F419476

General Info

Members Datasets Scaffolds Average Seq Length
353 218 706 269

Family's Representative Sequence

Representative Sequence 3300041486|Ga0451807_2614339|Ga0451807_2614339_165_1079
Length 304
Sequence MMHPMVNTAVKAARRAGNIINRASQNLDILAVSEKAVHDYVSEVDREAEQAIIRILHEAYPSHAILAEESGASGKSEYQWIIDPLDGTTNFLHGFPQYAVSIALAHKEVMSQAVIYDPVRNDLFTASRGRGAYLNDKRLRISKRIKLNKSLIGTGFPFREFAHIDAYLAIFRDLTEKTSGMRRAGAATLDLAYVAAGRLDGFWEFGLSPWDMAAGSLLITESGGLVGDLEGNSGYMQSGNIVAGNPLVFGQLIQALAPHLTPALKTKTRPKGRVLRFCALSQRDGKSRSHLTVLQARSGRLLPT

Samples

Sample ID Description Type Environment
1 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
2 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
129 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
130 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
131 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
134 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
135 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
146 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
150 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
215 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 6.52
Rhizosphere 91.5
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451807_2614339 3300041486 Bacteria 1255
2 Ga0055535_1000167 3300003761 Bacteria 71096
3 Ga0070658_10019827 3300005327 Bacteria 5386
4 Ga0070676_10254328 3300005328 Bacteria 1174
5 Ga0070683_100004472 3300005329 Bacteria 11534
6 Ga0070690_100052825 3300005330 Bacteria 2598
7 Ga0070690_100139640 3300005330 Bacteria 1644
8 Ga0070670_100000425 3300005331 Bacteria 34805
9 Ga0070670_100269894 3300005331 Bacteria 1484
10 Ga0068869_100365476 3300005334 Bacteria 1179
11 Ga0068869_100525804 3300005334 Bacteria 991
12 Ga0070666_10001027 3300005335 Bacteria 17099
13 Ga0070666_10183492 3300005335 Bacteria 1468
14 Ga0070680_100075389 3300005336 Bacteria 2777
15 Ga0070682_100126159 3300005337 Bacteria 1725
16 Ga0068868_100000145 3300005338 Bacteria 46047
17 Ga0068868_100054390 3300005338 Bacteria 3154
18 Ga0070660_100003022 3300005339 Bacteria 11582
19 Ga0070689_100038362 3300005340 Bacteria 3665
20 Ga0070687_100067545 3300005343 Bacteria 1909
21 Ga0070661_100002717 3300005344 Bacteria 12130
22 Ga0070669_100101562 3300005353 Bacteria 2170
23 Ga0070675_100003704 3300005354 Bacteria 11616
24 Ga0070675_100132216 3300005354 Bacteria 2127
25 Ga0070675_100253631 3300005354 Bacteria 1540
26 Ga0070675_100257994 3300005354 Bacteria 1527
27 Ga0070671_100077132 3300005355 Bacteria 2785
28 Ga0070674_100103848 3300005356 Bacteria 2076
29 Ga0070674_100210541 3300005356 Bacteria 1506
30 Ga0070673_100002718 3300005364 Bacteria 10846
31 Ga0070673_100110218 3300005364 Bacteria 2281
32 Ga0070673_100168986 3300005364 Bacteria 1865
33 Ga0070659_100027679 3300005366 Bacteria 4370
34 Ga0070667_100028749 3300005367 Bacteria 4629
35 Ga0070714_100000938 3300005435 Bacteria 20743
36 Ga0070714_100035146 3300005435 Bacteria 4198
37 Ga0070714_100050143 3300005435 Bacteria 3554
38 Ga0070713_100121133 3300005436 Bacteria 2295
39 Ga0070713_100185935 3300005436 Bacteria 1870
40 Ga0070701_10024119 3300005438 Bacteria 2940
41 Ga0070701_10191312 3300005438 Bacteria 1204
42 Ga0070705_100042140 3300005440 Bacteria 2608
43 Ga0070700_100080913 3300005441 Bacteria 2097
44 Ga0070663_100136791 3300005455 Bacteria 1866
45 Ga0070678_100000715 3300005456 Bacteria 16451
46 Ga0070678_100155753 3300005456 Bacteria 1845
47 Ga0070662_100215034 3300005457 Bacteria 1531
48 Ga0070662_100478331 3300005457 Bacteria 1037
49 Ga0070681_10034307 3300005458 Bacteria 5095
50 Ga0070681_10430075 3300005458 Bacteria 1232
51 Ga0068867_100537596 3300005459 Bacteria 1010
52 Ga0068867_100561060 3300005459 Bacteria 990
53 Ga0070697_100183535 3300005536 Bacteria 1774
54 Ga0070672_100013925 3300005543 Bacteria 5690
55 Ga0070672_100422687 3300005543 Bacteria 1145
56 Ga0070695_100011070 3300005545 Bacteria 5391
57 Ga0070665_100036872 3300005548 Bacteria 4917
58 Ga0070665_100059310 3300005548 Bacteria 3836
59 Ga0070704_100127730 3300005549 Bacteria 1964
60 Ga0070704_100539688 3300005549 Bacteria 1018
61 Ga0068855_100000072 3300005563 Bacteria 121486
62 Ga0068855_100196913 3300005563 Bacteria 2270
63 Ga0070664_100000316 3300005564 Bacteria 35228
64 Ga0070702_100093426 3300005615 Bacteria 1829
65 Ga0068852_100000229 3300005616 Bacteria 38015
66 Ga0068859_100147026 3300005617 Bacteria 2432
67 Ga0068859_100196445 3300005617 Bacteria 2102
68 Ga0068864_100047430 3300005618 Bacteria 3690
69 Ga0068864_100074562 3300005618 Bacteria 2961
70 Ga0068861_100202953 3300005719 Bacteria 1665
71 Ga0068851_10005868 3300005834 Bacteria 5592
72 Ga0068851_10156404 3300005834 Bacteria 1249
73 Ga0068863_100025456 3300005841 Bacteria 5643
74 Ga0068863_100026541 3300005841 Bacteria 5524
75 Ga0068858_100005423 3300005842 Bacteria 12496
76 Ga0068860_100005932 3300005843 Bacteria 12294
77 Ga0068862_100397048 3300005844 Bacteria 1289
78 Ga0070712_100253559 3300006175 Bacteria 1407
79 Ga0097621_100001309 3300006237 Bacteria 17131
80 Ga0097621_100238420 3300006237 Bacteria 1589
81 Ga0068871_100001685 3300006358 Bacteria 14824
82 Ga0068871_100005027 3300006358 Bacteria 9238
83 Ga0075428_100001685 3300006844 Bacteria 23558
84 Ga0075428_100262298 3300006844 Bacteria 1860
85 Ga0075430_100015343 3300006846 Bacteria 6525
86 Ga0075431_100000405 3300006847 Bacteria 34877
87 Ga0075433_10004572 3300006852 Bacteria 10793
88 Ga0075434_100001228 3300006871 Bacteria 21308
89 Ga0075434_100399941 3300006871 Unclassified 1394
90 Ga0075429_100010491 3300006880 Bacteria 8011
91 Ga0075429_100161867 3300006880 Bacteria 1960
92 Ga0097620_100147034 3300006931 Bacteria 2432
93 Ga0097620_100196423 3300006931 Bacteria 2102
94 Ga0075435_100112915 3300007076 Bacteria 2261
95 Ga0099794_10073521 3300007265 Bacteria 1678
96 Ga0099795_10000001 3300007788 Bacteria 179944
97 Ga0099795_10001756 3300007788 Bacteria 4850
98 Ga0111539_10013818 3300009094 Bacteria 10090
99 Ga0111539_10040464 3300009094 Bacteria 5612
100 Ga0111539_10218303 3300009094 Bacteria 2221
101 Ga0105245_10012117 3300009098 Bacteria 7498
102 Ga0105245_10040112 3300009098 Bacteria 4169
103 Ga0114129_10172397 3300009147 Bacteria 2948
104 Ga0105242_10073964 3300009176 Bacteria 2834
105 Ga0105242_10266441 3300009176 Bacteria 1550
106 Ga0105248_10130650 3300009177 Bacteria 2833
107 Ga0105248_10143914 3300009177 Bacteria 2690
108 Ga0105237_10461432 3300009545 Bacteria 1276
109 Ga0105238_10212884 3300009551 Bacteria 1909
110 Ga0099796_10000001 3300010159 Bacteria 107173
111 Ga0157371_10289519 3300013102 Bacteria 1184
112 Ga0157370_10027902 3300013104 Bacteria 5561
113 Ga0157369_10779723 3300013105 Bacteria 983
114 Ga0157374_10000860 3300013296 Bacteria 26547
115 Ga0157374_10018024 3300013296 Bacteria 6226
116 Ga0157378_10004072 3300013297 Bacteria 12914
117 Ga0157378_10065959 3300013297 Bacteria 3241
118 Ga0163162_10016546 3300013306 Bacteria 7207
119 Ga0163162_10412550 3300013306 Bacteria 1483
120 Ga0157375_10007106 3300013308 Bacteria 9777
121 Ga0157375_10388958 3300013308 Bacteria 1561
122 Ga0163163_10002837 3300014325 Bacteria 14648
123 Ga0157380_10110041 3300014326 Bacteria 2313
124 Ga0157380_10113111 3300014326 Bacteria 2285
125 Ga0157380_10139807 3300014326 Bacteria 2078
126 Ga0157377_10035191 3300014745 Bacteria 2745
127 Ga0157379_10004663 3300014968 Bacteria 11761
128 Ga0157376_10004036 3300014969 Bacteria 10152
129 Ga0157376_10014114 3300014969 Bacteria 5983
130 Ga0163161_10236604 3300017792 Bacteria 1419
131 Ga0207656_10008437 3300025321 Bacteria 3794
132 Ga0207656_10083694 3300025321 Bacteria 1438
133 Ga0207682_10003380 3300025893 Bacteria 6947
134 Ga0207645_10034564 3300025907 Bacteria 3248
135 Ga0207643_10009078 3300025908 Bacteria 5340
136 Ga0207705_10008649 3300025909 Bacteria 7419
137 Ga0207707_10061039 3300025912 Bacteria 3280
138 Ga0207707_10386010 3300025912 Bacteria 1203
139 Ga0207662_10068403 3300025918 Bacteria 2145
140 Ga0207646_10045803 3300025922 Bacteria 3925
141 Ga0207681_10453240 3300025923 Bacteria 1044
142 Ga0207694_10151899 3300025924 Bacteria 1866
143 Ga0207650_10001393 3300025925 Bacteria 17447
144 Ga0207659_10003124 3300025926 Bacteria 9898
145 Ga0207659_10032634 3300025926 Bacteria 3576
146 Ga0207659_10085094 3300025926 Bacteria 2348
147 Ga0207664_10001788 3300025929 Bacteria 14163
148 Ga0207664_10049216 3300025929 Bacteria 3317
149 Ga0207690_10017584 3300025932 Bacteria 4370
150 Ga0207706_10019630 3300025933 Bacteria 6080
151 Ga0207686_10193236 3300025934 Bacteria 1452
152 Ga0207670_10050295 3300025936 Bacteria 2792
153 Ga0207669_10073322 3300025937 Bacteria 2159
154 Ga0207691_10000667 3300025940 Bacteria 33915
155 Ga0207691_10053596 3300025940 Bacteria 3682
156 Ga0207691_10120645 3300025940 Bacteria 2324
157 Ga0207691_10260991 3300025940 Bacteria 1493
158 Ga0207711_10002694 3300025941 Bacteria 15698
159 Ga0207711_10014099 3300025941 Bacteria 6641
160 Ga0207689_10048275 3300025942 Bacteria 3511
161 Ga0207689_10141572 3300025942 Bacteria 1981
162 Ga0207661_10002441 3300025944 Bacteria 12808
163 Ga0207679_10000649 3300025945 Bacteria 23237
164 Ga0207679_10145906 3300025945 Bacteria 1919
165 Ga0207651_10061319 3300025960 Bacteria 2615
166 Ga0207651_10426143 3300025960 Bacteria 1134
167 Ga0207668_10476564 3300025972 Bacteria 1070
168 Ga0207658_10009511 3300025986 Bacteria 6598
169 Ga0207677_10002541 3300026023 Bacteria 9570
170 Ga0207677_10119344 3300026023 Bacteria 1980
171 Ga0207677_10203741 3300026023 Bacteria 1574
172 Ga0207703_10069468 3300026035 Bacteria 2905
173 Ga0207678_10160899 3300026067 Bacteria 1917
174 Ga0207708_10038460 3300026075 Bacteria 3644
175 Ga0207641_10004933 3300026088 Bacteria 11459
176 Ga0207641_10018984 3300026088 Bacteria 5640
177 Ga0207648_10030965 3300026089 Bacteria 4733
178 Ga0207648_10374245 3300026089 Bacteria 1287
179 Ga0207676_10038029 3300026095 Bacteria 3671
180 Ga0207676_10057056 3300026095 Bacteria 3074
181 Ga0207674_10049157 3300026116 Bacteria 4314
182 Ga0207674_10348966 3300026116 Bacteria 1431
183 Ga0207675_100065930 3300026118 Bacteria 3384
184 Ga0207683_10001353 3300026121 Bacteria 22149
185 Ga0207683_10132779 3300026121 Bacteria 2240
186 Ga0207698_10000201 3300026142 Bacteria 37485
187 Ga0209179_1000006 3300027512 Bacteria 101289
188 Ga0209971_1020636 3300027682 Bacteria 1567
189 Ga0207428_10376002 3300027907 Bacteria 1043
190 Ga0268266_10034651 3300028379 Bacteria 4294
191 Ga0268266_10040174 3300028379 Bacteria 3987
192 Ga0268266_10372741 3300028379 Bacteria 1345
193 Ga0268265_10293347 3300028380 Bacteria 1461
194 Ga0268265_10392762 3300028380 Bacteria 1280
195 Ga0268264_10169199 3300028381 Bacteria 1975
196 Ga0265326_10000879 3300028558 Bacteria 10929
197 Ga0265326_10008960 3300028558 Bacteria 2998
198 Ga0265334_10000015 3300028573 Bacteria 150318
199 Ga0265334_10012646 3300028573 Bacteria 3544
200 Ga0265334_10076576 3300028573 Bacteria 1239
201 Ga0265323_10005604 3300028653 Bacteria 5327
202 Ga0265322_10020853 3300028654 Bacteria 1877
203 Ga0265338_10005171 3300028800 Bacteria 17142
204 Ga0265338_10147851 3300028800 Bacteria 1830
205 Ga0265330_10046389 3300031235 Bacteria 1915
206 Ga0265332_10001626 3300031238 Bacteria 12300
207 Ga0265332_10007450 3300031238 Bacteria 4946
208 Ga0265328_10009856 3300031239 Bacteria 3869
209 Ga0265328_10094912 3300031239 Bacteria 1103
210 Ga0265320_10107249 3300031240 Bacteria 1282
211 Ga0265331_10003020 3300031250 Bacteria 11038
212 Ga0265331_10003444 3300031250 Bacteria 10229
213 Ga0265331_10076046 3300031250 Bacteria 1565
214 Ga0265327_10000133 3300031251 Bacteria 163887
215 Ga0265327_10000542 3300031251 Bacteria 64581
216 Ga0265327_10017618 3300031251 Bacteria 4470
217 Ga0265316_10000744 3300031344 Bacteria 36026
218 Ga0265316_10093678 3300031344 Bacteria 2289
219 Ga0307509_10000075 3300031507 Bacteria 139230
220 Ga0307408_100274899 3300031548 Bacteria 1400
221 Ga0265313_10000277 3300031595 Bacteria 56206
222 Ga0265313_10009298 3300031595 Bacteria 6394
223 Ga0265314_10000335 3300031711 Bacteria 66101
224 Ga0265342_10031276 3300031712 Bacteria 3292
225 Ga0316576_10023367 3300031727 Bacteria 4305
226 Ga0316577_10008398 3300031733 Bacteria 5534
227 Ga0316577_10020998 3300031733 Bacteria 3620
228 Ga0307412_10253090 3300031911 Bacteria 1369
229 Ga0307416_100114615 3300032002 Bacteria 2385
230 Ga0316583_10005090 3300032133 Bacteria 4706
231 Ga0316585_10011152 3300032137 Bacteria 2646
232 Ga0307510_10252581 3300033180 Bacteria 1250
233 Ga0373934_0121447 3300035086 Bacteria 1063
234 Ga0373936_0059454 3300035113 Bacteria 1558
235 Ga0373956_0083627 3300035119 Bacteria 1467
236 Ga0373962_0063301 3300035242 Bacteria 1091
237 Ga0373931_0123239 3300035691 Bacteria 1484
238 Ga0373933_0036513 3300035724 Bacteria 2877
239 Ga0373933_0097291 3300035724 Bacteria 1823
240 Ga0373937_0150272 3300036401 Bacteria 2181
241 Ga0373937_0465853 3300036401 Bacteria 1200
242 Ga0316582_0112152 3300036647 Bacteria 1816
243 Ga0316582_0209160 3300036647 Bacteria 1332
244 Ga0373925_0398192 3300037068 Bacteria 1123
245 Ga0395901_0000533 3300038443 Bacteria 43906
246 Ga0451577_0000600 3300042876 Bacteria 57931
247 Ga0451577_0005072 3300042876 Bacteria 13595
248 Ga0451577_0009608 3300042876 Bacteria 9285
249 Ga0451577_0036021 3300042876 Bacteria 4457
250 Ga0451577_0440942 3300042876 Bacteria 1182
251 Ga0453684_0000005 3300044712 Bacteria 1431632
252 Ga0453684_0000356 3300044712 Bacteria 189329
253 Ga0453684_0002166 3300044712 Bacteria 49117
254 Ga0453684_0002541 3300044712 Bacteria 43926
255 Ga0453684_0047079 3300044712 Bacteria 5725
256 Ga0453684_0058955 3300044712 Bacteria 4954
257 Ga0453684_0082346 3300044712 Bacteria 4009
258 Ga0453684_0221837 3300044712 Unclassified 2189
259 Ga0453684_0353799 3300044712 Bacteria 1655
260 Ga0453684_0473813 3300044712 Bacteria 1390
261 Ga0466970_0015640 3300044765 Bacteria 3905
262 Ga0451576_0000634 3300045051 Bacteria 73076
263 Ga0451576_0002387 3300045051 Bacteria 28262
264 Ga0451576_0012343 3300045051 Bacteria 9598
265 Ga0451576_0075251 3300045051 Bacteria 3513
266 Ga0451576_0230102 3300045051 Bacteria 1936
267 Ga0451576_0237444 3300045051 Bacteria 1904
268 Ga0451576_0840879 3300045051 Bacteria 963
269 Ga0495603_0137281 3300046455 Bacteria 1423
270 Ga0495642_0032982 3300046528 Bacteria 2081
271 Ga0495670_0069415 3300046691 Bacteria 1782
272 Ga0496100_0065688 3300048903 Bacteria 2405
273 Ga0496101_0018622 3300048904 Bacteria 4725
274 Ga0496102_0217706 3300048905 Bacteria 1800
275 Ga0496104_0030300 3300048907 Bacteria 5026
276 Ga0496104_0047596 3300048907 Bacteria 4041
277 Ga0496105_0004965 3300048908 Bacteria 10057
278 Ga0496105_0009078 3300048908 Bacteria 7756
279 Ga0496106_0194524 3300048909 Bacteria 1613
280 Ga0496108_0008184 3300048911 Bacteria 8486
281 Ga0496108_0123628 3300048911 Bacteria 2220
282 Ga0496109_0009828 3300048912 Bacteria 8165
283 Ga0496109_0018297 3300048912 Bacteria 6153
284 Ga0496110_0009462 3300048913 Bacteria 7889
285 Ga0496110_0069388 3300048913 Bacteria 3121
286 Ga0496110_0650697 3300048913 Bacteria 954
287 Ga0496111_0078748 3300048914 Bacteria 2403
288 Ga0496112_0755254 3300048915 Bacteria 899
289 Ga0496114_0007489 3300048917 Bacteria 8630
290 Ga0496114_0020480 3300048917 Bacteria 5368
291 Ga0496114_0098586 3300048917 Bacteria 2492
292 Ga0496114_0127385 3300048917 Bacteria 2196
293 Ga0496115_0033775 3300048918 Bacteria 4040
294 Ga0496122_0089649 3300048925 Unclassified 2102
295 Ga0496125_0007840 3300048928 Bacteria 11284
296 Ga0501033_0334871 3300049570 Bacteria 1062
297 Ga0501034_0032459 3300049571 Bacteria 5302
298 Ga0501034_0137042 3300049571 Bacteria 2428
299 Ga0501038_0055265 3300049574 Bacteria 3411
300 Ga0501039_0073631 3300049575 Bacteria 2654
301 Ga0501039_0264597 3300049575 Bacteria 1351
302 Ga0501040_0060378 3300049576 Bacteria 2605
303 Ga0501041_0000884 3300049577 Bacteria 16204
304 Ga0501041_0002450 3300049577 Bacteria 10538
305 Ga0501042_0031586 3300049578 Bacteria 3746
306 Ga0501043_0053993 3300049579 Bacteria 3155
307 Ga0501043_0203194 3300049579 Bacteria 1537
308 Ga0501048_0382542 3300049582 Bacteria 1005
309 Ga0501048_0474660 3300049582 Bacteria 896
310 Ga0501068_0136294 3300049584 Bacteria 1537
311 Ga0501068_0153991 3300049584 Bacteria 1446
312 Ga0501071_0070881 3300049587 Bacteria 2540
313 Ga0501071_0091162 3300049587 Bacteria 2239
314 Ga0501071_0557569 3300049587 Bacteria 880
315 Ga0501072_0017175 3300049588 Bacteria 5561
316 Ga0501072_0067834 3300049588 Bacteria 2815
317 Ga0501072_0253610 3300049588 Bacteria 1401
318 Ga0501073_0162704 3300049589 Bacteria 1546
319 Ga0501074_0162176 3300049590 Bacteria 1597
320 Ga0501075_0065866 3300049591 Bacteria 2733
321 Ga0501075_0273012 3300049591 Bacteria 1288
322 Ga0501076_0000468 3300049592 Bacteria 25466
323 Ga0501077_0026400 3300049593 Bacteria 3686
324 Ga0501077_0079534 3300049593 Bacteria 2077
325 Ga0501209_003130 3300049656 Bacteria 2678
326 Ga0501079_0015588 3300049741 Bacteria 5802
327 Ga0501079_0126920 3300049741 Bacteria 1984
328 Ga0501080_0132331 3300049742 Bacteria 2309
329 Ga0501080_0177925 3300049742 Bacteria 1959
330 Ga0501081_0002318 3300049743 Bacteria 11987
331 Ga0501081_0017127 3300049743 Bacteria 4794
332 Ga0501081_0054554 3300049743 Bacteria 2761
333 Ga0501081_0074275 3300049743 Bacteria 2372
334 Ga0501081_0483388 3300049743 Bacteria 922
335 Ga0501083_0217124 3300049744 Bacteria 1246
336 Ga0501045_0370673 3300049824 Bacteria 1066
337 nmdc:mga05p37_976373_c1 3300050507 Bacteria 903
338 nmdc:mga09592_40910_c1 3300050508 Bacteria 3895
339 nmdc:mga06r32_20088_c1 3300050510 Bacteria 6143
340 nmdc:mga08y16_116993_c1 3300050511 Bacteria 2775
341 nmdc:mga08y16_27642_c1 3300050511 Bacteria 5977
342 nmdc:mga0n895_239381_c1 3300050512 Bacteria 1841
343 nmdc:mga0n895_4260_c1 3300050512 Bacteria 11703
344 nmdc:mga0rr50_282417_c1 3300050513 Bacteria 1385
345 nmdc:mga0a205_5798_c2 3300050515 Bacteria 10708
346 Ga0500590_054878 3300053148 Bacteria 2017
347 Ga0500637_0111972 3300053178 Bacteria 1583
348 Ga0501084_0004288 3300054114 Bacteria 11611
349 Ga0501084_0024721 3300054114 Bacteria 5013
350 Ga0501082_0009058 3300060353 Bacteria 8584
351 Ga0501082_0066429 3300060353 Bacteria 3106
352 Ga0501082_0304083 3300060353 Bacteria 1389
353 Ga0530510_0254712 3300061734 Bacteria 1308
354 Ga0451807_2614339
355 Ga0055535_1000167
356 Ga0070658_10019827
357 Ga0070676_10254328
358 Ga0070683_100004472
359 Ga0070690_100052825
360 Ga0070690_100139640
361 Ga0070670_100000425
362 Ga0070670_100269894
363 Ga0068869_100365476
364 Ga0068869_100525804
365 Ga0070666_10001027
366 Ga0070666_10183492
367 Ga0070680_100075389
368 Ga0070682_100126159
369 Ga0068868_100000145
370 Ga0068868_100054390
371 Ga0070660_100003022
372 Ga0070689_100038362
373 Ga0070687_100067545
374 Ga0070661_100002717
375 Ga0070669_100101562
376 Ga0070675_100003704
377 Ga0070675_100132216
378 Ga0070675_100253631
379 Ga0070675_100257994
380 Ga0070671_100077132
381 Ga0070674_100103848
382 Ga0070674_100210541
383 Ga0070673_100002718
384 Ga0070673_100110218
385 Ga0070673_100168986
386 Ga0070659_100027679
387 Ga0070667_100028749
388 Ga0070714_100000938
389 Ga0070714_100035146
390 Ga0070714_100050143
391 Ga0070713_100121133
392 Ga0070713_100185935
393 Ga0070701_10024119
394 Ga0070701_10191312
395 Ga0070705_100042140
396 Ga0070700_100080913
397 Ga0070663_100136791
398 Ga0070678_100000715
399 Ga0070678_100155753
400 Ga0070662_100215034
401 Ga0070662_100478331
402 Ga0070681_10034307
403 Ga0070681_10430075
404 Ga0068867_100537596
405 Ga0068867_100561060
406 Ga0070697_100183535
407 Ga0070672_100013925
408 Ga0070672_100422687
409 Ga0070695_100011070
410 Ga0070665_100036872
411 Ga0070665_100059310
412 Ga0070704_100127730
413 Ga0070704_100539688
414 Ga0068855_100000072
415 Ga0068855_100196913
416 Ga0070664_100000316
417 Ga0070702_100093426
418 Ga0068852_100000229
419 Ga0068859_100147026
420 Ga0068859_100196445
421 Ga0068864_100047430
422 Ga0068864_100074562
423 Ga0068861_100202953
424 Ga0068851_10005868
425 Ga0068851_10156404
426 Ga0068863_100025456
427 Ga0068863_100026541
428 Ga0068858_100005423
429 Ga0068860_100005932
430 Ga0068862_100397048
431 Ga0070712_100253559
432 Ga0097621_100001309
433 Ga0097621_100238420
434 Ga0068871_100001685
435 Ga0068871_100005027
436 Ga0075428_100001685
437 Ga0075428_100262298
438 Ga0075430_100015343
439 Ga0075431_100000405
440 Ga0075433_10004572
441 Ga0075434_100001228
442 Ga0075434_100399941
443 Ga0075429_100010491
444 Ga0075429_100161867
445 Ga0097620_100147034
446 Ga0097620_100196423
447 Ga0075435_100112915
448 Ga0099794_10073521
449 Ga0099795_10000001
450 Ga0099795_10001756
451 Ga0111539_10013818
452 Ga0111539_10040464
453 Ga0111539_10218303
454 Ga0105245_10012117
455 Ga0105245_10040112
456 Ga0114129_10172397
457 Ga0105242_10073964
458 Ga0105242_10266441
459 Ga0105248_10130650
460 Ga0105248_10143914
461 Ga0105237_10461432
462 Ga0105238_10212884
463 Ga0099796_10000001
464 Ga0157371_10289519
465 Ga0157370_10027902
466 Ga0157369_10779723
467 Ga0157374_10000860
468 Ga0157374_10018024
469 Ga0157378_10004072
470 Ga0157378_10065959
471 Ga0163162_10016546
472 Ga0163162_10412550
473 Ga0157375_10007106
474 Ga0157375_10388958
475 Ga0163163_10002837
476 Ga0157380_10110041
477 Ga0157380_10113111
478 Ga0157380_10139807
479 Ga0157377_10035191
480 Ga0157379_10004663
481 Ga0157376_10004036
482 Ga0157376_10014114
483 Ga0163161_10236604
484 Ga0207656_10008437
485 Ga0207656_10083694
486 Ga0207682_10003380
487 Ga0207645_10034564
488 Ga0207643_10009078
489 Ga0207705_10008649
490 Ga0207707_10061039
491 Ga0207707_10386010
492 Ga0207662_10068403
493 Ga0207646_10045803
494 Ga0207681_10453240
495 Ga0207694_10151899
496 Ga0207650_10001393
497 Ga0207659_10003124
498 Ga0207659_10032634
499 Ga0207659_10085094
500 Ga0207664_10001788
501 Ga0207664_10049216
502 Ga0207690_10017584
503 Ga0207706_10019630
504 Ga0207686_10193236
505 Ga0207670_10050295
506 Ga0207669_10073322
507 Ga0207691_10000667
508 Ga0207691_10053596
509 Ga0207691_10120645
510 Ga0207691_10260991
511 Ga0207711_10002694
512 Ga0207711_10014099
513 Ga0207689_10048275
514 Ga0207689_10141572
515 Ga0207661_10002441
516 Ga0207679_10000649
517 Ga0207679_10145906
518 Ga0207651_10061319
519 Ga0207651_10426143
520 Ga0207668_10476564
521 Ga0207658_10009511
522 Ga0207677_10002541
523 Ga0207677_10119344
524 Ga0207677_10203741
525 Ga0207703_10069468
526 Ga0207678_10160899
527 Ga0207708_10038460
528 Ga0207641_10004933
529 Ga0207641_10018984
530 Ga0207648_10030965
531 Ga0207648_10374245
532 Ga0207676_10038029
533 Ga0207676_10057056
534 Ga0207674_10049157
535 Ga0207674_10348966
536 Ga0207675_100065930
537 Ga0207683_10001353
538 Ga0207683_10132779
539 Ga0207698_10000201
540 Ga0209179_1000006
541 Ga0209971_1020636
542 Ga0207428_10376002
543 Ga0268266_10034651
544 Ga0268266_10040174
545 Ga0268266_10372741
546 Ga0268265_10293347
547 Ga0268265_10392762
548 Ga0268264_10169199
549 Ga0265326_10000879
550 Ga0265326_10008960
551 Ga0265334_10000015
552 Ga0265334_10012646
553 Ga0265334_10076576
554 Ga0265323_10005604
555 Ga0265322_10020853
556 Ga0265338_10005171
557 Ga0265338_10147851
558 Ga0265330_10046389
559 Ga0265332_10001626
560 Ga0265332_10007450
561 Ga0265328_10009856
562 Ga0265328_10094912
563 Ga0265320_10107249
564 Ga0265331_10003020
565 Ga0265331_10003444
566 Ga0265331_10076046
567 Ga0265327_10000133
568 Ga0265327_10000542
569 Ga0265327_10017618
570 Ga0265316_10000744
571 Ga0265316_10093678
572 Ga0307509_10000075
573 Ga0307408_100274899
574 Ga0265313_10000277
575 Ga0265313_10009298
576 Ga0265314_10000335
577 Ga0265342_10031276
578 Ga0316576_10023367
579 Ga0316577_10008398
580 Ga0316577_10020998
581 Ga0307412_10253090
582 Ga0307416_100114615
583 Ga0316583_10005090
584 Ga0316585_10011152
585 Ga0307510_10252581
586 Ga0373934_0121447
587 Ga0373936_0059454
588 Ga0373956_0083627
589 Ga0373962_0063301
590 Ga0373931_0123239
591 Ga0373933_0036513
592 Ga0373933_0097291
593 Ga0373937_0150272
594 Ga0373937_0465853
595 Ga0316582_0112152
596 Ga0316582_0209160
597 Ga0373925_0398192
598 Ga0395901_0000533
599 Ga0451577_0000600
600 Ga0451577_0005072
601 Ga0451577_0009608
602 Ga0451577_0036021
603 Ga0451577_0440942
604 Ga0453684_0000005
605 Ga0453684_0000356
606 Ga0453684_0002166
607 Ga0453684_0002541
608 Ga0453684_0047079
609 Ga0453684_0058955
610 Ga0453684_0082346
611 Ga0453684_0221837
612 Ga0453684_0353799
613 Ga0453684_0473813
614 Ga0466970_0015640
615 Ga0451576_0000634
616 Ga0451576_0002387
617 Ga0451576_0012343
618 Ga0451576_0075251
619 Ga0451576_0230102
620 Ga0451576_0237444
621 Ga0451576_0840879
622 Ga0495603_0137281
623 Ga0495642_0032982
624 Ga0495670_0069415
625 Ga0496100_0065688
626 Ga0496101_0018622
627 Ga0496102_0217706
628 Ga0496104_0030300
629 Ga0496104_0047596
630 Ga0496105_0004965
631 Ga0496105_0009078
632 Ga0496106_0194524
633 Ga0496108_0008184
634 Ga0496108_0123628
635 Ga0496109_0009828
636 Ga0496109_0018297
637 Ga0496110_0009462
638 Ga0496110_0069388
639 Ga0496110_0650697
640 Ga0496111_0078748
641 Ga0496112_0755254
642 Ga0496114_0007489
643 Ga0496114_0020480
644 Ga0496114_0098586
645 Ga0496114_0127385
646 Ga0496115_0033775
647 Ga0496122_0089649
648 Ga0496125_0007840
649 Ga0501033_0334871
650 Ga0501034_0032459
651 Ga0501034_0137042
652 Ga0501038_0055265
653 Ga0501039_0073631
654 Ga0501039_0264597
655 Ga0501040_0060378
656 Ga0501041_0000884
657 Ga0501041_0002450
658 Ga0501042_0031586
659 Ga0501043_0053993
660 Ga0501043_0203194
661 Ga0501048_0382542
662 Ga0501048_0474660
663 Ga0501068_0136294
664 Ga0501068_0153991
665 Ga0501071_0070881
666 Ga0501071_0091162
667 Ga0501071_0557569
668 Ga0501072_0017175
669 Ga0501072_0067834
670 Ga0501072_0253610
671 Ga0501073_0162704
672 Ga0501074_0162176
673 Ga0501075_0065866
674 Ga0501075_0273012
675 Ga0501076_0000468
676 Ga0501077_0026400
677 Ga0501077_0079534
678 Ga0501209_003130
679 Ga0501079_0015588
680 Ga0501079_0126920
681 Ga0501080_0132331
682 Ga0501080_0177925
683 Ga0501081_0002318
684 Ga0501081_0017127
685 Ga0501081_0054554
686 Ga0501081_0074275
687 Ga0501081_0483388
688 Ga0501083_0217124
689 Ga0501045_0370673
690 nmdc:mga05p37_976373_c1
691 nmdc:mga09592_40910_c1
692 nmdc:mga06r32_20088_c1
693 nmdc:mga08y16_116993_c1
694 nmdc:mga08y16_27642_c1
695 nmdc:mga0n895_239381_c1
696 nmdc:mga0n895_4260_c1
697 nmdc:mga0rr50_282417_c1
698 nmdc:mga0a205_5798_c2
699 Ga0500590_054878
700 Ga0500637_0111972
701 Ga0501084_0004288
702 Ga0501084_0024721
703 Ga0501082_0009058
704 Ga0501082_0066429
705 Ga0501082_0304083
706 Ga0530510_0254712

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

1

262

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3luz-assembly1.cif.gz_A crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.9822 6 263
3luz-assembly1.cif.gz_B crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.9752 6 263
3luz-assembly1.cif.gz_A crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.974 6 263
3luz-assembly1.cif.gz_B crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.9587 6 263
2qfl-assembly1.cif.gz_A structure of suhb: inositol monophosphatase and extragenic suppressor from e. coli 0.9572 5 261
ID Description Score Start End Superfamily
3luzB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9793 146 263 3.40.190.80
5zhhC01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9677 9 144 3.30.540.10
3luzB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9618 146 263 3.40.190.80
6ib8A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9592 146 264 3.40.190.80
af_Q54U72_147_270_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9488 147 262 3.40.190.80
ID Description Score Start End GO Terms
AF-A0A837Q4N6-F1-model_v4 deleted 0.9863 5 153
AF-A0A4Q3Q142-F1-model_v4 deleted 0.9844 1 114
AF-A0A537GFE0-F1-model_v4 Inositol-1-monophosphatase (EC 3.1.3.25) 0.9824 5 234 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A7C1PI53-F1-model_v4 Inositol monophosphatase 0.9811 134 262 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A528V7A3-F1-model_v4 Inositol monophosphatase 0.9804 109 206 GO:0006020
GO:0007165
GO:0008934

Map