F419446

General Info

Members Datasets Scaffolds Average Seq Length
353 209 314 411

Family's Representative Sequence

Representative Sequence 3300033180|Ga0307510_10000312|Ga0307510_1000031237
Length 489
Sequence MILTGWLSVYWFLFLQRGDTNLEIKMNCFAIFSAVISGQFLLYFCWPKQGVAYALKQNLTLIAFTLPLYFPVLKNLYSRYMIDYQVYTLSNGIRILHKHSPSTITHCCFIVNAGSRDEPEDKAGLAHFIEHLLFKETETRSTNQILNRLELVGADLNAYTTKEYTCIHASLLKQHLERTMDLFQDILFHSTFPQEELEKERGVILDEIASYLDQPEEAIQDDFEELLFKGHALGKNILGTPETVSAMDKADIKSFMAANYNTEEMIFAVFGDHDLKKLIKLAEKYFGTIPANHTQKHRLRPADSEGEKLNVYRPITQTHCMIGNRAYPSSHQYKPGLLLLNNLLGGMGMSNRLNLEIREKYGIAYTIESNYTPLSDTGIFSIYFGTDAEKAEKALRLVHKELKKLRDQKLGTLQLHQAKQKFIGQIALAEENRMGLIISMAKSLLDFGYVDTLEQIFAKINACTAEQLLEISNEIFDNSLTTLLFVPKE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
5 2738541283 Pedobacter sp. OK701 Isolate Unclassified
6 2738541284 Pedobacter sp. YR016 Isolate Unclassified
7 2738541302 Pedobacter sp. CF074 Isolate Unclassified
8 2738543023 Pedobacter sp. OK628 Isolate Unclassified
9 2739367651 Pedobacter sp. OK291 Isolate Unclassified
10 2739367656 Pedobacter sp. CF523 Isolate Unclassified
11 2739367663 Pedobacter sp. YR510 Isolate Unclassified
12 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
13 2818991437 Pedobacter terrae 518 Isolate Unclassified
14 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
15 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
16 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
17 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
18 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
19 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
20 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
21 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
22 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
23 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
24 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
25 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
26 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
27 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
28 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
29 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
30 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
31 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
32 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
33 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
34 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
35 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
36 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
37 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
38 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
39 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
40 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
41 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
42 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
43 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
44 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
45 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
46 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
47 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
48 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
49 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
50 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
51 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
52 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
53 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
54 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
55 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
56 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
57 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
58 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
59 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
60 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
61 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
140 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
141 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
142 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
176 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
177 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
178 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
179 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
198 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
202 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
203 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
204 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
207 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
208 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
209 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.95
Metatranscriptomes 0
Isolates 11.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.65
Nodule 0
Rhizoplane 1.13
Rhizosphere 79.89
Stem 0
Stem Tuber 0
Unclassified 11.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1065277 2162886007 Bacteria 2673
2 SwRhRL2b_contig_3910478 2162886007 Bacteria 17291
3 JGI24736J21556_1003721 3300001904 Bacteria 2632
4 JGI24739J22299_10051208 3300001989 Bacteria 1332
5 JGI24737J22298_10001223 3300001990 Bacteria 9052
6 JGI24735J21928_10000084 3300002067 Bacteria 35383
7 JGI24735J21928_10031815 3300002067 Bacteria 1563
8 JGI25162J39368_1000630 3300002737 Bacteria 25078
9 JGI25162J39368_1001083 3300002737 Bacteria 16563
10 JGI25164J39214_1001584 3300002772 Bacteria 4858
11 JGI25152J39213_1000028 3300002773 Bacteria 100367
12 JGI25150J39212_1000006 3300002774 Bacteria 257228
13 JGI25151J46595_10000024 3300003187 Bacteria 217596
14 JGI25165J46597_1001320 3300003214 Bacteria 14015
15 JGI25153J46596_10000026 3300003215 Bacteria 217245
16 rootH1_10018659 3300003316 Bacteria 18105
17 rootH1_10140045 3300003316 Bacteria 7134
18 rootH2_10000579 3300003320 Bacteria 178428
19 rootH2_10028941 3300003320 Bacteria 19045
20 rootH2_10029452 3300003320 Bacteria 3068
21 rootH2_10058795 3300003320 Bacteria 4053
22 rootL2_10155837 3300003322 Bacteria 2624
23 rootH1_10001716 3300003323 Bacteria 29715
24 rootH1_10152660 3300003323 Bacteria 4435
25 rootH1_10297020 3300003323 Bacteria 1888
26 Ga0055536_1000002 3300003781 Bacteria 605605
27 Ga0055530_10004367 3300003791 Bacteria 7327
28 Ga0065714_10002724 3300005288 Bacteria 22352
29 Ga0065714_10006746 3300005288 Bacteria 3155
30 Ga0065714_10013210 3300005288 Bacteria 1965
31 Ga0065714_10064473 3300005288 Bacteria 60352
32 Ga0065714_10073478 3300005288 Bacteria 3170
33 Ga0065714_10074911 3300005288 Bacteria 2974
34 Ga0065714_10095798 3300005288 Bacteria 1777
35 Ga0065704_10070311 3300005289 Bacteria 34868
36 Ga0065704_10077214 3300005289 Bacteria 4815
37 Ga0070658_10000884 3300005327 Bacteria 25651
38 Ga0070658_10116126 3300005327 Unclassified 2221
39 Ga0070676_10003689 3300005328 Bacteria 8022
40 Ga0068868_100056895 3300005338 Bacteria 3089
41 Ga0070660_100015432 3300005339 Bacteria 5517
42 Ga0070673_100001687 3300005364 Bacteria 13102
43 Ga0070659_100000076 3300005366 Bacteria 77320
44 Ga0070659_100001241 3300005366 Bacteria 18501
45 Ga0070663_100037517 3300005455 Bacteria 3374
46 Ga0070662_100000050 3300005457 Bacteria 64208
47 Ga0068867_100003010 3300005459 Bacteria 11877
48 Ga0070679_100017867 3300005530 Bacteria 6869
49 Ga0070684_100042759 3300005535 Bacteria 3913
50 Ga0068853_100213274 3300005539 Bacteria 1760
51 Ga0070672_100051349 3300005543 Bacteria 3215
52 Ga0070665_100000012 3300005548 Bacteria 508937
53 Ga0068855_100000177 3300005563 Bacteria 82003
54 Ga0068855_100054320 3300005563 Bacteria 4708
55 Ga0068855_100367079 3300005563 Bacteria 1583
56 Ga0068857_100022903 3300005577 Bacteria 5495
57 Ga0068857_100096796 3300005577 Bacteria 2645
58 Ga0068854_100038287 3300005578 Bacteria 3372
59 Ga0068856_100000292 3300005614 Bacteria 54884
60 Ga0068856_100001838 3300005614 Bacteria 22215
61 Ga0068852_100012048 3300005616 Bacteria 6545
62 Ga0068866_10035411 3300005718 Bacteria 2438
63 Ga0075366_10001853 3300006195 Bacteria 10663
64 Ga0075366_10002626 3300006195 Bacteria 9244
65 Ga0097621_100013237 3300006237 Bacteria 6141
66 Ga0075428_100037619 3300006844 Bacteria 5326
67 Ga0068865_100000100 3300006881 Bacteria 44815
68 Ga0105244_10015268 3300009036 Bacteria 4408
69 Ga0105240_10000158 3300009093 Bacteria 139180
70 Ga0105240_10005758 3300009093 Bacteria 18378
71 Ga0105240_10012192 3300009093 Bacteria 11892
72 Ga0105240_10098370 3300009093 Bacteria 3563
73 Ga0105240_10120774 3300009093 Bacteria 3155
74 Ga0105240_10171511 3300009093 Bacteria 2569
75 Ga0105240_10256435 3300009093 Bacteria 2020
76 Ga0105240_10346800 3300009093 Bacteria 1685
77 Ga0105241_10001803 3300009174 Bacteria 16258
78 Ga0105241_10008225 3300009174 Bacteria 7680
79 Ga0105241_10009182 3300009174 Bacteria 7277
80 Ga0105237_10000311 3300009545 Bacteria 67880
81 Ga0105237_10000621 3300009545 Bacteria 49573
82 Ga0105237_10001139 3300009545 Bacteria 35697
83 Ga0105237_10001268 3300009545 Bacteria 33663
84 Ga0105237_10003373 3300009545 Bacteria 19006
85 Ga0105237_10009763 3300009545 Bacteria 10266
86 Ga0105237_10393832 3300009545 Bacteria 1390
87 Ga0105237_10393833 3300009545 Bacteria 1390
88 Ga0105238_10011689 3300009551 Bacteria 8850
89 Ga0105239_10000014 3300010375 Bacteria 325391
90 Ga0105239_10000674 3300010375 Bacteria 48668
91 Ga0105239_10000859 3300010375 Bacteria 43167
92 Ga0105239_10001824 3300010375 Bacteria 27887
93 Ga0105239_10004353 3300010375 Bacteria 16966
94 Ga0105239_10021250 3300010375 Bacteria 7155
95 Ga0105239_10124849 3300010375 Bacteria 2860
96 Ga0157373_10000621 3300013100 Bacteria 27802
97 Ga0157373_10002248 3300013100 Bacteria 14628
98 Ga0157373_10005767 3300013100 Bacteria 9270
99 Ga0157373_10021394 3300013100 Bacteria 4699
100 Ga0157373_10022241 3300013100 Bacteria 4601
101 Ga0157373_10028204 3300013100 Bacteria 4050
102 Ga0157373_10038385 3300013100 Bacteria 3433
103 Ga0157371_10000224 3300013102 Bacteria 82657
104 Ga0157371_10000629 3300013102 Bacteria 41913
105 Ga0157371_10001836 3300013102 Bacteria 21402
106 Ga0157371_10003389 3300013102 Bacteria 14478
107 Ga0157371_10011216 3300013102 Bacteria 6925
108 Ga0157371_10049048 3300013102 Bacteria 3000
109 Ga0157370_10002047 3300013104 Bacteria 24775
110 Ga0157370_10006976 3300013104 Bacteria 12338
111 Ga0157370_10037314 3300013104 Bacteria 4711
112 Ga0157370_10038873 3300013104 Bacteria 4602
113 Ga0157370_10077687 3300013104 Bacteria 3127
114 Ga0157370_10115359 3300013104 Bacteria 2509
115 Ga0157370_10123069 3300013104 Bacteria 2422
116 Ga0157370_10126200 3300013104 Bacteria 2388
117 Ga0157370_10138324 3300013104 Bacteria 2269
118 Ga0157370_10180207 3300013104 Bacteria 1963
119 Ga0157369_10000158 3300013105 Bacteria 96395
120 Ga0157369_10000696 3300013105 Bacteria 43381
121 Ga0157369_10195870 3300013105 Bacteria 2122
122 Ga0157374_10001143 3300013296 Bacteria 22611
123 Ga0157374_10013032 3300013296 Bacteria 7250
124 Ga0157378_10005740 3300013297 Bacteria 10868
125 Ga0163162_10000011 3300013306 Bacteria 299877
126 Ga0163162_10000062 3300013306 Bacteria 105579
127 Ga0163162_10003376 3300013306 Bacteria 15277
128 Ga0163162_10022712 3300013306 Bacteria 6185
129 Ga0157372_10000037 3300013307 Bacteria 172444
130 Ga0157372_10004006 3300013307 Bacteria 15802
131 Ga0157372_10018711 3300013307 Bacteria 7451
132 Ga0157372_10046367 3300013307 Bacteria 4825
133 Ga0157372_10060169 3300013307 Bacteria 4250
134 Ga0157375_10009417 3300013308 Bacteria 8575
135 Ga0157375_10009600 3300013308 Bacteria 8500
136 Ga0182008_10000046 3300014497 Bacteria 111777
137 Ga0182008_10000047 3300014497 Bacteria 108181
138 Ga0182008_10000099 3300014497 Bacteria 66933
139 Ga0157377_10020716 3300014745 Bacteria 3450
140 Ga0182006_1000241 3300015261 Bacteria 51244
141 Ga0182006_1000397 3300015261 Bacteria 35456
142 Ga0182006_1000513 3300015261 Bacteria 29503
143 Ga0182006_1020788 3300015261 Bacteria 2746
144 Ga0182006_1032208 3300015261 Bacteria 2108
145 Ga0182007_10000008 3300015262 Bacteria 332953
146 Ga0182007_10014917 3300015262 Bacteria 2913
147 Ga0183373_1002 3300015682 Bacteria 990153
148 Ga0163161_10000570 3300017792 Bacteria 29671
149 Ga0163161_10000622 3300017792 Bacteria 28395
150 Ga0163161_10000650 3300017792 Bacteria 27726
151 Ga0163161_10003520 3300017792 Bacteria 10961
152 Ga0163161_10022780 3300017792 Bacteria 4412
153 Ga0207427_100685 3300025231 Bacteria 16128
154 Ga0209437_100021 3300025233 Bacteria 646400
155 Ga0209437_100124 3300025233 Bacteria 199789
156 Ga0207425_1000003 3300025245 Bacteria 1145342
157 Ga0209026_1000246 3300025250 Bacteria 69164
158 Ga0209129_1000022 3300025258 Bacteria 440876
159 Ga0209233_1000264 3300025261 Bacteria 78251
160 Ga0209676_1000022 3300025292 Bacteria 605659
161 Ga0209025_1000007 3300025294 Bacteria 1145109
162 Ga0209758_1000012 3300025297 Bacteria 949866
163 Ga0209050_1000020 3300025298 Bacteria 605671
164 Ga0207655_1014897 3300025728 Bacteria 4357
165 Ga0207647_10000041 3300025904 Bacteria 92367
166 Ga0207647_10000116 3300025904 Bacteria 61857
167 Ga0207647_10091913 3300025904 Bacteria 1809
168 Ga0207645_10000144 3300025907 Bacteria 55568
169 Ga0207705_10007437 3300025909 Bacteria 8054
170 Ga0207654_10054512 3300025911 Bacteria 2311
171 Ga0207695_10000235 3300025913 Bacteria 146984
172 Ga0207695_10002684 3300025913 Bacteria 25964
173 Ga0207695_10007587 3300025913 Bacteria 13754
174 Ga0207695_10012959 3300025913 Bacteria 9966
175 Ga0207695_10078050 3300025913 Bacteria 3361
176 Ga0207671_10001046 3300025914 Bacteria 33639
177 Ga0207671_10004911 3300025914 Bacteria 12554
178 Ga0207671_10005374 3300025914 Bacteria 11834
179 Ga0207671_10011329 3300025914 Bacteria 7264
180 Ga0207671_10014231 3300025914 Bacteria 6297
181 Ga0207671_10049074 3300025914 Bacteria 3124
182 Ga0207671_10256161 3300025914 Bacteria 1376
183 Ga0207657_10167321 3300025919 Unclassified 1783
184 Ga0207657_10268287 3300025919 Bacteria 1357
185 Ga0207694_10123275 3300025924 Bacteria 2071
186 Ga0207690_10000049 3300025932 Bacteria 113589
187 Ga0207690_10003530 3300025932 Bacteria 9316
188 Ga0207706_10000007 3300025933 Bacteria 211081
189 Ga0207704_10000125 3300025938 Bacteria 41739
190 Ga0207691_10126544 3300025940 Bacteria 2261
191 Ga0207667_10000070 3300025949 Bacteria 180479
192 Ga0207667_10062710 3300025949 Bacteria 3886
193 Ga0207667_10144288 3300025949 Bacteria 2451
194 Ga0207640_10015057 3300025981 Bacteria 4468
195 Ga0207639_10154708 3300026041 Bacteria 1925
196 Ga0207678_10051001 3300026067 Bacteria 3573
197 Ga0207702_10000319 3300026078 Bacteria 55143
198 Ga0207702_10012316 3300026078 Bacteria 7118
199 Ga0207702_10013905 3300026078 Bacteria 6686
200 Ga0207648_10002420 3300026089 Bacteria 20094
201 Ga0207674_10012156 3300026116 Bacteria 9637
202 Ga0207674_10114699 3300026116 Bacteria 2666
203 Ga0207698_10015184 3300026142 Bacteria 5151
204 Ga0268266_10000039 3300028379 Bacteria 324579
205 Ga0307517_10000363 3300028786 Bacteria 78039
206 Ga0307515_10000528 3300028794 Bacteria 90438
207 Ga0307515_10001024 3300028794 Bacteria 63787
208 Ga0307515_10015757 3300028794 Bacteria 13908
209 Ga0307515_10173320 3300028794 Bacteria 2139
210 Ga0265338_10032365 3300028800 Bacteria 5102
211 Ga0265338_10140469 3300028800 Bacteria 1892
212 Ga0316177_1116921 3300030731 Bacteria 31477
213 Ga0316176_1123546 3300030732 Bacteria 6269
214 Ga0316183_1054866 3300030742 Bacteria 36207
215 Ga0316181_1126086 3300030744 Bacteria 12112
216 Ga0265325_10008581 3300031241 Bacteria 6022
217 Ga0265340_10004486 3300031247 Bacteria 7794
218 Ga0307408_100000291 3300031548 Bacteria 48964
219 Ga0307408_100001056 3300031548 Bacteria 21143
220 Ga0307408_100001216 3300031548 Bacteria 19381
221 Ga0265314_10048549 3300031711 Bacteria 2978
222 Ga0307405_10000014 3300031731 Bacteria 226733
223 Ga0307407_10000002 3300031903 Bacteria 323084
224 Ga0307412_10000001 3300031911 Bacteria 822691
225 Ga0307412_10001323 3300031911 Bacteria 13865
226 Ga0307416_100000005 3300032002 Bacteria 477728
227 Ga0307414_10000599 3300032004 Bacteria 18579
228 Ga0307414_10002461 3300032004 Bacteria 9702
229 Ga0307414_10003760 3300032004 Bacteria 8151
230 Ga0307414_10003765 3300032004 Bacteria 8149
231 Ga0307414_10122265 3300032004 Bacteria 2003
232 Ga0307414_10137761 3300032004 Unclassified 1906
233 Ga0307411_10180905 3300032005 Unclassified 1600
234 Ga0307507_10003362 3300033179 Bacteria 31256
235 Ga0307510_10000312 3300033180 Bacteria 44881
236 Ga0373935_0078462 3300035692 Bacteria 2142
237 Ga0373947_0051836 3300035725 Bacteria 2470
238 Ga0373925_0039740 3300037068 Bacteria 3481
239 Ga0395899_0000017 3300037312 Bacteria 440179
240 Ga0395899_0000152 3300037312 Bacteria 105233
241 Ga0395899_0000639 3300037312 Bacteria 36223
242 Ga0395900_0000738 3300037418 Bacteria 43440
243 Ga0395900_0001858 3300037418 Bacteria 24051
244 Ga0395900_0006350 3300037418 Bacteria 12328
245 Ga0395898_0040622 3300037466 Bacteria 4599
246 Ga0395905_0001548 3300037471 Bacteria 27490
247 Ga0395901_0000542 3300038443 Bacteria 43469
248 Ga0395901_0001757 3300038443 Bacteria 22357
249 Ga0436361_0581767 3300039447 Bacteria 25021
250 Ga0439448_0035841 3300042005 Bacteria 1590
251 Ga0453684_0124290 3300044712 Bacteria 3108
252 Ga0466959_0019059 3300045049 Bacteria 5044
253 Ga0495629_0004182 3300046459 Bacteria 10837
254 Ga0495651_0114648 3300046462 Bacteria 1988
255 Ga0495651_0157064 3300046462 Bacteria 1634
256 Ga0495650_0000095 3300046471 Bacteria 218020
257 Ga0495582_0002653 3300046473 Bacteria 9980
258 Ga0495639_0018997 3300046475 Bacteria 2997
259 Ga0495585_0000057 3300046492 Bacteria 113069
260 Ga0495585_0025217 3300046492 Bacteria 3408
261 Ga0495583_0003801 3300046506 Bacteria 11209
262 Ga0495606_0000009 3300046507 Bacteria 306313
263 Ga0495606_0005151 3300046507 Bacteria 12671
264 Ga0495606_0005747 3300046507 Bacteria 11725
265 Ga0495610_0000204 3300046512 Bacteria 65887
266 Ga0495610_0000279 3300046512 Bacteria 53150
267 Ga0495610_0000783 3300046512 Bacteria 29899
268 Ga0495616_0002949 3300046513 Bacteria 11053
269 Ga0495616_0004226 3300046513 Bacteria 9089
270 Ga0495631_0002180 3300046518 Bacteria 11302
271 Ga0495637_0006497 3300046520 Bacteria 5861
272 Ga0495637_0031868 3300046520 Bacteria 2328
273 Ga0495644_0024226 3300046523 Bacteria 2308
274 Ga0495665_0012405 3300046531 Bacteria 4610
275 Ga0495609_0020653 3300046538 Bacteria 3041
276 Ga0495622_0033310 3300046557 Bacteria 2405
277 Ga0495633_0000500 3300046558 Bacteria 39535
278 Ga0495633_0007091 3300046558 Bacteria 6518
279 Ga0495668_0000055 3300046616 Bacteria 199412
280 Ga0495625_0000007 3300046660 Bacteria 565749
281 Ga0495625_0001421 3300046660 Bacteria 29255
282 Ga0495625_0003334 3300046660 Bacteria 16169
283 Ga0495625_0011898 3300046660 Bacteria 7065
284 Ga0495625_0049538 3300046660 Bacteria 3019
285 Ga0495661_0003749 3300046665 Bacteria 11126
286 Ga0495661_0020191 3300046665 Bacteria 4354
287 Ga0495658_0002722 3300046683 Bacteria 8888
288 Ga0495613_0002684 3300046689 Bacteria 13362
289 Ga0495649_0000007 3300046694 Bacteria 518037
290 Ga0495581_0002859 3300047315 Bacteria 9861
291 Ga0495687_002416 3300047443 Bacteria 15041
292 Ga0495673_0024267 3300047469 Bacteria 2934
293 Ga0495686_0000152 3300047472 Bacteria 133713
294 Ga0495686_0012029 3300047472 Bacteria 6081
295 Ga0495686_0035907 3300047472 Bacteria 3182
296 Ga0495686_0055152 3300047472 Bacteria 2487
297 Ga0495614_0015406 3300048089 Bacteria 3332
298 Ga0496114_0305554 3300048917 Bacteria 1405
299 Ga0496115_0032980 3300048918 Bacteria 4088
300 Ga0496115_0075335 3300048918 Bacteria 2741
301 Ga0496116_0003748 3300048919 Bacteria 14866
302 Ga0496117_0002427 3300048920 Bacteria 23567
303 Ga0496122_0001886 3300048925 Bacteria 31745
304 Ga0496122_0017077 3300048925 Bacteria 6810
305 Ga0496123_0001009 3300048926 Bacteria 43009
306 Ga0495678_003423 3300049459 Bacteria 9837
307 Ga0501223_000906 3300049663 Bacteria 7018
308 Ga0501240_000822 3300049673 Bacteria 2775
309 Ga0501241_001568 3300049758 Bacteria 4589
310 nmdc:mga0k408_18909_c1 3300050493 Bacteria 3846
311 nmdc:mga0k408_70_c3 3300050493 Bacteria 21106
312 Ga0500608_000304 3300053122 Bacteria 18980
313 Ga0500618_000011 3300053125 Bacteria 198091
314 Ga0500624_000895 3300053157 Bacteria 6379

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045049 Ga0466959_0019059 Ga0466959_0019059_2015_3166 363
2 3300035725 Ga0373947_0051836 Ga0373947_0051836_1040_2215 375
3 3300005455 Ga0070663_100037517 Ga0070663_1000375171 377
4 3300026067 Ga0207678_10051001 Ga0207678_100510012 377
5 3300035692 Ga0373935_0078462 Ga0373935_0078462_675_1880 385
6 3300037068 Ga0373925_0039740 Ga0373925_0039740_721_1926 385
7 3300046459 Ga0495629_0004182 Ga0495629_0004182_1342_2547 385
8 3300046473 Ga0495582_0002653 Ga0495582_0002653_7124_8329 385
9 3300046475 Ga0495639_0018997 Ga0495639_0018997_128_1333 385
10 3300046531 Ga0495665_0012405 Ga0495665_0012405_2996_4201 385
11 3300046683 Ga0495658_0002722 Ga0495658_0002722_762_1967 385
12 3300046689 Ga0495613_0002684 Ga0495613_0002684_6543_7748 385
13 3300047315 Ga0495581_0002859 Ga0495581_0002859_5325_6530 385
14 3300048089 Ga0495614_0015406 Ga0495614_0015406_291_1496 385
15 3300013102 Ga0157371_10049048 Ga0157371_100490482 390
16 3300013104 Ga0157370_10138324 Ga0157370_101383242 390
17 3300013105 Ga0157369_10000696 Ga0157369_100006963 390
18 3300013307 Ga0157372_10000037 Ga0157372_1000003756 390
19 3300037312 Ga0395899_0000152 Ga0395899_0000152_11925_13160 390
20 3300025919 Ga0207657_10268287 Ga0207657_102682871 391
21 3300047472 Ga0495686_0012029 Ga0495686_0012029_2647_3876 392
22 3300046507 Ga0495606_0005747 Ga0495606_0005747_3288_4520 393
23 3300005548 Ga0070665_100000012 Ga0070665_100000012421 394
24 3300028379 Ga0268266_10000039 Ga0268266_1000003949 394
25 3300009093 Ga0105240_10005758 Ga0105240_100057589 396
26 3300013306 Ga0163162_10000062 Ga0163162_1000006252 396
27 3300025913 Ga0207695_10007587 Ga0207695_100075879 396
28 3300028800 Ga0265338_10032365 Ga0265338_100323653 396
29 3300032004 Ga0307414_10137761 Ga0307414_101377612 399
30 3300013100 Ga0157373_10000621 Ga0157373_100006219 402
31 3300003316 rootH1_10140045 rootH1_101400456 403
32 3300048917 Ga0496114_0305554 Ga0496114_0305554_82_1368 403
33 3300048918 Ga0496115_0032980 Ga0496115_0032980_439_1725 403
34 iso_pu_bacteria 8055588893 8055592054 404
35 3300044712 Ga0453684_0124290 Ga0453684_0124290_1581_2825 405
36 iso_pu_bacteria 2585427687 2586207114 405
37 iso_pu_bacteria 2721755487 2722731119 405
38 iso_pu_bacteria 2738541283 2738755739 405
39 iso_pu_bacteria 2738541284 2738761598 405
40 iso_pu_bacteria 2738541302 2738852696 405
41 iso_pu_bacteria 2738543023 2739305332 405
42 iso_pu_bacteria 2739367651 2739586619 405
43 iso_pu_bacteria 2739367656 2739614968 405
44 iso_pu_bacteria 2739367663 2739645913 405
45 iso_pu_bacteria 2775506987 2776615767 405
46 iso_pu_bacteria 2818991437 2819547063 405
47 iso_pu_bacteria 2842722452 2842727194 405
48 iso_pu_bacteria 2842903701 2842905363 405
49 iso_pu_bacteria 2842909656 2842910803 405
50 iso_pu_bacteria 2849281842 2849284019 405
51 iso_pu_bacteria 2852623160 2852626603 405
52 iso_pu_bacteria 2852627209 2852627980 405
53 iso_pu_bacteria 2857627736 2857628099 405
54 iso_pu_bacteria 2896317667 2896320737 405
55 iso_pu_bacteria 2902048731 2902052106 405
56 iso_pu_bacteria 2904445276 2904447073 405
57 iso_pu_bacteria 2904780799 2904785761 405
58 iso_pu_bacteria 2919177583 2919182419 405
59 iso_pu_bacteria 2919186247 2919188337 405
60 iso_pu_bacteria 2939664404 2939667579 405
61 iso_pu_bacteria 2945997725 2945998107 405
62 iso_pu_bacteria 2954016120 2954020551 405
63 iso_pu_bacteria 3003233435 3003236429 405
64 3300006844 Ga0075428_100037619 Ga0075428_1000376193 406
65 iso_pu_bacteria 2599185184 2599481184 406
66 iso_pu_bacteria 2890737413 2890740335 406
67 iso_pu_bacteria 2896344016 2896345393 406
68 iso_pu_bacteria 2898713307 2898714318 406
69 iso_pu_bacteria 2919437846 2919439671 406
70 iso_pu_bacteria 2928078545 2928081777 406
71 iso_pu_bacteria 2928147474 2928151804 406
72 iso_pu_bacteria 2932082852 2932087113 406
73 iso_pu_bacteria 2977232053 2977235171 406
74 3300005327 Ga0070658_10000884 Ga0070658_100008844 407
75 3300009093 Ga0105240_10120774 Ga0105240_101207743 407
76 3300013306 Ga0163162_10022712 Ga0163162_100227125 407
77 3300025909 Ga0207705_10007437 Ga0207705_100074372 407
78 3300028800 Ga0265338_10140469 Ga0265338_101404692 407
79 3300031241 Ga0265325_10008581 Ga0265325_100085812 407
80 3300031247 Ga0265340_10004486 Ga0265340_100044866 407
81 3300031711 Ga0265314_10048549 Ga0265314_100485493 407
82 3300001904 JGI24736J21556_1003721 JGI24736J21556_10037213 408
83 3300002737 JGI25162J39368_1001083 JGI25162J39368_100108310 408
84 3300003320 rootH2_10000579 rootH2_1000057925 408
85 3300005288 Ga0065714_10095798 Ga0065714_100957981 408
86 3300005328 Ga0070676_10003689 Ga0070676_100036899 408
87 3300005338 Ga0068868_100056895 Ga0068868_1000568951 408
88 3300005364 Ga0070673_100001687 Ga0070673_1000016877 408
89 3300005457 Ga0070662_100000050 Ga0070662_10000005023 408
90 3300005459 Ga0068867_100003010 Ga0068867_1000030106 408
91 3300005530 Ga0070679_100017867 Ga0070679_1000178672 408
92 3300005543 Ga0070672_100051349 Ga0070672_1000513492 408
93 3300005578 Ga0068854_100038287 Ga0068854_1000382873 408
94 3300005614 Ga0068856_100001838 Ga0068856_10000183813 408
95 3300005616 Ga0068852_100012048 Ga0068852_1000120485 408
96 3300005718 Ga0068866_10035411 Ga0068866_100354112 408
97 3300006195 Ga0075366_10001853 Ga0075366_100018539 408
98 3300006237 Ga0097621_100013237 Ga0097621_1000132374 408
99 3300006881 Ga0068865_100000100 Ga0068865_10000010043 408
100 3300009093 Ga0105240_10098370 Ga0105240_100983703 408
101 3300009093 Ga0105240_10346800 Ga0105240_103468001 408
102 3300009174 Ga0105241_10001803 Ga0105241_100018034 408
103 3300009174 Ga0105241_10008225 Ga0105241_100082255 408
104 3300009545 Ga0105237_10001139 Ga0105237_1000113926 408
105 3300009545 Ga0105237_10003373 Ga0105237_1000337314 408
106 3300009545 Ga0105237_10393832 Ga0105237_103938321 408
107 3300009545 Ga0105237_10393833 Ga0105237_103938331 408
108 3300009551 Ga0105238_10011689 Ga0105238_100116894 408
109 3300010375 Ga0105239_10004353 Ga0105239_100043535 408
110 3300010375 Ga0105239_10021250 Ga0105239_100212504 408
111 3300010375 Ga0105239_10124849 Ga0105239_101248492 408
112 3300013100 Ga0157373_10038385 Ga0157373_100383853 408
113 3300013105 Ga0157369_10195870 Ga0157369_101958702 408
114 3300013296 Ga0157374_10001143 Ga0157374_1000114312 408
115 3300013296 Ga0157374_10013032 Ga0157374_100130325 408
116 3300013297 Ga0157378_10005740 Ga0157378_100057406 408
117 3300013307 Ga0157372_10046367 Ga0157372_100463674 408
118 3300013308 Ga0157375_10009600 Ga0157375_100096005 408
119 3300014745 Ga0157377_10020716 Ga0157377_100207162 408
120 3300025233 Ga0209437_100124 Ga0209437_100124173 408
121 3300025904 Ga0207647_10000116 Ga0207647_1000011654 408
122 3300025907 Ga0207645_10000144 Ga0207645_1000014411 408
123 3300025911 Ga0207654_10054512 Ga0207654_100545122 408
124 3300025913 Ga0207695_10002684 Ga0207695_1000268417 408
125 3300025914 Ga0207671_10004911 Ga0207671_100049115 408
126 3300025914 Ga0207671_10011329 Ga0207671_100113292 408
127 3300025914 Ga0207671_10014231 Ga0207671_100142316 408
128 3300025914 Ga0207671_10256161 Ga0207671_102561611 408
129 3300025933 Ga0207706_10000007 Ga0207706_10000007147 408
130 3300025938 Ga0207704_10000125 Ga0207704_1000012538 408
131 3300025940 Ga0207691_10126544 Ga0207691_101265442 408
132 3300025949 Ga0207667_10144288 Ga0207667_101442882 408
133 3300025981 Ga0207640_10015057 Ga0207640_100150571 408
134 3300026078 Ga0207702_10012316 Ga0207702_100123169 408
135 3300026089 Ga0207648_10002420 Ga0207648_100024205 408
136 3300026142 Ga0207698_10015184 Ga0207698_100151844 408
137 3300028786 Ga0307517_10000363 Ga0307517_1000036341 408
138 3300028794 Ga0307515_10000528 Ga0307515_1000052860 408
139 3300028794 Ga0307515_10001024 Ga0307515_1000102424 408
140 3300028794 Ga0307515_10173320 Ga0307515_101733202 408
141 3300033179 Ga0307507_10003362 Ga0307507_1000336216 408
142 3300033180 Ga0307510_10000312 Ga0307510_1000031237 408
143 3300037312 Ga0395899_0000639 Ga0395899_0000639_15609_16916 408
144 3300037418 Ga0395900_0000738 Ga0395900_0000738_23160_24389 408
145 3300037418 Ga0395900_0001858 Ga0395900_0001858_15973_17280 408
146 3300037418 Ga0395900_0006350 Ga0395900_0006350_10722_11951 408
147 3300037466 Ga0395898_0040622 Ga0395898_0040622_465_1772 408
148 3300037471 Ga0395905_0001548 Ga0395905_0001548_7006_8313 408
149 3300038443 Ga0395901_0000542 Ga0395901_0000542_23114_24421 408
150 3300038443 Ga0395901_0001757 Ga0395901_0001757_11712_12941 408
151 3300039447 Ga0436361_0581767 Ga0436361_0581767_2481_3710 408
152 3300042005 Ga0439448_0035841 Ga0439448_0035841_214_1443 408
153 3300046462 Ga0495651_0114648 Ga0495651_0114648_506_1735 408
154 3300046492 Ga0495585_0025217 Ga0495585_0025217_1331_2560 408
155 3300046513 Ga0495616_0002949 Ga0495616_0002949_9122_10351 408
156 3300046518 Ga0495631_0002180 Ga0495631_0002180_6523_7950 408
157 3300046538 Ga0495609_0020653 Ga0495609_0020653_76_1305 408
158 3300046557 Ga0495622_0033310 Ga0495622_0033310_818_2047 408
159 3300046558 Ga0495633_0000500 Ga0495633_0000500_17220_18449 408
160 3300046616 Ga0495668_0000055 Ga0495668_0000055_181933_183162 408
161 3300046660 Ga0495625_0001421 Ga0495625_0001421_10170_11399 408
162 3300046660 Ga0495625_0003334 Ga0495625_0003334_5280_6509 408
163 3300046660 Ga0495625_0011898 Ga0495625_0011898_2941_4170 408
164 3300046660 Ga0495625_0049538 Ga0495625_0049538_351_1580 408
165 3300046665 Ga0495661_0003749 Ga0495661_0003749_788_2017 408
166 3300047443 Ga0495687_002416 Ga0495687_002416_12153_13382 408
167 3300047472 Ga0495686_0000152 Ga0495686_0000152_27898_29127 408
168 3300047472 Ga0495686_0055152 Ga0495686_0055152_471_1700 408
169 3300049459 Ga0495678_003423 Ga0495678_003423_7249_8478 408
170 3300049673 Ga0501240_000822 Ga0501240_000822_945_2171 408
171 3300050493 nmdc:mga0k408_70_c3 nmdc:mga0k408_70_c3_12062_13291 408
172 3300053122 Ga0500608_000304 Ga0500608_000304_4842_6071 408
173 iso_pu_bacteria 2884933994 2884935033 408
174 2162886007 SwRhRL2b_contig_1065277 SwRhRL2b_0518.00003420 409
175 2162886007 SwRhRL2b_contig_3910478 SwRhRL2b_0926.00008160 409
176 3300001989 JGI24739J22299_10051208 JGI24739J22299_100512081 409
177 3300001990 JGI24737J22298_10001223 JGI24737J22298_100012235 409
178 3300002067 JGI24735J21928_10000084 JGI24735J21928_1000008411 409
179 3300002067 JGI24735J21928_10031815 JGI24735J21928_100318151 409
180 3300002737 JGI25162J39368_1000630 JGI25162J39368_10006305 409
181 3300002772 JGI25164J39214_1001584 JGI25164J39214_10015845 409
182 3300002773 JGI25152J39213_1000028 JGI25152J39213_100002836 409
183 3300002774 JGI25150J39212_1000006 JGI25150J39212_1000006155 409
184 3300003187 JGI25151J46595_10000024 JGI25151J46595_1000002436 409
185 3300003214 JGI25165J46597_1001320 JGI25165J46597_100132014 409
186 3300003215 JGI25153J46596_10000026 JGI25153J46596_10000026156 409
187 3300003316 rootH1_10018659 rootH1_1001865915 409
188 3300003320 rootH2_10028941 rootH2_1002894110 409
189 3300003320 rootH2_10029452 rootH2_100294522 409
190 3300003320 rootH2_10058795 rootH2_100587953 409
191 3300003322 rootL2_10155837 rootL2_101558372 409
192 3300003323 rootH1_10001716 rootH1_1000171621 409
193 3300003323 rootH1_10152660 rootH1_101526603 409
194 3300003323 rootH1_10297020 rootH1_102970202 409
195 3300003781 Ga0055536_1000002 Ga0055536_1000002249 409
196 3300003791 Ga0055530_10004367 Ga0055530_100043676 409
197 3300005288 Ga0065714_10002724 Ga0065714_1000272415 409
198 3300005288 Ga0065714_10006746 Ga0065714_100067463 409
199 3300005288 Ga0065714_10013210 Ga0065714_100132102 409
200 3300005288 Ga0065714_10064473 Ga0065714_1006447348 409
201 3300005288 Ga0065714_10073478 Ga0065714_100734783 409
202 3300005288 Ga0065714_10074911 Ga0065714_100749113 409
203 3300005289 Ga0065704_10070311 Ga0065704_1007031111 409
204 3300005289 Ga0065704_10077214 Ga0065704_100772144 409
205 3300005327 Ga0070658_10116126 Ga0070658_101161261 409
206 3300005339 Ga0070660_100015432 Ga0070660_1000154328 409
207 3300005366 Ga0070659_100000076 Ga0070659_10000007643 409
208 3300005366 Ga0070659_100001241 Ga0070659_1000012414 409
209 3300005535 Ga0070684_100042759 Ga0070684_1000427594 409
210 3300005539 Ga0068853_100213274 Ga0068853_1002132742 409
211 3300005563 Ga0068855_100000177 Ga0068855_10000017739 409
212 3300005563 Ga0068855_100054320 Ga0068855_1000543204 409
213 3300005563 Ga0068855_100367079 Ga0068855_1003670791 409
214 3300005577 Ga0068857_100022903 Ga0068857_1000229035 409
215 3300005577 Ga0068857_100096796 Ga0068857_1000967963 409
216 3300005614 Ga0068856_100000292 Ga0068856_10000029245 409
217 3300006195 Ga0075366_10002626 Ga0075366_100026265 409
218 3300009036 Ga0105244_10015268 Ga0105244_100152684 409
219 3300009093 Ga0105240_10000158 Ga0105240_10000158103 409
220 3300009093 Ga0105240_10012192 Ga0105240_1001219210 409
221 3300009093 Ga0105240_10171511 Ga0105240_101715111 409
222 3300009093 Ga0105240_10256435 Ga0105240_102564352 409
223 3300009174 Ga0105241_10009182 Ga0105241_100091822 409
224 3300009545 Ga0105237_10000311 Ga0105237_1000031164 409
225 3300009545 Ga0105237_10000621 Ga0105237_1000062143 409
226 3300009545 Ga0105237_10001268 Ga0105237_1000126822 409
227 3300009545 Ga0105237_10009763 Ga0105237_100097632 409
228 3300010375 Ga0105239_10000014 Ga0105239_10000014300 409
229 3300010375 Ga0105239_10000674 Ga0105239_1000067413 409
230 3300010375 Ga0105239_10000859 Ga0105239_1000085932 409
231 3300010375 Ga0105239_10001824 Ga0105239_1000182413 409
232 3300013100 Ga0157373_10002248 Ga0157373_1000224811 409
233 3300013100 Ga0157373_10005767 Ga0157373_100057678 409
234 3300013100 Ga0157373_10021394 Ga0157373_100213942 409
235 3300013100 Ga0157373_10022241 Ga0157373_100222412 409
236 3300013100 Ga0157373_10028204 Ga0157373_100282043 409
237 3300013102 Ga0157371_10000224 Ga0157371_1000022432 409
238 3300013102 Ga0157371_10000629 Ga0157371_100006295 409
239 3300013102 Ga0157371_10001836 Ga0157371_1000183622 409
240 3300013102 Ga0157371_10003389 Ga0157371_100033898 409
241 3300013102 Ga0157371_10011216 Ga0157371_100112162 409
242 3300013104 Ga0157370_10002047 Ga0157370_1000204710 409
243 3300013104 Ga0157370_10006976 Ga0157370_100069768 409
244 3300013104 Ga0157370_10037314 Ga0157370_100373146 409
245 3300013104 Ga0157370_10038873 Ga0157370_100388734 409
246 3300013104 Ga0157370_10077687 Ga0157370_100776874 409
247 3300013104 Ga0157370_10115359 Ga0157370_101153591 409
248 3300013104 Ga0157370_10123069 Ga0157370_101230693 409
249 3300013104 Ga0157370_10126200 Ga0157370_101262002 409
250 3300013104 Ga0157370_10180207 Ga0157370_101802072 409
251 3300013105 Ga0157369_10000158 Ga0157369_1000015858 409
252 3300013306 Ga0163162_10000011 Ga0163162_1000001154 409
253 3300013306 Ga0163162_10003376 Ga0163162_1000337611 409
254 3300013307 Ga0157372_10004006 Ga0157372_1000400610 409
255 3300013307 Ga0157372_10018711 Ga0157372_100187116 409
256 3300013307 Ga0157372_10060169 Ga0157372_100601693 409
257 3300013308 Ga0157375_10009417 Ga0157375_100094179 409
258 3300014497 Ga0182008_10000046 Ga0182008_1000004664 409
259 3300014497 Ga0182008_10000047 Ga0182008_1000004711 409
260 3300014497 Ga0182008_10000099 Ga0182008_1000009915 409
261 3300015261 Ga0182006_1000241 Ga0182006_100024144 409
262 3300015261 Ga0182006_1000397 Ga0182006_100039730 409
263 3300015261 Ga0182006_1000513 Ga0182006_100051323 409
264 3300015261 Ga0182006_1020788 Ga0182006_10207882 409
265 3300015261 Ga0182006_1032208 Ga0182006_10322083 409
266 3300015262 Ga0182007_10000008 Ga0182007_1000000831 409
267 3300015262 Ga0182007_10014917 Ga0182007_100149172 409
268 3300015682 Ga0183373_1002 Ga0183373_1002304 409
269 3300017792 Ga0163161_10000570 Ga0163161_100005706 409
270 3300017792 Ga0163161_10000622 Ga0163161_1000062231 409
271 3300017792 Ga0163161_10000650 Ga0163161_100006505 409
272 3300017792 Ga0163161_10003520 Ga0163161_1000352014 409
273 3300017792 Ga0163161_10022780 Ga0163161_100227802 409
274 3300025231 Ga0207427_100685 Ga0207427_1006856 409
275 3300025233 Ga0209437_100021 Ga0209437_1000216 409
276 3300025245 Ga0207425_1000003 Ga0207425_1000003154 409
277 3300025250 Ga0209026_1000246 Ga0209026_100024655 409
278 3300025258 Ga0209129_1000022 Ga0209129_1000022153 409
279 3300025261 Ga0209233_1000264 Ga0209233_10002646 409
280 3300025292 Ga0209676_1000022 Ga0209676_1000022290 409
281 3300025294 Ga0209025_1000007 Ga0209025_1000007153 409
282 3300025297 Ga0209758_1000012 Ga0209758_1000012154 409
283 3300025298 Ga0209050_1000020 Ga0209050_1000020249 409
284 3300025728 Ga0207655_1014897 Ga0207655_10148974 409
285 3300025904 Ga0207647_10000041 Ga0207647_1000004182 409
286 3300025904 Ga0207647_10091913 Ga0207647_100919131 409
287 3300025913 Ga0207695_10000235 Ga0207695_10000235103 409
288 3300025913 Ga0207695_10012959 Ga0207695_100129593 409
289 3300025913 Ga0207695_10078050 Ga0207695_100780504 409
290 3300025914 Ga0207671_10001046 Ga0207671_1000104623 409
291 3300025914 Ga0207671_10005374 Ga0207671_1000537410 409
292 3300025914 Ga0207671_10049074 Ga0207671_100490742 409
293 3300025919 Ga0207657_10167321 Ga0207657_101673212 409
294 3300025924 Ga0207694_10123275 Ga0207694_101232752 409
295 3300025932 Ga0207690_10000049 Ga0207690_1000004914 409
296 3300025932 Ga0207690_10003530 Ga0207690_100035306 409
297 3300025949 Ga0207667_10000070 Ga0207667_10000070118 409
298 3300025949 Ga0207667_10062710 Ga0207667_100627103 409
299 3300026041 Ga0207639_10154708 Ga0207639_101547081 409
300 3300026078 Ga0207702_10000319 Ga0207702_1000031911 409
301 3300026078 Ga0207702_10013905 Ga0207702_100139055 409
302 3300026116 Ga0207674_10012156 Ga0207674_100121569 409
303 3300026116 Ga0207674_10114699 Ga0207674_101146992 409
304 3300028794 Ga0307515_10015757 Ga0307515_100157574 409
305 3300030731 Ga0316177_1116921 Ga0316177_11169216 409
306 3300030732 Ga0316176_1123546 Ga0316176_11235464 409
307 3300030742 Ga0316183_1054866 Ga0316183_105486611 409
308 3300030744 Ga0316181_1126086 Ga0316181_11260865 409
309 3300031548 Ga0307408_100000291 Ga0307408_10000029121 409
310 3300031548 Ga0307408_100001056 Ga0307408_10000105610 409
311 3300031548 Ga0307408_100001216 Ga0307408_10000121610 409
312 3300031731 Ga0307405_10000014 Ga0307405_1000001452 409
313 3300031903 Ga0307407_10000002 Ga0307407_10000002219 409
314 3300031911 Ga0307412_10000001 Ga0307412_10000001583 409
315 3300031911 Ga0307412_10001323 Ga0307412_1000132315 409
316 3300032002 Ga0307416_100000005 Ga0307416_100000005221 409
317 3300032004 Ga0307414_10000599 Ga0307414_100005991 409
318 3300032004 Ga0307414_10002461 Ga0307414_100024619 409
319 3300032004 Ga0307414_10003760 Ga0307414_100037605 409
320 3300032004 Ga0307414_10003765 Ga0307414_100037656 409
321 3300032004 Ga0307414_10122265 Ga0307414_101222653 409
322 3300032005 Ga0307411_10180905 Ga0307411_101809052 409
323 3300037312 Ga0395899_0000017 Ga0395899_0000017_84069_85298 409
324 3300046462 Ga0495651_0157064 Ga0495651_0157064_294_1526 409
325 3300046471 Ga0495650_0000095 Ga0495650_0000095_78986_80218 409
326 3300046492 Ga0495585_0000057 Ga0495585_0000057_86195_87427 409
327 3300046506 Ga0495583_0003801 Ga0495583_0003801_4324_5556 409
328 3300046507 Ga0495606_0000009 Ga0495606_0000009_170402_171634 409
329 3300046507 Ga0495606_0005151 Ga0495606_0005151_4069_5298 409
330 3300046512 Ga0495610_0000204 Ga0495610_0000204_3109_4341 409
331 3300046512 Ga0495610_0000279 Ga0495610_0000279_3772_5004 409
332 3300046512 Ga0495610_0000783 Ga0495610_0000783_28525_29757 409
333 3300046513 Ga0495616_0004226 Ga0495616_0004226_2375_3607 409
334 3300046520 Ga0495637_0006497 Ga0495637_0006497_2767_3999 409
335 3300046520 Ga0495637_0031868 Ga0495637_0031868_374_1606 409
336 3300046523 Ga0495644_0024226 Ga0495644_0024226_129_1361 409
337 3300046558 Ga0495633_0007091 Ga0495633_0007091_669_1901 409
338 3300046660 Ga0495625_0000007 Ga0495625_0000007_161087_162319 409
339 3300046665 Ga0495661_0020191 Ga0495661_0020191_1026_2258 409
340 3300046694 Ga0495649_0000007 Ga0495649_0000007_273097_274329 409
341 3300047469 Ga0495673_0024267 Ga0495673_0024267_1579_2811 409
342 3300047472 Ga0495686_0035907 Ga0495686_0035907_1862_3097 409
343 3300048918 Ga0496115_0075335 Ga0496115_0075335_1056_2285 409
344 3300048919 Ga0496116_0003748 Ga0496116_0003748_11711_12940 409
345 3300048920 Ga0496117_0002427 Ga0496117_0002427_18136_19365 409
346 3300048925 Ga0496122_0001886 Ga0496122_0001886_11938_13167 409
347 3300048925 Ga0496122_0017077 Ga0496122_0017077_5095_6324 409
348 3300048926 Ga0496123_0001009 Ga0496123_0001009_5479_6708 409
349 3300049663 Ga0501223_000906 Ga0501223_000906_5525_6754 409
350 3300049758 Ga0501241_001568 Ga0501241_001568_3263_4492 409
351 3300050493 nmdc:mga0k408_18909_c1 nmdc:mga0k408_18909_c1_698_1930 409
352 3300053125 Ga0500618_000011 Ga0500618_000011_135165_136397 409
353 3300053157 Ga0500624_000895 Ga0500624_000895_5094_6326 409

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00675

Peptidase_M16

Insulinase (Peptidase family M16)

94

241

0.96

PF05193

Peptidase_M16_C

Peptidase M16 inactive domain

246

422

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hdi-assembly1.cif.gz_B crystal structure of bacillus halodurans metallo peptidase 0.9599 4 406
7v4y-assembly1.cif.gz_A ttha1264/ttha1265 complex 0.9498 1 407
7v4y-assembly1.cif.gz_A ttha1264/ttha1265 complex 0.9475 1 407
3amj-assembly1.cif.gz_B the crystal structure of the heterodimer of m16b peptidase from sphingomonas sp. a1 0.9417 2 408
1bcc-assembly1.cif.gz_A cytochrome bc1 complex from chicken 0.9417 2 408
ID Description Score Start End Superfamily
1ntkA01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9772 4 208 3.30.830.10
af_P9WHT5_3_225_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9709 2 205 3.30.830.10
af_P98080_18_243_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9671 2 207 3.30.830.10
af_Q23295_11_239_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9668 2 211 3.30.830.10
af_A0A1D6G373_49_271_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9593 2 210 3.30.830.10
ID Description Score Start End GO Terms
AF-A0A2N2WAK9-F1-model_v4 Peptidase M16 0.9902 1 408 GO:0046872
AF-A0A7Y2A0J5-F1-model_v4 Insulinase family protein 0.9896 2 405 GO:0046872
AF-A0A2N2WAK9-F1-model_v4 Peptidase M16 0.9878 1 408 GO:0046872
AF-K1SZW8-F1-model_v4 Zinc protease ymxG 0.9834 1 307 GO:0006508
GO:0008233
GO:0046872
AF-A0A0M3CCJ1-F1-model_v4 deleted 0.9824 1 108

Feature Viewer

pLDDT pTM Quality
94.76 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map