga0207702_10059249 Ga0207702_100592492 138
200 3300026078 Ga0207702_10433017 Ga0207702_104330172 138
201 3300026078 Ga0207702_10858728 Ga0207702_108587282 138
202 3300026089 Ga0207648_10291926 Ga0207648_102919263 138
203 3300026089 Ga0207648_10560850 Ga0207648_105608502 138
204 3300026095 Ga0207676_10779164 Ga0207676_107791642 138
205 3300026116 Ga0207674_10564848 Ga0207674_105648482 138
206 3300026116 Ga0207674_10781927 Ga0207674_107819272 138
207 3300026118 Ga0207675_100348986 Ga0207675_1003489862 138
208 3300026118 Ga0207675_100642329 Ga0207675_1006423292 138
209 3300026121 Ga0207683_10546439 Ga0207683_105464392 138
210 3300026121 Ga0207683_10614791 Ga0207683_106147912 138
211 3300026142 Ga0207698_10413608 Ga0207698_104136082 138
212 3300027907 Ga0207428_11140770 Ga0207428_111407701 138
213 3300028379 Ga0268266_10227446 Ga0268266_102274463 138
214 3300028381 Ga0268264_10774399 Ga0268264_107743991 138
215 3300031731 Ga0307405_10833970 Ga0307405_108339702 138
216 3300031824 Ga0307413_10443068 Ga0307413_104430681 138
217 3300031824 Ga0307413_10484134 Ga0307413_104841342 138
218 3300031824 Ga0307413_11331200 Ga0307413_113312001 138
219 3300031852 Ga0307410_10161800 Ga0307410_101618002 138
220 3300031852 Ga0307410_10512038 Ga0307410_105120382 138
221 3300031852 Ga0307410_10520587 Ga0307410_105205871 138
222 3300031852 Ga0307410_10556580 Ga0307410_105565801 138
223 3300031852 Ga0307410_11413350 Ga0307410_114133501 138
224 3300031901 Ga0307406_10393512 Ga0307406_103935122 138
225 3300031901 Ga0307406_10526444 Ga0307406_105264442 138
226 3300031903 Ga0307407_10145676 Ga0307407_101456761 138
227 3300031903 Ga0307407_10505000 Ga0307407_105050002 138
228 3300031911 Ga0307412_11391164 Ga0307412_113911642 138
229 3300031995 Ga0307409_100233450 Ga0307409_1002334503 138
230 3300031995 Ga0307409_100466423 Ga0307409_1004664232 138
231 3300031995 Ga0307409_100650109 Ga0307409_1006501092 138
232 3300031995 Ga0307409_100970256 Ga0307409_1009702561 138
233 3300031995 Ga0307409_101860786 Ga0307409_1018607861 138
234 3300031995 Ga0307409_101947336 Ga0307409_1019473361 138
235 3300032002 Ga0307416_100826699 Ga0307416_1008266992 138
236 3300032002 Ga0307416_101538864 Ga0307416_1015388642 138
237 3300032002 Ga0307416_101635937 Ga0307416_1016359371 138
238 3300032004 Ga0307414_10567029 Ga0307414_105670292 138
239 3300032005 Ga0307411_11222627 Ga0307411_112226272 138
240 3300032126 Ga0307415_100517135 Ga0307415_1005171352 138
241 3300032126 Ga0307415_100542096 Ga0307415_1005420962 138
242 3300032126 Ga0307415_100569990 Ga0307415_1005699902 138
243 3300041443 Ga0451789_0430967 Ga0451789_0430967_32_451 138
244 3300041512 Ga0451853_2383160 Ga0451853_2383160_141_560 138
245 3300044684 Ga0466966_0224872 Ga0466966_0224872_380_796 138
246 3300044684 Ga0466966_0254665 Ga0466966_0254665_576_992 138
247 3300044693 Ga0466961_0273723 Ga0466961_0273723_497_913 138
248 3300044694 Ga0466963_0200374 Ga0466963_0200374_151_567 138
249 3300044694 Ga0466963_0236651 Ga0466963_0236651_422_838 138
250 3300044694 Ga0466963_0648870 Ga0466963_0648870_62_478 138
251 3300044706 Ga0466964_0145414 Ga0466964_0145414_13_429 138
252 3300044706 Ga0466964_0227992 Ga0466964_0227992_13_432 138
253 3300044706 Ga0466964_0372858 Ga0466964_0372858_215_631 138
254 3300044719 Ga0466971_0100022 Ga0466971_0100022_743_1159 138
255 3300044735 Ga0466968_0181190 Ga0466968_0181190_433_849 138
256 3300044842 Ga0466957_0596649 Ga0466957_0596649_314_730 138
257 3300044901 Ga0466960_0219184 Ga0466960_0219184_195_611 138
258 3300045976 Ga0466967_0037815 Ga0466967_0037815_2567_2983 138
259 3300045976 Ga0466967_0113149 Ga0466967_0113149_367_783 138
260 3300045976 Ga0466967_0172982 Ga0466967_0172982_1043_1462 138
261 3300045976 Ga0466967_0412347 Ga0466967_0412347_792_1208 138
262 3300045976 Ga0466967_0427711 Ga0466967_0427711_244_660 138
263 3300045976 Ga0466967_1366714 Ga0466967_1366714_183_599 138
264 3300045976 Ga0466967_1543110 Ga0466967_1543110_210_626 138
265 3300046491 Ga0495584_0532029 Ga0495584_0532029_18_449 138
266 3300046500 Ga0495596_0216543 Ga0495596_0216543_232_651 138
267 3300046513 Ga0495616_0243108 Ga0495616_0243108_25_444 138
268 3300046518 Ga0495631_0083031 Ga0495631_0083031_413_832 138
269 3300046522 Ga0495643_0249139 Ga0495643_0249139_19_438 138
270 3300046522 Ga0495643_0254621 Ga0495643_0254621_113_532 138
271 3300046615 Ga0495656_0775232 Ga0495656_0775232_80_496 138
272 3300046665 Ga0495661_0213356 Ga0495661_0213356_502_930 138
273 3300046794 Ga0495589_0087313 Ga0495589_0087313_796_1215 138
274 3300048903 Ga0496100_0188762 Ga0496100_0188762_153_569 138
275 3300048904 Ga0496101_0001147 Ga0496101_0001147_14719_15138 138
276 3300048904 Ga0496101_0338691 Ga0496101_0338691_530_946 138
277 3300048905 Ga0496102_0041443 Ga0496102_0041443_944_1360 138
278 3300048906 Ga0496103_0077029 Ga0496103_0077029_1051_1467 138
279 3300048907 Ga0496104_0067023 Ga0496104_0067023_2263_2679 138
280 3300048907 Ga0496104_0580958 Ga0496104_0580958_254_673 138
281 3300048908 Ga0496105_0062075 Ga0496105_0062075_2363_2779 138
282 3300048909 Ga0496106_0069479 Ga0496106_0069479_918_1334 138
283 3300048910 Ga0496107_0215948 Ga0496107_0215948_896_1312 138
284 3300048911 Ga0496108_0001875 Ga0496108_0001875_15442_15858 138
285 3300048911 Ga0496108_0364918 Ga0496108_0364918_280_699 138
286 3300048911 Ga0496108_0428295 Ga0496108_0428295_456_872 138
287 3300048912 Ga0496109_0017648 Ga0496109_0017648_3881_4297 138
288 3300048912 Ga0496109_0447719 Ga0496109_0447719_423_851 138
289 3300048912 Ga0496109_1792978 Ga0496109_1792978_115_534 138
290 3300048913 Ga0496110_0072720 Ga0496110_0072720_1930_2346 138
291 3300048913 Ga0496110_0467466 Ga0496110_0467466_490_909 138
292 3300048913 Ga0496110_0468302 Ga0496110_0468302_445_873 138
293 3300048914 Ga0496111_0019588 Ga0496111_0019588_70_486 138
294 3300048914 Ga0496111_0699439 Ga0496111_0699439_300_719 138
295 3300048915 Ga0496112_0011404 Ga0496112_0011404_2023_2439 138
296 3300048916 Ga0496113_0314715 Ga0496113_0314715_263_679 138
297 3300048916 Ga0496113_0668267 Ga0496113_0668267_252_671 138
298 3300048916 Ga0496113_1157722 Ga0496113_1157722_37_465 138
299 3300048917 Ga0496114_0608449 Ga0496114_0608449_63_479 138
300 3300048918 Ga0496115_0867997 Ga0496115_0867997_91_507 138
301 3300048924 Ga0496121_0008296 Ga0496121_0008296_7066_7482 138
302 3300048924 Ga0496121_0696775 Ga0496121_0696775_67_483 138
303 3300048929 Ga0496126_0767085 Ga0496126_0767085_109_525 138
304 3300049568 Ga0501031_0331636 Ga0501031_0331636_35_472 138
305 3300049569 Ga0501032_0468062 Ga0501032_0468062_43_480 138
306 3300049572 Ga0501036_0234097 Ga0501036_0234097_54_491 138
307 3300049572 Ga0501036_0322132 Ga0501036_0322132_434_871 138
308 3300049573 Ga0501037_0577015 Ga0501037_0577015_252_689 138
309 3300049574 Ga0501038_0622642 Ga0501038_0622642_76_513 138
310 3300049575 Ga0501039_1127799 Ga0501039_1127799_124_561 138
311 3300049576 Ga0501040_0134505 Ga0501040_0134505_1196_1633 138
312 3300049576 Ga0501040_0356201 Ga0501040_0356201_321_758 138
313 3300049577 Ga0501041_0036442 Ga0501041_0036442_44_481 138
314 3300049577 Ga0501041_0508876 Ga0501041_0508876_60_497 138
315 3300049578 Ga0501042_0076369 Ga0501042_0076369_49_486 138
316 3300049578 Ga0501042_0468559 Ga0501042_0468559_439_867 138
317 3300049578 Ga0501042_0478414 Ga0501042_0478414_21_455 138
318 3300049580 Ga0501046_0153558 Ga0501046_0153558_1254_1691 138
319 3300049580 Ga0501046_0429576 Ga0501046_0429576_474_911 138
320 3300049580 Ga0501046_0554431 Ga0501046_0554431_58_474 138
321 3300049581 Ga0501047_0080169 Ga0501047_0080169_625_1041 138
322 3300049582 Ga0501048_0210900 Ga0501048_0210900_494_931 138
323 3300049582 Ga0501048_0569152 Ga0501048_0569152_187_624 138
324 3300049584 Ga0501068_0041480 Ga0501068_0041480_1964_2401 138
325 3300049585 Ga0501069_0275055 Ga0501069_0275055_377_814 138
326 3300049587 Ga0501071_1603706 Ga0501071_1603706_13_450 138
327 3300049588 Ga0501072_0035322 Ga0501072_0035322_84_521 138
328 3300049588 Ga0501072_0100154 Ga0501072_0100154_470_907 138
329 3300049591 Ga0501075_0558537 Ga0501075_0558537_69_506 138
330 3300049592 Ga0501076_0103785 Ga0501076_0103785_59_496 138
331 3300049592 Ga0501076_0918762 Ga0501076_0918762_170_607 138
332 3300049593 Ga0501077_0263375 Ga0501077_0263375_116_553 138
333 3300049593 Ga0501077_0699167 Ga0501077_0699167_41_478 138
334 3300049742 Ga0501080_0386717 Ga0501080_0386717_584_1021 138
335 3300049743 Ga0501081_0051752 Ga0501081_0051752_208_645 138
336 3300049822 Ga0501035_0235551 Ga0501035_0235551_450_887 138
337 3300049823 Ga0501044_0246777 Ga0501044_0246777_1225_1641 138
338 3300049824 Ga0501045_0142498 Ga0501045_0142498_863_1300 138
339 3300050492 nmdc:mga0yw44_197347_c1 nmdc:mga0yw44_197347_c1_10_426 138
340 3300050492 nmdc:mga0yw44_345767_c1 nmdc:mga0yw44_345767_c1_430_849 138
341 3300050507 nmdc:mga05p37_964755_c1 nmdc:mga05p37_964755_c1_83_520 138
342 3300050508 nmdc:mga09592_762778_c1 nmdc:mga09592_762778_c1_346_765 138
343 3300050509 nmdc:mga0qj67_853633_c1 nmdc:mga0qj67_853633_c1_107_604 138
344 3300050511 nmdc:mga08y16_738059_c1 nmdc:mga08y16_738059_c1_527_955 138
345 3300050511 nmdc:mga08y16_749530_c1 nmdc:mga08y16_749530_c1_249_677 138
346 3300050511 nmdc:mga08y16_975860_c1 nmdc:mga08y16_975860_c1_247_666 138
347 3300053083 Ga0495655_0160468 Ga0495655_0160468_250_669 138
348 3300054114 Ga0501084_0511914 Ga0501084_0511914_44_481 138
349 3300054114 Ga0501084_1066198 Ga0501084_1066198_174_611 138
350 3300060353 Ga0501082_0113394 Ga0501082_0113394_646_1083 138
351 3300060353 Ga0501082_0381725 Ga0501082_0381725_687_1124 138
352 3300061719 Ga0466962_0203083 Ga0466962_0203083_262_678 138
353 3300061734 Ga0530510_0107540 Ga0530510_0107540_1341_1778 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17384

DUF150_C

RimP C-terminal SH3 domain

101

165

0.97

PF02576

RimP_N

RimP N-terminal domain

36

98

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dy9-assembly1.cif.gz_F y68t hfq from methanococcus jannaschii in complex with amp 0.8559 81 134
4x9c-assembly1.cif.gz_C 1.4a crystal structure of hfq from methanococcus jannaschii 0.8433 81 134
2x4j-assembly1.cif.gz_A crystal structure of orf137 from pyrobaculum spherical virus 0.8352 84 137
6gwk-assembly4.cif.gz_W the crystal structure of hfq from caulobacter crescentus 0.7969 85 137
7uwy-assembly1.cif.gz_A nmr solution structure of the de novo designed small beta-barrel protein 29_bp_sh3 0.7965 77 134
ID Description Score Start End Superfamily
af_Q2G2D3_87_153_2.30.30.180 Mainly Beta;Roll;SH3 type barrels.;Ribosome maturation factor RimP, C-terminal domain 0.9245 76 137 2.30.30.180
af_P0A8A8_87_147_2.30.30.180 Mainly Beta;Roll;SH3 type barrels.;Ribosome maturation factor RimP, C-terminal domain 0.9205 76 136 2.30.30.180
af_P0A8A8_87_147_2.30.30.180 Mainly Beta;Roll;SH3 type barrels.;Ribosome maturation factor RimP, C-terminal domain 0.9067 76 136 2.30.30.180
2ej9A02 Mainly Beta;Roll;SH3 type barrels.; 0.8668 83 134 2.30.30.100
4x9dF00 Mainly Beta;Roll;SH3 type barrels.; 0.85 81 134 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A536SCN9-F1-model_v4 Ribosome maturation factor RimP 0.9218 82 138
AF-A0A534HRL7-F1-model_v4 Ribosome maturation factor RimP 0.9071 72 137
AF-A0A534HRL7-F1-model_v4 Ribosome maturation factor RimP 0.8946 72 137
AF-A0A496K6Z6-F1-model_v4 deleted 0.8695 66 138
AF-A0A536SCN9-F1-model_v4 Ribosome maturation factor RimP 0.8661 82 138

Feature Viewer

pLDDT pTM Quality
84.9 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map