F419484
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 353 | 224 | 706 | 268 |
Family's Representative Sequence
| Representative Sequence | 3300044673|Ga0453683_0003829|Ga0453683_0003829_7056_8018 |
| Length | 320 |
| Sequence | LLDVFHDISCDAYSAHFSILLELECVPYSREPSMSDILKKILAVKAQEVAAAKPAKPLPILRAEAEHAAPIRDFVGAIRNRIAAGHPAVIAEIKKASPSKGVIREDFRPAEIAKSYELHGAACLSVLTDEQFFQGSAEYLKQARAACELPVLRKDFIVDEYQIYQARAMGADAVLLIAAALTLKQMQAFESLAHQLGMAVLVEVHDAEELETALQLTTPLLGINNRNLRTFEVTLQTTLDLLAKIPQDRIVVTESGIFTQADVHLMREHQVNAFLVGEAFMRARDPGVELAQVFNQIGKKPSCSYGVGMLHLRCKKTTVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 2 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 4 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 43 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 64 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 99 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 102 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 103 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 105 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 106 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 107 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 108 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 109 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 110 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 111 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 112 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 113 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 114 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 115 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 116 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 117 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 119 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 120 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 121 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 122 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 123 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 124 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 127 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 128 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 129 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 130 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 131 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 132 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 133 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 134 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 135 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 136 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 137 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 138 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 139 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 140 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 141 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 142 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 143 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 144 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 145 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 146 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 180 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 181 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 182 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 183 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 184 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 185 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 186 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 187 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 190 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 191 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 192 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 193 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 194 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 195 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 196 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 197 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 198 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 199 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 200 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 201 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 202 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 203 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 204 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 205 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 206 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 207 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 208 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 209 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 210 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 211 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 212 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 213 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 214 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 215 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 216 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 217 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 218 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 219 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 220 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 221 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 222 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 223 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 224 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.08 |
| Metatranscriptomes | 0.57 |
| Isolates | 9.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.13 |
| Nodule | 0.57 |
| Rhizoplane | 3.97 |
| Rhizosphere | 84.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0453683_0003829 | 3300044673 | Bacteria | 10922 |
| 2 | JGI25162J39368_1000324 | 3300002737 | Bacteria | 41886 |
| 3 | Ga0055536_1002226 | 3300003781 | Bacteria | 11039 |
| 4 | Ga0055530_10000513 | 3300003791 | Bacteria | 33776 |
| 5 | Ga0065714_10073876 | 3300005288 | Bacteria | 3116 |
| 6 | Ga0065704_10004129 | 3300005289 | Bacteria | 6335 |
| 7 | Ga0070676_10046988 | 3300005328 | Bacteria | 2519 |
| 8 | Ga0070690_100010188 | 3300005330 | Bacteria | 5462 |
| 9 | Ga0070670_100055153 | 3300005331 | Bacteria | 3411 |
| 10 | Ga0070670_100161245 | 3300005331 | Bacteria | 1943 |
| 11 | Ga0070670_100576262 | 3300005331 | Bacteria | 1006 |
| 12 | Ga0070677_10002876 | 3300005333 | Bacteria | 5530 |
| 13 | Ga0070677_10059486 | 3300005333 | Bacteria | 1572 |
| 14 | Ga0068869_100044334 | 3300005334 | Bacteria | 3198 |
| 15 | Ga0068869_100075250 | 3300005334 | Bacteria | 2508 |
| 16 | Ga0070666_10037552 | 3300005335 | Bacteria | 3221 |
| 17 | Ga0070666_10183020 | 3300005335 | Bacteria | 1470 |
| 18 | Ga0070689_100432188 | 3300005340 | Bacteria | 1117 |
| 19 | Ga0070668_100021137 | 3300005347 | Bacteria | 4919 |
| 20 | Ga0070669_100139066 | 3300005353 | Bacteria | 1870 |
| 21 | Ga0070675_100078373 | 3300005354 | Bacteria | 2751 |
| 22 | Ga0070675_100250704 | 3300005354 | Bacteria | 1549 |
| 23 | Ga0070671_100026746 | 3300005355 | Bacteria | 4745 |
| 24 | Ga0070674_100041648 | 3300005356 | Bacteria | 3114 |
| 25 | Ga0070673_100031143 | 3300005364 | Bacteria | 4000 |
| 26 | Ga0070673_100097338 | 3300005364 | Bacteria | 2416 |
| 27 | Ga0070688_100008002 | 3300005365 | Bacteria | 5719 |
| 28 | Ga0070667_100085286 | 3300005367 | Bacteria | 2708 |
| 29 | Ga0070667_100172050 | 3300005367 | Bacteria | 1913 |
| 30 | Ga0070701_10010200 | 3300005438 | Bacteria | 4144 |
| 31 | Ga0070700_100070528 | 3300005441 | Bacteria | 2228 |
| 32 | Ga0070663_100011363 | 3300005455 | Bacteria | 5586 |
| 33 | Ga0070678_100065251 | 3300005456 | Bacteria | 2702 |
| 34 | Ga0068867_100001996 | 3300005459 | Bacteria | 14233 |
| 35 | Ga0068867_100039635 | 3300005459 | Bacteria | 3435 |
| 36 | Ga0068867_100052301 | 3300005459 | Bacteria | 3014 |
| 37 | Ga0070685_10014498 | 3300005466 | Bacteria | 4177 |
| 38 | Ga0070672_100064646 | 3300005543 | Bacteria | 2891 |
| 39 | Ga0070672_100153989 | 3300005543 | Bacteria | 1903 |
| 40 | Ga0070686_100011188 | 3300005544 | Bacteria | 5083 |
| 41 | Ga0070665_100044468 | 3300005548 | Bacteria | 4460 |
| 42 | Ga0070702_100011121 | 3300005615 | Bacteria | 4467 |
| 43 | Ga0068859_100098082 | 3300005617 | Bacteria | 2984 |
| 44 | Ga0068861_100077737 | 3300005719 | Bacteria | 2589 |
| 45 | Ga0068870_10081643 | 3300005840 | Bacteria | 1788 |
| 46 | Ga0068863_100064255 | 3300005841 | Bacteria | 3471 |
| 47 | Ga0068858_100082584 | 3300005842 | Bacteria | 2987 |
| 48 | Ga0068858_100348235 | 3300005842 | Bacteria | 1419 |
| 49 | Ga0068860_100023269 | 3300005843 | Bacteria | 5987 |
| 50 | Ga0068860_100103557 | 3300005843 | Bacteria | 2717 |
| 51 | Ga0097621_100156307 | 3300006237 | Bacteria | 1957 |
| 52 | Ga0068871_100151288 | 3300006358 | Bacteria | 1979 |
| 53 | Ga0068865_100129698 | 3300006881 | Bacteria | 1887 |
| 54 | Ga0097620_100098090 | 3300006931 | Bacteria | 2984 |
| 55 | Ga0079104_1000446 | 3300006946 | Bacteria | 46720 |
| 56 | Ga0105251_10002972 | 3300009011 | Bacteria | 12686 |
| 57 | Ga0111539_10165996 | 3300009094 | Bacteria | 2581 |
| 58 | Ga0105245_10050253 | 3300009098 | Bacteria | 3736 |
| 59 | Ga0105243_10000562 | 3300009148 | Bacteria | 37568 |
| 60 | Ga0105243_10008193 | 3300009148 | Bacteria | 8025 |
| 61 | Ga0105242_10061382 | 3300009176 | Bacteria | 3092 |
| 62 | Ga0105248_10281729 | 3300009177 | Bacteria | 1871 |
| 63 | Ga0105249_10027654 | 3300009553 | Bacteria | 5118 |
| 64 | Ga0105246_10239317 | 3300011119 | Bacteria | 1434 |
| 65 | Ga0157370_10001229 | 3300013104 | Bacteria | 32093 |
| 66 | Ga0157374_10000924 | 3300013296 | Bacteria | 25554 |
| 67 | Ga0157374_10170265 | 3300013296 | Bacteria | 2124 |
| 68 | Ga0157378_10014121 | 3300013297 | Bacteria | 6989 |
| 69 | Ga0163162_10393978 | 3300013306 | Bacteria | 1517 |
| 70 | Ga0157372_10408185 | 3300013307 | Bacteria | 1583 |
| 71 | Ga0157375_10421854 | 3300013308 | Bacteria | 1500 |
| 72 | Ga0163163_10509086 | 3300014325 | Bacteria | 1266 |
| 73 | Ga0157380_10044769 | 3300014326 | Bacteria | 3469 |
| 74 | Ga0157377_10000160 | 3300014745 | Bacteria | 41263 |
| 75 | Ga0157377_10031810 | 3300014745 | Bacteria | 2870 |
| 76 | Ga0157379_10165797 | 3300014968 | Bacteria | 1994 |
| 77 | Ga0157379_10174883 | 3300014968 | Bacteria | 1938 |
| 78 | Ga0157376_10081833 | 3300014969 | Bacteria | 2773 |
| 79 | Ga0163161_10006283 | 3300017792 | Bacteria | 8224 |
| 80 | Ga0163161_10052234 | 3300017792 | Bacteria | 2962 |
| 81 | Ga0213872_10000045 | 3300021361 | Bacteria | 112229 |
| 82 | Ga0213872_10000440 | 3300021361 | Bacteria | 34046 |
| 83 | Ga0213872_10000674 | 3300021361 | Bacteria | 25844 |
| 84 | Ga0213872_10000924 | 3300021361 | Bacteria | 20820 |
| 85 | Ga0213872_10045708 | 3300021361 | Bacteria | 1992 |
| 86 | Ga0209563_100088 | 3300025230 | Bacteria | 175375 |
| 87 | Ga0207697_10002805 | 3300025315 | Bacteria | 8864 |
| 88 | Ga0207655_1000040 | 3300025728 | Bacteria | 335311 |
| 89 | Ga0207713_1018085 | 3300025735 | Bacteria | 3501 |
| 90 | Ga0207682_10000452 | 3300025893 | Bacteria | 18894 |
| 91 | Ga0207682_10034045 | 3300025893 | Bacteria | 2053 |
| 92 | Ga0207680_10025188 | 3300025903 | Bacteria | 3279 |
| 93 | Ga0207645_10002682 | 3300025907 | Bacteria | 13864 |
| 94 | Ga0207645_10006835 | 3300025907 | Bacteria | 8137 |
| 95 | Ga0207643_10015061 | 3300025908 | Bacteria | 4204 |
| 96 | Ga0207681_10127809 | 3300025923 | Bacteria | 1874 |
| 97 | Ga0207650_10017423 | 3300025925 | Bacteria | 5030 |
| 98 | Ga0207650_10226348 | 3300025925 | Bacteria | 1507 |
| 99 | Ga0207659_10154679 | 3300025926 | Bacteria | 1794 |
| 100 | Ga0207659_10481720 | 3300025926 | Bacteria | 1048 |
| 101 | Ga0207687_10127530 | 3300025927 | Bacteria | 1913 |
| 102 | Ga0207687_10316202 | 3300025927 | Bacteria | 1262 |
| 103 | Ga0207644_10005959 | 3300025931 | Bacteria | 7947 |
| 104 | Ga0207706_10011334 | 3300025933 | Bacteria | 8123 |
| 105 | Ga0207686_10312203 | 3300025934 | Bacteria | 1171 |
| 106 | Ga0207709_10001469 | 3300025935 | Bacteria | 16353 |
| 107 | Ga0207709_10025100 | 3300025935 | Bacteria | 3410 |
| 108 | Ga0207709_10209372 | 3300025935 | Bacteria | 1398 |
| 109 | Ga0207704_10012780 | 3300025938 | Bacteria | 4175 |
| 110 | Ga0207691_10083457 | 3300025940 | Bacteria | 2868 |
| 111 | Ga0207691_10148368 | 3300025940 | Bacteria | 2063 |
| 112 | Ga0207711_10075412 | 3300025941 | Bacteria | 2935 |
| 113 | Ga0207689_10029433 | 3300025942 | Bacteria | 4585 |
| 114 | Ga0207689_10095991 | 3300025942 | Bacteria | 2435 |
| 115 | Ga0207651_10291832 | 3300025960 | Bacteria | 1352 |
| 116 | Ga0207712_10074248 | 3300025961 | Bacteria | 2455 |
| 117 | Ga0207668_10049131 | 3300025972 | Bacteria | 2898 |
| 118 | Ga0207640_10171655 | 3300025981 | Bacteria | 1617 |
| 119 | Ga0207658_10038011 | 3300025986 | Bacteria | 3464 |
| 120 | Ga0207677_10216368 | 3300026023 | Bacteria | 1533 |
| 121 | Ga0207703_10651475 | 3300026035 | Bacteria | 999 |
| 122 | Ga0207678_10015363 | 3300026067 | Bacteria | 6734 |
| 123 | Ga0207708_10001857 | 3300026075 | Bacteria | 15564 |
| 124 | Ga0207641_10078495 | 3300026088 | Bacteria | 2859 |
| 125 | Ga0207648_10000574 | 3300026089 | Bacteria | 41215 |
| 126 | Ga0207648_10007623 | 3300026089 | Bacteria | 10610 |
| 127 | Ga0207648_10059527 | 3300026089 | Bacteria | 3331 |
| 128 | Ga0207676_10058160 | 3300026095 | Bacteria | 3048 |
| 129 | Ga0207676_10087630 | 3300026095 | Bacteria | 2546 |
| 130 | Ga0207676_10584726 | 3300026095 | Bacteria | 1071 |
| 131 | Ga0207683_10154293 | 3300026121 | Bacteria | 2074 |
| 132 | Ga0207698_10437987 | 3300026142 | Bacteria | 1258 |
| 133 | Ga0209281_1000060 | 3300027111 | Bacteria | 295683 |
| 134 | Ga0268266_10109761 | 3300028379 | Bacteria | 2443 |
| 135 | Ga0268264_10033611 | 3300028381 | Bacteria | 4215 |
| 136 | Ga0268264_10084747 | 3300028381 | Bacteria | 2718 |
| 137 | Ga0265336_10000371 | 3300028666 | Bacteria | 28840 |
| 138 | Ga0307515_10062795 | 3300028794 | Bacteria | 5236 |
| 139 | Ga0307515_10235312 | 3300028794 | Bacteria | 1614 |
| 140 | Ga0265338_10073015 | 3300028800 | Bacteria | 2927 |
| 141 | Ga0265324_10000092 | 3300029957 | Bacteria | 69604 |
| 142 | Ga0265324_10004594 | 3300029957 | Bacteria | 6172 |
| 143 | Ga0265324_10004656 | 3300029957 | Bacteria | 6112 |
| 144 | Ga0316183_1125898 | 3300030742 | Bacteria | 4891 |
| 145 | Ga0316181_1085618 | 3300030744 | Bacteria | 2246 |
| 146 | Ga0265330_10006726 | 3300031235 | Bacteria | 5668 |
| 147 | Ga0265328_10000016 | 3300031239 | Bacteria | 132959 |
| 148 | Ga0265328_10012526 | 3300031239 | Bacteria | 3373 |
| 149 | Ga0265328_10059576 | 3300031239 | Bacteria | 1401 |
| 150 | Ga0265320_10030055 | 3300031240 | Bacteria | 2806 |
| 151 | Ga0265325_10011063 | 3300031241 | Bacteria | 5193 |
| 152 | Ga0265329_10011030 | 3300031242 | Bacteria | 3296 |
| 153 | Ga0265331_10000144 | 3300031250 | Bacteria | 92791 |
| 154 | Ga0265331_10001968 | 3300031250 | Bacteria | 14339 |
| 155 | Ga0265331_10005310 | 3300031250 | Bacteria | 7797 |
| 156 | Ga0265331_10012237 | 3300031250 | Bacteria | 4655 |
| 157 | Ga0265331_10015686 | 3300031250 | Bacteria | 3994 |
| 158 | Ga0265331_10020077 | 3300031250 | Bacteria | 3436 |
| 159 | Ga0265331_10022860 | 3300031250 | Bacteria | 3184 |
| 160 | Ga0265331_10027619 | 3300031250 | Bacteria | 2844 |
| 161 | Ga0265331_10038495 | 3300031250 | Bacteria | 2337 |
| 162 | Ga0265327_10000077 | 3300031251 | Bacteria | 211850 |
| 163 | Ga0265327_10000314 | 3300031251 | Bacteria | 92783 |
| 164 | Ga0265327_10000528 | 3300031251 | Bacteria | 65837 |
| 165 | Ga0265327_10008311 | 3300031251 | Bacteria | 7763 |
| 166 | Ga0265327_10009180 | 3300031251 | Bacteria | 7182 |
| 167 | Ga0265327_10011473 | 3300031251 | Bacteria | 6093 |
| 168 | Ga0265327_10015687 | 3300031251 | Bacteria | 4869 |
| 169 | Ga0265327_10043507 | 3300031251 | Bacteria | 2402 |
| 170 | Ga0307408_100000574 | 3300031548 | Bacteria | 31711 |
| 171 | Ga0307408_100000699 | 3300031548 | Bacteria | 27364 |
| 172 | Ga0265313_10121038 | 3300031595 | Bacteria | 1141 |
| 173 | Ga0316575_10000042 | 3300031665 | Bacteria | 31213 |
| 174 | Ga0316575_10012962 | 3300031665 | Bacteria | 3111 |
| 175 | Ga0265314_10000207 | 3300031711 | Bacteria | 86954 |
| 176 | Ga0265314_10011151 | 3300031711 | Bacteria | 7448 |
| 177 | Ga0265314_10012644 | 3300031711 | Bacteria | 6870 |
| 178 | Ga0265342_10010154 | 3300031712 | Bacteria | 6560 |
| 179 | Ga0307516_10000048 | 3300031730 | Bacteria | 130378 |
| 180 | Ga0307516_10045769 | 3300031730 | Bacteria | 4320 |
| 181 | Ga0307405_10029699 | 3300031731 | Bacteria | 3197 |
| 182 | Ga0307405_10050695 | 3300031731 | Bacteria | 2571 |
| 183 | Ga0307405_10289159 | 3300031731 | Bacteria | 1238 |
| 184 | Ga0307406_10000834 | 3300031901 | Bacteria | 17319 |
| 185 | Ga0307406_10033559 | 3300031901 | Bacteria | 3143 |
| 186 | Ga0307412_10026499 | 3300031911 | Bacteria | 3603 |
| 187 | Ga0307412_10029707 | 3300031911 | Bacteria | 3432 |
| 188 | Ga0307416_100489451 | 3300032002 | Bacteria | 1292 |
| 189 | Ga0316593_10000385 | 3300032168 | Bacteria | 7877 |
| 190 | Ga0316593_10016802 | 3300032168 | Bacteria | 2224 |
| 191 | Ga0373937_0030010 | 3300036401 | Bacteria | 4925 |
| 192 | Ga0316582_0044559 | 3300036647 | Bacteria | 2789 |
| 193 | Ga0395905_0151398 | 3300037471 | Bacteria | 2182 |
| 194 | Ga0400490_03127 | 3300038726 | Bacteria | 5388 |
| 195 | Ga0400490_04196 | 3300038726 | Bacteria | 8292 |
| 196 | Ga0400491_09838 | 3300038727 | Bacteria | 1925 |
| 197 | Ga0400483_058231 | 3300039062 | Bacteria | 1784 |
| 198 | Ga0400483_063003 | 3300039062 | Unclassified | 1548 |
| 199 | Ga0400483_079712 | 3300039062 | Bacteria | 57268 |
| 200 | Ga0400483_222800 | 3300039062 | Bacteria | 244239 |
| 201 | Ga0400489_11147 | 3300039093 | Bacteria | 1030 |
| 202 | Ga0436361_0014095 | 3300039447 | Bacteria | 35713 |
| 203 | Ga0436361_0207523 | 3300039447 | Bacteria | 56742 |
| 204 | Ga0436361_0308044 | 3300039447 | Bacteria | 2537 |
| 205 | Ga0436361_0512442 | 3300039447 | Bacteria | 20430 |
| 206 | Ga0436361_0743645 | 3300039447 | Bacteria | 72606 |
| 207 | Ga0436361_0781475 | 3300039447 | Bacteria | 3387 |
| 208 | Ga0436361_1111363 | 3300039447 | Bacteria | 1584 |
| 209 | Ga0439438_006206 | 3300041405 | Bacteria | 4255 |
| 210 | Ga0439447_013369 | 3300041407 | Bacteria | 2330 |
| 211 | Ga0439447_027584 | 3300041407 | Bacteria | 1448 |
| 212 | Ga0439466_0027089 | 3300041411 | Bacteria | 1986 |
| 213 | Ga0439431_0000429 | 3300041997 | Bacteria | 8934 |
| 214 | Ga0439432_000568 | 3300042006 | Bacteria | 13848 |
| 215 | Ga0439432_009578 | 3300042006 | Bacteria | 3375 |
| 216 | Ga0439451_005209 | 3300042009 | Bacteria | 2644 |
| 217 | Ga0439452_022478 | 3300042010 | Bacteria | 1631 |
| 218 | Ga0439463_000657 | 3300042016 | Bacteria | 9599 |
| 219 | Ga0450911_000205 | 3300042115 | Bacteria | 23269 |
| 220 | Ga0439446_0025056 | 3300042156 | Bacteria | 1705 |
| 221 | Ga0451577_0006776 | 3300042876 | Bacteria | 11360 |
| 222 | Ga0451577_0026660 | 3300042876 | Bacteria | 5234 |
| 223 | Ga0451577_0091271 | 3300042876 | Bacteria | 2719 |
| 224 | Ga0451577_0116821 | 3300042876 | Bacteria | 2390 |
| 225 | Ga0451577_0139848 | 3300042876 | Unclassified | 2175 |
| 226 | Ga0451577_0386926 | 3300042876 | Bacteria | 1269 |
| 227 | Ga0451577_0832713 | 3300042876 | Bacteria | 833 |
| 228 | Ga0451577_0925343 | 3300042876 | Unclassified | 784 |
| 229 | Ga0453684_0014391 | 3300044712 | Bacteria | 12663 |
| 230 | Ga0453684_0028934 | 3300044712 | Bacteria | 7886 |
| 231 | Ga0453684_0087007 | 3300044712 | Bacteria | 3875 |
| 232 | Ga0453684_0104860 | 3300044712 | Bacteria | 3450 |
| 233 | Ga0453684_0255981 | 3300044712 | Bacteria | 2008 |
| 234 | Ga0453684_0298581 | 3300044712 | Bacteria | 1831 |
| 235 | Ga0451576_0000570 | 3300045051 | Bacteria | 78726 |
| 236 | Ga0451576_0002197 | 3300045051 | Bacteria | 30078 |
| 237 | Ga0451576_0002214 | 3300045051 | Bacteria | 29931 |
| 238 | Ga0451576_0003219 | 3300045051 | Bacteria | 22759 |
| 239 | Ga0451576_0018983 | 3300045051 | Bacteria | 7512 |
| 240 | Ga0451576_0070436 | 3300045051 | Bacteria | 3640 |
| 241 | Ga0451576_0125989 | 3300045051 | Bacteria | 2668 |
| 242 | Ga0495591_000781 | 3300046458 | Bacteria | 22669 |
| 243 | Ga0495591_004619 | 3300046458 | Bacteria | 6636 |
| 244 | Ga0495650_0010358 | 3300046471 | Bacteria | 5210 |
| 245 | Ga0495605_0000278 | 3300046474 | Bacteria | 57625 |
| 246 | Ga0495605_0000930 | 3300046474 | Bacteria | 20030 |
| 247 | Ga0495584_0019638 | 3300046491 | Bacteria | 3432 |
| 248 | Ga0495594_0000635 | 3300046499 | Bacteria | 18070 |
| 249 | Ga0495607_0001805 | 3300046501 | Bacteria | 18284 |
| 250 | Ga0495607_0010360 | 3300046501 | Bacteria | 6272 |
| 251 | Ga0495583_0000504 | 3300046506 | Bacteria | 56210 |
| 252 | Ga0495583_0003618 | 3300046506 | Bacteria | 11573 |
| 253 | Ga0495583_0006029 | 3300046506 | Bacteria | 8032 |
| 254 | Ga0495606_0000631 | 3300046507 | Bacteria | 55444 |
| 255 | Ga0495616_0026315 | 3300046513 | Bacteria | 3098 |
| 256 | Ga0495620_0000153 | 3300046515 | Bacteria | 56187 |
| 257 | Ga0495620_0004357 | 3300046515 | Bacteria | 7994 |
| 258 | Ga0495620_0045690 | 3300046515 | Bacteria | 1894 |
| 259 | Ga0495631_0026244 | 3300046518 | Bacteria | 2677 |
| 260 | Ga0495632_0006335 | 3300046519 | Bacteria | 7634 |
| 261 | Ga0495637_0001314 | 3300046520 | Bacteria | 14925 |
| 262 | Ga0495637_0041094 | 3300046520 | Bacteria | 1986 |
| 263 | Ga0495643_0001069 | 3300046522 | Bacteria | 27292 |
| 264 | Ga0495643_0021682 | 3300046522 | Bacteria | 3680 |
| 265 | Ga0495643_0032702 | 3300046522 | Bacteria | 2884 |
| 266 | Ga0495643_0084734 | 3300046522 | Bacteria | 1644 |
| 267 | Ga0495648_0002836 | 3300046524 | Bacteria | 15600 |
| 268 | Ga0495648_0007939 | 3300046524 | Bacteria | 8417 |
| 269 | Ga0495654_0001456 | 3300046530 | Bacteria | 16218 |
| 270 | Ga0495654_0007193 | 3300046530 | Bacteria | 6243 |
| 271 | Ga0495609_0000166 | 3300046538 | Bacteria | 69064 |
| 272 | Ga0495597_0003210 | 3300046542 | Bacteria | 9734 |
| 273 | Ga0495633_0000291 | 3300046558 | Bacteria | 57655 |
| 274 | Ga0495668_0031331 | 3300046616 | Bacteria | 2997 |
| 275 | Ga0495668_0052087 | 3300046616 | Bacteria | 2265 |
| 276 | Ga0495611_0003776 | 3300046648 | Bacteria | 6613 |
| 277 | Ga0495661_0000277 | 3300046665 | Bacteria | 58877 |
| 278 | Ga0495661_0000294 | 3300046665 | Bacteria | 56661 |
| 279 | Ga0495661_0004957 | 3300046665 | Bacteria | 9520 |
| 280 | Ga0495661_0035843 | 3300046665 | Bacteria | 3110 |
| 281 | Ga0495658_0056871 | 3300046683 | Bacteria | 2232 |
| 282 | Ga0495671_0001637 | 3300046692 | Bacteria | 14695 |
| 283 | Ga0495671_0006472 | 3300046692 | Bacteria | 6767 |
| 284 | Ga0495671_0008224 | 3300046692 | Bacteria | 5884 |
| 285 | Ga0495649_0009394 | 3300046694 | Bacteria | 5819 |
| 286 | Ga0495649_0037076 | 3300046694 | Bacteria | 2677 |
| 287 | Ga0495589_0000676 | 3300046794 | Bacteria | 22317 |
| 288 | Ga0495660_0008552 | 3300046810 | Bacteria | 5992 |
| 289 | Ga0495660_0054678 | 3300046810 | Bacteria | 2162 |
| 290 | Ga0495672_0011861 | 3300047320 | Bacteria | 6119 |
| 291 | Ga0495683_0000196 | 3300047323 | Bacteria | 57478 |
| 292 | Ga0495679_000987 | 3300047446 | Bacteria | 17554 |
| 293 | Ga0495673_0002977 | 3300047469 | Bacteria | 11414 |
| 294 | Ga0495673_0005263 | 3300047469 | Bacteria | 7856 |
| 295 | Ga0495673_0013086 | 3300047469 | Bacteria | 4370 |
| 296 | Ga0495673_0047142 | 3300047469 | Bacteria | 1905 |
| 297 | Ga0495681_0014262 | 3300047470 | Bacteria | 4565 |
| 298 | Ga0495681_0070300 | 3300047470 | Bacteria | 1587 |
| 299 | Ga0495686_0256649 | 3300047472 | Bacteria | 980 |
| 300 | Ga0496110_0056624 | 3300048913 | Bacteria | 3450 |
| 301 | Ga0496110_0069820 | 3300048913 | Bacteria | 3112 |
| 302 | Ga0496114_0323513 | 3300048917 | Bacteria | 1363 |
| 303 | Ga0496118_0030448 | 3300048921 | Bacteria | 4503 |
| 304 | Ga0496121_0004825 | 3300048924 | Bacteria | 17756 |
| 305 | Ga0496122_0004379 | 3300048925 | Bacteria | 17595 |
| 306 | Ga0496123_0051205 | 3300048926 | Bacteria | 2751 |
| 307 | Ga0496124_0008721 | 3300048927 | Bacteria | 10535 |
| 308 | Ga0496124_0088934 | 3300048927 | Bacteria | 2523 |
| 309 | Ga0496125_0065367 | 3300048928 | Bacteria | 2882 |
| 310 | Ga0496125_0065827 | 3300048928 | Bacteria | 2867 |
| 311 | Ga0495678_000268 | 3300049459 | Bacteria | 57604 |
| 312 | Ga0495678_001974 | 3300049459 | Bacteria | 14782 |
| 313 | Ga0495678_020969 | 3300049459 | Bacteria | 2884 |
| 314 | Ga0495678_021986 | 3300049459 | Bacteria | 2797 |
| 315 | Ga0495678_074383 | 3300049459 | Bacteria | 1236 |
| 316 | Ga0495682_0000911 | 3300049460 | Bacteria | 18044 |
| 317 | Ga0501226_000033 | 3300049853 | Bacteria | 72088 |
| 318 | Ga0501226_001139 | 3300049853 | Bacteria | 3448 |
| 319 | Ga0590071_008764 | 3300059421 | Bacteria | 2378 |
| 320 | Ga0590075_017512 | 3300059424 | Bacteria | 1766 |
| 321 | 2547372183 | 2547132103 | Bacteria | 5115736 |
| 322 | 2574430140 | 2574179768 | Bacteria | 4907129 |
| 323 | 2599502354 | 2599185188 | Bacteria | 6164180 |
| 324 | 2599933948 | 2599185300 | Bacteria | 6062622 |
| 325 | 2599945763 | 2599185302 | Bacteria | 5954930 |
| 326 | 2599956757 | 2599185304 | Bacteria | 5951361 |
| 327 | 2599975278 | 2599185307 | Bacteria | 6194719 |
| 328 | 2599984848 | 2599185309 | Bacteria | 5969593 |
| 329 | 2599988067 | 2599185310 | Bacteria | 6014457 |
| 330 | 2599998857 | 2599185312 | Bacteria | 5912071 |
| 331 | 2600046395 | 2599185320 | Bacteria | 5963263 |
| 332 | 2600446015 | 2600254954 | Bacteria | 5100516 |
| 333 | 2671586790 | 2671180115 | Bacteria | 5353919 |
| 334 | 2678265846 | 2675903515 | Bacteria | 6580491 |
| 335 | 2738690343 | 2738541271 | Bacteria | 5657310 |
| 336 | 2738716209 | 2738541276 | Bacteria | 4690596 |
| 337 | 2739243171 | 2738543012 | Bacteria | 7115078 |
| 338 | 2739266117 | 2738543016 | Bacteria | 5657564 |
| 339 | 2739289802 | 2738543020 | Bacteria | 5718238 |
| 340 | 2739295114 | 2738543021 | Bacteria | 5718241 |
| 341 | 2745007078 | 2744054620 | Bacteria | 6551379 |
| 342 | 2808906411 | 2808606373 | Bacteria | 4423627 |
| 343 | 2842808017 | 2842805378 | Bacteria | 5385175 |
| 344 | 2842855319 | 2842854478 | Bacteria | 6143501 |
| 345 | 2843693353 | 2843690924 | Bacteria | 5169057 |
| 346 | 2846042172 | 2846037992 | Bacteria | 4526407 |
| 347 | 2891635434 | 2891633521 | Bacteria | 4602265 |
| 348 | 2952254664 | 2952252522 | Bacteria | 4171745 |
| 349 | 3007867049 | 3007866637 | Bacteria | 5899198 |
| 350 | 3007872415 | 3007872151 | Bacteria | 5268868 |
| 351 | 639788484 | 639633007 | Bacteria | 4376040 |
| 352 | 8056148466 | 8056143049 | Bacteria | 6307666 |
| 353 | 8057162112 | 8057160832 | Bacteria | 3268302 |
| 354 | Ga0453683_0003829 | |||
| 355 | JGI25162J39368_1000324 | |||
| 356 | Ga0055536_1002226 | |||
| 357 | Ga0055530_10000513 | |||
| 358 | Ga0065714_10073876 | |||
| 359 | Ga0065704_10004129 | |||
| 360 | Ga0070676_10046988 | |||
| 361 | Ga0070690_100010188 | |||
| 362 | Ga0070670_100055153 | |||
| 363 | Ga0070670_100161245 | |||
| 364 | Ga0070670_100576262 | |||
| 365 | Ga0070677_10002876 | |||
| 366 | Ga0070677_10059486 | |||
| 367 | Ga0068869_100044334 | |||
| 368 | Ga0068869_100075250 | |||
| 369 | Ga0070666_10037552 | |||
| 370 | Ga0070666_10183020 | |||
| 371 | Ga0070689_100432188 | |||
| 372 | Ga0070668_100021137 | |||
| 373 | Ga0070669_100139066 | |||
| 374 | Ga0070675_100078373 | |||
| 375 | Ga0070675_100250704 | |||
| 376 | Ga0070671_100026746 | |||
| 377 | Ga0070674_100041648 | |||
| 378 | Ga0070673_100031143 | |||
| 379 | Ga0070673_100097338 | |||
| 380 | Ga0070688_100008002 | |||
| 381 | Ga0070667_100085286 | |||
| 382 | Ga0070667_100172050 | |||
| 383 | Ga0070701_10010200 | |||
| 384 | Ga0070700_100070528 | |||
| 385 | Ga0070663_100011363 | |||
| 386 | Ga0070678_100065251 | |||
| 387 | Ga0068867_100001996 | |||
| 388 | Ga0068867_100039635 | |||
| 389 | Ga0068867_100052301 | |||
| 390 | Ga0070685_10014498 | |||
| 391 | Ga0070672_100064646 | |||
| 392 | Ga0070672_100153989 | |||
| 393 | Ga0070686_100011188 | |||
| 394 | Ga0070665_100044468 | |||
| 395 | Ga0070702_100011121 | |||
| 396 | Ga0068859_100098082 | |||
| 397 | Ga0068861_100077737 | |||
| 398 | Ga0068870_10081643 | |||
| 399 | Ga0068863_100064255 | |||
| 400 | Ga0068858_100082584 | |||
| 401 | Ga0068858_100348235 | |||
| 402 | Ga0068860_100023269 | |||
| 403 | Ga0068860_100103557 | |||
| 404 | Ga0097621_100156307 | |||
| 405 | Ga0068871_100151288 | |||
| 406 | Ga0068865_100129698 | |||
| 407 | Ga0097620_100098090 | |||
| 408 | Ga0079104_1000446 | |||
| 409 | Ga0105251_10002972 | |||
| 410 | Ga0111539_10165996 | |||
| 411 | Ga0105245_10050253 | |||
| 412 | Ga0105243_10000562 | |||
| 413 | Ga0105243_10008193 | |||
| 414 | Ga0105242_10061382 | |||
| 415 | Ga0105248_10281729 | |||
| 416 | Ga0105249_10027654 | |||
| 417 | Ga0105246_10239317 | |||
| 418 | Ga0157370_10001229 | |||
| 419 | Ga0157374_10000924 | |||
| 420 | Ga0157374_10170265 | |||
| 421 | Ga0157378_10014121 | |||
| 422 | Ga0163162_10393978 | |||
| 423 | Ga0157372_10408185 | |||
| 424 | Ga0157375_10421854 | |||
| 425 | Ga0163163_10509086 | |||
| 426 | Ga0157380_10044769 | |||
| 427 | Ga0157377_10000160 | |||
| 428 | Ga0157377_10031810 | |||
| 429 | Ga0157379_10165797 | |||
| 430 | Ga0157379_10174883 | |||
| 431 | Ga0157376_10081833 | |||
| 432 | Ga0163161_10006283 | |||
| 433 | Ga0163161_10052234 | |||
| 434 | Ga0213872_10000045 | |||
| 435 | Ga0213872_10000440 | |||
| 436 | Ga0213872_10000674 | |||
| 437 | Ga0213872_10000924 | |||
| 438 | Ga0213872_10045708 | |||
| 439 | Ga0209563_100088 | |||
| 440 | Ga0207697_10002805 | |||
| 441 | Ga0207655_1000040 | |||
| 442 | Ga0207713_1018085 | |||
| 443 | Ga0207682_10000452 | |||
| 444 | Ga0207682_10034045 | |||
| 445 | Ga0207680_10025188 | |||
| 446 | Ga0207645_10002682 | |||
| 447 | Ga0207645_10006835 | |||
| 448 | Ga0207643_10015061 | |||
| 449 | Ga0207681_10127809 | |||
| 450 | Ga0207650_10017423 | |||
| 451 | Ga0207650_10226348 | |||
| 452 | Ga0207659_10154679 | |||
| 453 | Ga0207659_10481720 | |||
| 454 | Ga0207687_10127530 | |||
| 455 | Ga0207687_10316202 | |||
| 456 | Ga0207644_10005959 | |||
| 457 | Ga0207706_10011334 | |||
| 458 | Ga0207686_10312203 | |||
| 459 | Ga0207709_10001469 | |||
| 460 | Ga0207709_10025100 | |||
| 461 | Ga0207709_10209372 | |||
| 462 | Ga0207704_10012780 | |||
| 463 | Ga0207691_10083457 | |||
| 464 | Ga0207691_10148368 | |||
| 465 | Ga0207711_10075412 | |||
| 466 | Ga0207689_10029433 | |||
| 467 | Ga0207689_10095991 | |||
| 468 | Ga0207651_10291832 | |||
| 469 | Ga0207712_10074248 | |||
| 470 | Ga0207668_10049131 | |||
| 471 | Ga0207640_10171655 | |||
| 472 | Ga0207658_10038011 | |||
| 473 | Ga0207677_10216368 | |||
| 474 | Ga0207703_10651475 | |||
| 475 | Ga0207678_10015363 | |||
| 476 | Ga0207708_10001857 | |||
| 477 | Ga0207641_10078495 | |||
| 478 | Ga0207648_10000574 | |||
| 479 | Ga0207648_10007623 | |||
| 480 | Ga0207648_10059527 | |||
| 481 | Ga0207676_10058160 | |||
| 482 | Ga0207676_10087630 | |||
| 483 | Ga0207676_10584726 | |||
| 484 | Ga0207683_10154293 | |||
| 485 | Ga0207698_10437987 | |||
| 486 | Ga0209281_1000060 | |||
| 487 | Ga0268266_10109761 | |||
| 488 | Ga0268264_10033611 | |||
| 489 | Ga0268264_10084747 | |||
| 490 | Ga0265336_10000371 | |||
| 491 | Ga0307515_10062795 | |||
| 492 | Ga0307515_10235312 | |||
| 493 | Ga0265338_10073015 | |||
| 494 | Ga0265324_10000092 | |||
| 495 | Ga0265324_10004594 | |||
| 496 | Ga0265324_10004656 | |||
| 497 | Ga0316183_1125898 | |||
| 498 | Ga0316181_1085618 | |||
| 499 | Ga0265330_10006726 | |||
| 500 | Ga0265328_10000016 | |||
| 501 | Ga0265328_10012526 | |||
| 502 | Ga0265328_10059576 | |||
| 503 | Ga0265320_10030055 | |||
| 504 | Ga0265325_10011063 | |||
| 505 | Ga0265329_10011030 | |||
| 506 | Ga0265331_10000144 | |||
| 507 | Ga0265331_10001968 | |||
| 508 | Ga0265331_10005310 | |||
| 509 | Ga0265331_10012237 | |||
| 510 | Ga0265331_10015686 | |||
| 511 | Ga0265331_10020077 | |||
| 512 | Ga0265331_10022860 | |||
| 513 | Ga0265331_10027619 | |||
| 514 | Ga0265331_10038495 | |||
| 515 | Ga0265327_10000077 | |||
| 516 | Ga0265327_10000314 | |||
| 517 | Ga0265327_10000528 | |||
| 518 | Ga0265327_10008311 | |||
| 519 | Ga0265327_10009180 | |||
| 520 | Ga0265327_10011473 | |||
| 521 | Ga0265327_10015687 | |||
| 522 | Ga0265327_10043507 | |||
| 523 | Ga0307408_100000574 | |||
| 524 | Ga0307408_100000699 | |||
| 525 | Ga0265313_10121038 | |||
| 526 | Ga0316575_10000042 | |||
| 527 | Ga0316575_10012962 | |||
| 528 | Ga0265314_10000207 | |||
| 529 | Ga0265314_10011151 | |||
| 530 | Ga0265314_10012644 | |||
| 531 | Ga0265342_10010154 | |||
| 532 | Ga0307516_10000048 | |||
| 533 | Ga0307516_10045769 | |||
| 534 | Ga0307405_10029699 | |||
| 535 | Ga0307405_10050695 | |||
| 536 | Ga0307405_10289159 | |||
| 537 | Ga0307406_10000834 | |||
| 538 | Ga0307406_10033559 | |||
| 539 | Ga0307412_10026499 | |||
| 540 | Ga0307412_10029707 | |||
| 541 | Ga0307416_100489451 | |||
| 542 | Ga0316593_10000385 | |||
| 543 | Ga0316593_10016802 | |||
| 544 | Ga0373937_0030010 | |||
| 545 | Ga0316582_0044559 | |||
| 546 | Ga0395905_0151398 | |||
| 547 | Ga0400490_03127 | |||
| 548 | Ga0400490_04196 | |||
| 549 | Ga0400491_09838 | |||
| 550 | Ga0400483_058231 | |||
| 551 | Ga0400483_063003 | |||
| 552 | Ga0400483_079712 | |||
| 553 | Ga0400483_222800 | |||
| 554 | Ga0400489_11147 | |||
| 555 | Ga0436361_0014095 | |||
| 556 | Ga0436361_0207523 | |||
| 557 | Ga0436361_0308044 | |||
| 558 | Ga0436361_0512442 | |||
| 559 | Ga0436361_0743645 | |||
| 560 | Ga0436361_0781475 | |||
| 561 | Ga0436361_1111363 | |||
| 562 | Ga0439438_006206 | |||
| 563 | Ga0439447_013369 | |||
| 564 | Ga0439447_027584 | |||
| 565 | Ga0439466_0027089 | |||
| 566 | Ga0439431_0000429 | |||
| 567 | Ga0439432_000568 | |||
| 568 | Ga0439432_009578 | |||
| 569 | Ga0439451_005209 | |||
| 570 | Ga0439452_022478 | |||
| 571 | Ga0439463_000657 | |||
| 572 | Ga0450911_000205 | |||
| 573 | Ga0439446_0025056 | |||
| 574 | Ga0451577_0006776 | |||
| 575 | Ga0451577_0026660 | |||
| 576 | Ga0451577_0091271 | |||
| 577 | Ga0451577_0116821 | |||
| 578 | Ga0451577_0139848 | |||
| 579 | Ga0451577_0386926 | |||
| 580 | Ga0451577_0832713 | |||
| 581 | Ga0451577_0925343 | |||
| 582 | Ga0453684_0014391 | |||
| 583 | Ga0453684_0028934 | |||
| 584 | Ga0453684_0087007 | |||
| 585 | Ga0453684_0104860 | |||
| 586 | Ga0453684_0255981 | |||
| 587 | Ga0453684_0298581 | |||
| 588 | Ga0451576_0000570 | |||
| 589 | Ga0451576_0002197 | |||
| 590 | Ga0451576_0002214 | |||
| 591 | Ga0451576_0003219 | |||
| 592 | Ga0451576_0018983 | |||
| 593 | Ga0451576_0070436 | |||
| 594 | Ga0451576_0125989 | |||
| 595 | Ga0495591_000781 | |||
| 596 | Ga0495591_004619 | |||
| 597 | Ga0495650_0010358 | |||
| 598 | Ga0495605_0000278 | |||
| 599 | Ga0495605_0000930 | |||
| 600 | Ga0495584_0019638 | |||
| 601 | Ga0495594_0000635 | |||
| 602 | Ga0495607_0001805 | |||
| 603 | Ga0495607_0010360 | |||
| 604 | Ga0495583_0000504 | |||
| 605 | Ga0495583_0003618 | |||
| 606 | Ga0495583_0006029 | |||
| 607 | Ga0495606_0000631 | |||
| 608 | Ga0495616_0026315 | |||
| 609 | Ga0495620_0000153 | |||
| 610 | Ga0495620_0004357 | |||
| 611 | Ga0495620_0045690 | |||
| 612 | Ga0495631_0026244 | |||
| 613 | Ga0495632_0006335 | |||
| 614 | Ga0495637_0001314 | |||
| 615 | Ga0495637_0041094 | |||
| 616 | Ga0495643_0001069 | |||
| 617 | Ga0495643_0021682 | |||
| 618 | Ga0495643_0032702 | |||
| 619 | Ga0495643_0084734 | |||
| 620 | Ga0495648_0002836 | |||
| 621 | Ga0495648_0007939 | |||
| 622 | Ga0495654_0001456 | |||
| 623 | Ga0495654_0007193 | |||
| 624 | Ga0495609_0000166 | |||
| 625 | Ga0495597_0003210 | |||
| 626 | Ga0495633_0000291 | |||
| 627 | Ga0495668_0031331 | |||
| 628 | Ga0495668_0052087 | |||
| 629 | Ga0495611_0003776 | |||
| 630 | Ga0495661_0000277 | |||
| 631 | Ga0495661_0000294 | |||
| 632 | Ga0495661_0004957 | |||
| 633 | Ga0495661_0035843 | |||
| 634 | Ga0495658_0056871 | |||
| 635 | Ga0495671_0001637 | |||
| 636 | Ga0495671_0006472 | |||
| 637 | Ga0495671_0008224 | |||
| 638 | Ga0495649_0009394 | |||
| 639 | Ga0495649_0037076 | |||
| 640 | Ga0495589_0000676 | |||
| 641 | Ga0495660_0008552 | |||
| 642 | Ga0495660_0054678 | |||
| 643 | Ga0495672_0011861 | |||
| 644 | Ga0495683_0000196 | |||
| 645 | Ga0495679_000987 | |||
| 646 | Ga0495673_0002977 | |||
| 647 | Ga0495673_0005263 | |||
| 648 | Ga0495673_0013086 | |||
| 649 | Ga0495673_0047142 | |||
| 650 | Ga0495681_0014262 | |||
| 651 | Ga0495681_0070300 | |||
| 652 | Ga0495686_0256649 | |||
| 653 | Ga0496110_0056624 | |||
| 654 | Ga0496110_0069820 | |||
| 655 | Ga0496114_0323513 | |||
| 656 | Ga0496118_0030448 | |||
| 657 | Ga0496121_0004825 | |||
| 658 | Ga0496122_0004379 | |||
| 659 | Ga0496123_0051205 | |||
| 660 | Ga0496124_0008721 | |||
| 661 | Ga0496124_0088934 | |||
| 662 | Ga0496125_0065367 | |||
| 663 | Ga0496125_0065827 | |||
| 664 | Ga0495678_000268 | |||
| 665 | Ga0495678_001974 | |||
| 666 | Ga0495678_020969 | |||
| 667 | Ga0495678_021986 | |||
| 668 | Ga0495678_074383 | |||
| 669 | Ga0495682_0000911 | |||
| 670 | Ga0501226_000033 | |||
| 671 | Ga0501226_001139 | |||
| 672 | Ga0590071_008764 | |||
| 673 | Ga0590075_017512 | |||
| 674 | 2547372183 | |||
| 675 | 2574430140 | |||
| 676 | 2599502354 | |||
| 677 | 2599933948 | |||
| 678 | 2599945763 | |||
| 679 | 2599956757 | |||
| 680 | 2599975278 | |||
| 681 | 2599984848 | |||
| 682 | 2599988067 | |||
| 683 | 2599998857 | |||
| 684 | 2600046395 | |||
| 685 | 2600446015 | |||
| 686 | 2671586790 | |||
| 687 | 2678265846 | |||
| 688 | 2738690343 | |||
| 689 | 2738716209 | |||
| 690 | 2739243171 | |||
| 691 | 2739266117 | |||
| 692 | 2739289802 | |||
| 693 | 2739295114 | |||
| 694 | 2745007078 | |||
| 695 | 2808906411 | |||
| 696 | 2842808017 | |||
| 697 | 2842855319 | |||
| 698 | 2843693353 | |||
| 699 | 2846042172 | |||
| 700 | 2891635434 | |||
| 701 | 2952254664 | |||
| 702 | 3007867049 | |||
| 703 | 3007872415 | |||
| 704 | 639788484 | |||
| 705 | 8056148466 | |||
| 706 | 8057162112 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6y88-assembly8.cif.gz_H | igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp | 0.9818 | 2 | 265 |
| 6y88-assembly8.cif.gz_H | igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp | 0.9781 | 2 | 265 |
| 3t55-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with phenoxymethyl benzoic acid (pmba) | 0.9614 | 5 | 265 |
| 2c3z-assembly1.cif.gz_A | crystal structure of a truncated variant of indole-3-glycerol phosphate synthase from sulfolobus solfataricus | 0.9554 | 43 | 253 |
| 6y88-assembly7.cif.gz_G | igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp | 0.9508 | 12 | 265 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2c3zA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9554 | 43 | 253 | 3.20.20.70 |
| af_B4FS35_106_381_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9536 | 1 | 264 | 3.20.20.70 |
| af_P00909_2_259_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9426 | 3 | 267 | 3.20.20.70 |
| af_Q0JCI6_1_245_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9414 | 37 | 264 | 3.20.20.70 |
| 3t40A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9397 | 5 | 264 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T1ARB3-F1-model_v4 | indole-3-glycerol-phosphate synthase (EC 4.1.1.48) | 0.9961 | 85 | 226 |
GO:0000162
GO:0004425 GO:0004640 GO:0016757 |
| AF-K0ICW5-F1-model_v4 | indole-3-glycerol-phosphate synthase (EC 4.1.1.48) | 0.9918 | 17 | 266 |
GO:0000162
GO:0004425 GO:0004640 GO:0006568 |
| AF-D5X013-F1-model_v4 | Indole-3-glycerol phosphate synthase (IGPS) (EC 4.1.1.48) | 0.9907 | 6 | 264 |
GO:0000162
GO:0004425 GO:0004640 GO:0006568 |
| AF-A0A531M3W6-F1-model_v4 | indole-3-glycerol-phosphate synthase (EC 4.1.1.48) | 0.9879 | 70 | 215 |
GO:0000162
GO:0004425 GO:0004640 |
| AF-A0A023XAN1-F1-model_v4 | deleted | 0.9868 | 6 | 264 |
|