F419484

General Info

Members Datasets Scaffolds Average Seq Length
353 224 706 268

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0003829|Ga0453683_0003829_7056_8018
Length 320
Sequence LLDVFHDISCDAYSAHFSILLELECVPYSREPSMSDILKKILAVKAQEVAAAKPAKPLPILRAEAEHAAPIRDFVGAIRNRIAAGHPAVIAEIKKASPSKGVIREDFRPAEIAKSYELHGAACLSVLTDEQFFQGSAEYLKQARAACELPVLRKDFIVDEYQIYQARAMGADAVLLIAAALTLKQMQAFESLAHQLGMAVLVEVHDAEELETALQLTTPLLGINNRNLRTFEVTLQTTLDLLAKIPQDRIVVTESGIFTQADVHLMREHQVNAFLVGEAFMRARDPGVELAQVFNQIGKKPSCSYGVGMLHLRCKKTTVA

Samples

Sample ID Description Type Environment
1 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
105 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
106 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
109 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
112 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
129 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
130 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
131 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
134 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
135 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
136 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
137 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
138 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
139 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
140 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
141 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
142 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
158 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
175 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
176 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
177 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
188 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
189 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
190 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
193 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
194 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
195 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
196 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
197 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
198 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
199 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
200 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
201 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
202 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
203 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
204 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
205 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
206 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
207 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
208 2738543012 Acidovorax sp. CF301 Isolate Unclassified
209 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
210 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
211 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
212 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
213 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
214 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
215 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
216 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
217 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
218 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
219 2952252522 Salinicola sp. DM10 Isolate Unclassified
220 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
221 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
222 639633007 Azoarcus olearius BH72 Isolate Unclassified
223 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
224 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.08
Metatranscriptomes 0.57
Isolates 9.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0.57
Rhizoplane 3.97
Rhizosphere 84.7
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453683_0003829 3300044673 Bacteria 10922
2 JGI25162J39368_1000324 3300002737 Bacteria 41886
3 Ga0055536_1002226 3300003781 Bacteria 11039
4 Ga0055530_10000513 3300003791 Bacteria 33776
5 Ga0065714_10073876 3300005288 Bacteria 3116
6 Ga0065704_10004129 3300005289 Bacteria 6335
7 Ga0070676_10046988 3300005328 Bacteria 2519
8 Ga0070690_100010188 3300005330 Bacteria 5462
9 Ga0070670_100055153 3300005331 Bacteria 3411
10 Ga0070670_100161245 3300005331 Bacteria 1943
11 Ga0070670_100576262 3300005331 Bacteria 1006
12 Ga0070677_10002876 3300005333 Bacteria 5530
13 Ga0070677_10059486 3300005333 Bacteria 1572
14 Ga0068869_100044334 3300005334 Bacteria 3198
15 Ga0068869_100075250 3300005334 Bacteria 2508
16 Ga0070666_10037552 3300005335 Bacteria 3221
17 Ga0070666_10183020 3300005335 Bacteria 1470
18 Ga0070689_100432188 3300005340 Bacteria 1117
19 Ga0070668_100021137 3300005347 Bacteria 4919
20 Ga0070669_100139066 3300005353 Bacteria 1870
21 Ga0070675_100078373 3300005354 Bacteria 2751
22 Ga0070675_100250704 3300005354 Bacteria 1549
23 Ga0070671_100026746 3300005355 Bacteria 4745
24 Ga0070674_100041648 3300005356 Bacteria 3114
25 Ga0070673_100031143 3300005364 Bacteria 4000
26 Ga0070673_100097338 3300005364 Bacteria 2416
27 Ga0070688_100008002 3300005365 Bacteria 5719
28 Ga0070667_100085286 3300005367 Bacteria 2708
29 Ga0070667_100172050 3300005367 Bacteria 1913
30 Ga0070701_10010200 3300005438 Bacteria 4144
31 Ga0070700_100070528 3300005441 Bacteria 2228
32 Ga0070663_100011363 3300005455 Bacteria 5586
33 Ga0070678_100065251 3300005456 Bacteria 2702
34 Ga0068867_100001996 3300005459 Bacteria 14233
35 Ga0068867_100039635 3300005459 Bacteria 3435
36 Ga0068867_100052301 3300005459 Bacteria 3014
37 Ga0070685_10014498 3300005466 Bacteria 4177
38 Ga0070672_100064646 3300005543 Bacteria 2891
39 Ga0070672_100153989 3300005543 Bacteria 1903
40 Ga0070686_100011188 3300005544 Bacteria 5083
41 Ga0070665_100044468 3300005548 Bacteria 4460
42 Ga0070702_100011121 3300005615 Bacteria 4467
43 Ga0068859_100098082 3300005617 Bacteria 2984
44 Ga0068861_100077737 3300005719 Bacteria 2589
45 Ga0068870_10081643 3300005840 Bacteria 1788
46 Ga0068863_100064255 3300005841 Bacteria 3471
47 Ga0068858_100082584 3300005842 Bacteria 2987
48 Ga0068858_100348235 3300005842 Bacteria 1419
49 Ga0068860_100023269 3300005843 Bacteria 5987
50 Ga0068860_100103557 3300005843 Bacteria 2717
51 Ga0097621_100156307 3300006237 Bacteria 1957
52 Ga0068871_100151288 3300006358 Bacteria 1979
53 Ga0068865_100129698 3300006881 Bacteria 1887
54 Ga0097620_100098090 3300006931 Bacteria 2984
55 Ga0079104_1000446 3300006946 Bacteria 46720
56 Ga0105251_10002972 3300009011 Bacteria 12686
57 Ga0111539_10165996 3300009094 Bacteria 2581
58 Ga0105245_10050253 3300009098 Bacteria 3736
59 Ga0105243_10000562 3300009148 Bacteria 37568
60 Ga0105243_10008193 3300009148 Bacteria 8025
61 Ga0105242_10061382 3300009176 Bacteria 3092
62 Ga0105248_10281729 3300009177 Bacteria 1871
63 Ga0105249_10027654 3300009553 Bacteria 5118
64 Ga0105246_10239317 3300011119 Bacteria 1434
65 Ga0157370_10001229 3300013104 Bacteria 32093
66 Ga0157374_10000924 3300013296 Bacteria 25554
67 Ga0157374_10170265 3300013296 Bacteria 2124
68 Ga0157378_10014121 3300013297 Bacteria 6989
69 Ga0163162_10393978 3300013306 Bacteria 1517
70 Ga0157372_10408185 3300013307 Bacteria 1583
71 Ga0157375_10421854 3300013308 Bacteria 1500
72 Ga0163163_10509086 3300014325 Bacteria 1266
73 Ga0157380_10044769 3300014326 Bacteria 3469
74 Ga0157377_10000160 3300014745 Bacteria 41263
75 Ga0157377_10031810 3300014745 Bacteria 2870
76 Ga0157379_10165797 3300014968 Bacteria 1994
77 Ga0157379_10174883 3300014968 Bacteria 1938
78 Ga0157376_10081833 3300014969 Bacteria 2773
79 Ga0163161_10006283 3300017792 Bacteria 8224
80 Ga0163161_10052234 3300017792 Bacteria 2962
81 Ga0213872_10000045 3300021361 Bacteria 112229
82 Ga0213872_10000440 3300021361 Bacteria 34046
83 Ga0213872_10000674 3300021361 Bacteria 25844
84 Ga0213872_10000924 3300021361 Bacteria 20820
85 Ga0213872_10045708 3300021361 Bacteria 1992
86 Ga0209563_100088 3300025230 Bacteria 175375
87 Ga0207697_10002805 3300025315 Bacteria 8864
88 Ga0207655_1000040 3300025728 Bacteria 335311
89 Ga0207713_1018085 3300025735 Bacteria 3501
90 Ga0207682_10000452 3300025893 Bacteria 18894
91 Ga0207682_10034045 3300025893 Bacteria 2053
92 Ga0207680_10025188 3300025903 Bacteria 3279
93 Ga0207645_10002682 3300025907 Bacteria 13864
94 Ga0207645_10006835 3300025907 Bacteria 8137
95 Ga0207643_10015061 3300025908 Bacteria 4204
96 Ga0207681_10127809 3300025923 Bacteria 1874
97 Ga0207650_10017423 3300025925 Bacteria 5030
98 Ga0207650_10226348 3300025925 Bacteria 1507
99 Ga0207659_10154679 3300025926 Bacteria 1794
100 Ga0207659_10481720 3300025926 Bacteria 1048
101 Ga0207687_10127530 3300025927 Bacteria 1913
102 Ga0207687_10316202 3300025927 Bacteria 1262
103 Ga0207644_10005959 3300025931 Bacteria 7947
104 Ga0207706_10011334 3300025933 Bacteria 8123
105 Ga0207686_10312203 3300025934 Bacteria 1171
106 Ga0207709_10001469 3300025935 Bacteria 16353
107 Ga0207709_10025100 3300025935 Bacteria 3410
108 Ga0207709_10209372 3300025935 Bacteria 1398
109 Ga0207704_10012780 3300025938 Bacteria 4175
110 Ga0207691_10083457 3300025940 Bacteria 2868
111 Ga0207691_10148368 3300025940 Bacteria 2063
112 Ga0207711_10075412 3300025941 Bacteria 2935
113 Ga0207689_10029433 3300025942 Bacteria 4585
114 Ga0207689_10095991 3300025942 Bacteria 2435
115 Ga0207651_10291832 3300025960 Bacteria 1352
116 Ga0207712_10074248 3300025961 Bacteria 2455
117 Ga0207668_10049131 3300025972 Bacteria 2898
118 Ga0207640_10171655 3300025981 Bacteria 1617
119 Ga0207658_10038011 3300025986 Bacteria 3464
120 Ga0207677_10216368 3300026023 Bacteria 1533
121 Ga0207703_10651475 3300026035 Bacteria 999
122 Ga0207678_10015363 3300026067 Bacteria 6734
123 Ga0207708_10001857 3300026075 Bacteria 15564
124 Ga0207641_10078495 3300026088 Bacteria 2859
125 Ga0207648_10000574 3300026089 Bacteria 41215
126 Ga0207648_10007623 3300026089 Bacteria 10610
127 Ga0207648_10059527 3300026089 Bacteria 3331
128 Ga0207676_10058160 3300026095 Bacteria 3048
129 Ga0207676_10087630 3300026095 Bacteria 2546
130 Ga0207676_10584726 3300026095 Bacteria 1071
131 Ga0207683_10154293 3300026121 Bacteria 2074
132 Ga0207698_10437987 3300026142 Bacteria 1258
133 Ga0209281_1000060 3300027111 Bacteria 295683
134 Ga0268266_10109761 3300028379 Bacteria 2443
135 Ga0268264_10033611 3300028381 Bacteria 4215
136 Ga0268264_10084747 3300028381 Bacteria 2718
137 Ga0265336_10000371 3300028666 Bacteria 28840
138 Ga0307515_10062795 3300028794 Bacteria 5236
139 Ga0307515_10235312 3300028794 Bacteria 1614
140 Ga0265338_10073015 3300028800 Bacteria 2927
141 Ga0265324_10000092 3300029957 Bacteria 69604
142 Ga0265324_10004594 3300029957 Bacteria 6172
143 Ga0265324_10004656 3300029957 Bacteria 6112
144 Ga0316183_1125898 3300030742 Bacteria 4891
145 Ga0316181_1085618 3300030744 Bacteria 2246
146 Ga0265330_10006726 3300031235 Bacteria 5668
147 Ga0265328_10000016 3300031239 Bacteria 132959
148 Ga0265328_10012526 3300031239 Bacteria 3373
149 Ga0265328_10059576 3300031239 Bacteria 1401
150 Ga0265320_10030055 3300031240 Bacteria 2806
151 Ga0265325_10011063 3300031241 Bacteria 5193
152 Ga0265329_10011030 3300031242 Bacteria 3296
153 Ga0265331_10000144 3300031250 Bacteria 92791
154 Ga0265331_10001968 3300031250 Bacteria 14339
155 Ga0265331_10005310 3300031250 Bacteria 7797
156 Ga0265331_10012237 3300031250 Bacteria 4655
157 Ga0265331_10015686 3300031250 Bacteria 3994
158 Ga0265331_10020077 3300031250 Bacteria 3436
159 Ga0265331_10022860 3300031250 Bacteria 3184
160 Ga0265331_10027619 3300031250 Bacteria 2844
161 Ga0265331_10038495 3300031250 Bacteria 2337
162 Ga0265327_10000077 3300031251 Bacteria 211850
163 Ga0265327_10000314 3300031251 Bacteria 92783
164 Ga0265327_10000528 3300031251 Bacteria 65837
165 Ga0265327_10008311 3300031251 Bacteria 7763
166 Ga0265327_10009180 3300031251 Bacteria 7182
167 Ga0265327_10011473 3300031251 Bacteria 6093
168 Ga0265327_10015687 3300031251 Bacteria 4869
169 Ga0265327_10043507 3300031251 Bacteria 2402
170 Ga0307408_100000574 3300031548 Bacteria 31711
171 Ga0307408_100000699 3300031548 Bacteria 27364
172 Ga0265313_10121038 3300031595 Bacteria 1141
173 Ga0316575_10000042 3300031665 Bacteria 31213
174 Ga0316575_10012962 3300031665 Bacteria 3111
175 Ga0265314_10000207 3300031711 Bacteria 86954
176 Ga0265314_10011151 3300031711 Bacteria 7448
177 Ga0265314_10012644 3300031711 Bacteria 6870
178 Ga0265342_10010154 3300031712 Bacteria 6560
179 Ga0307516_10000048 3300031730 Bacteria 130378
180 Ga0307516_10045769 3300031730 Bacteria 4320
181 Ga0307405_10029699 3300031731 Bacteria 3197
182 Ga0307405_10050695 3300031731 Bacteria 2571
183 Ga0307405_10289159 3300031731 Bacteria 1238
184 Ga0307406_10000834 3300031901 Bacteria 17319
185 Ga0307406_10033559 3300031901 Bacteria 3143
186 Ga0307412_10026499 3300031911 Bacteria 3603
187 Ga0307412_10029707 3300031911 Bacteria 3432
188 Ga0307416_100489451 3300032002 Bacteria 1292
189 Ga0316593_10000385 3300032168 Bacteria 7877
190 Ga0316593_10016802 3300032168 Bacteria 2224
191 Ga0373937_0030010 3300036401 Bacteria 4925
192 Ga0316582_0044559 3300036647 Bacteria 2789
193 Ga0395905_0151398 3300037471 Bacteria 2182
194 Ga0400490_03127 3300038726 Bacteria 5388
195 Ga0400490_04196 3300038726 Bacteria 8292
196 Ga0400491_09838 3300038727 Bacteria 1925
197 Ga0400483_058231 3300039062 Bacteria 1784
198 Ga0400483_063003 3300039062 Unclassified 1548
199 Ga0400483_079712 3300039062 Bacteria 57268
200 Ga0400483_222800 3300039062 Bacteria 244239
201 Ga0400489_11147 3300039093 Bacteria 1030
202 Ga0436361_0014095 3300039447 Bacteria 35713
203 Ga0436361_0207523 3300039447 Bacteria 56742
204 Ga0436361_0308044 3300039447 Bacteria 2537
205 Ga0436361_0512442 3300039447 Bacteria 20430
206 Ga0436361_0743645 3300039447 Bacteria 72606
207 Ga0436361_0781475 3300039447 Bacteria 3387
208 Ga0436361_1111363 3300039447 Bacteria 1584
209 Ga0439438_006206 3300041405 Bacteria 4255
210 Ga0439447_013369 3300041407 Bacteria 2330
211 Ga0439447_027584 3300041407 Bacteria 1448
212 Ga0439466_0027089 3300041411 Bacteria 1986
213 Ga0439431_0000429 3300041997 Bacteria 8934
214 Ga0439432_000568 3300042006 Bacteria 13848
215 Ga0439432_009578 3300042006 Bacteria 3375
216 Ga0439451_005209 3300042009 Bacteria 2644
217 Ga0439452_022478 3300042010 Bacteria 1631
218 Ga0439463_000657 3300042016 Bacteria 9599
219 Ga0450911_000205 3300042115 Bacteria 23269
220 Ga0439446_0025056 3300042156 Bacteria 1705
221 Ga0451577_0006776 3300042876 Bacteria 11360
222 Ga0451577_0026660 3300042876 Bacteria 5234
223 Ga0451577_0091271 3300042876 Bacteria 2719
224 Ga0451577_0116821 3300042876 Bacteria 2390
225 Ga0451577_0139848 3300042876 Unclassified 2175
226 Ga0451577_0386926 3300042876 Bacteria 1269
227 Ga0451577_0832713 3300042876 Bacteria 833
228 Ga0451577_0925343 3300042876 Unclassified 784
229 Ga0453684_0014391 3300044712 Bacteria 12663
230 Ga0453684_0028934 3300044712 Bacteria 7886
231 Ga0453684_0087007 3300044712 Bacteria 3875
232 Ga0453684_0104860 3300044712 Bacteria 3450
233 Ga0453684_0255981 3300044712 Bacteria 2008
234 Ga0453684_0298581 3300044712 Bacteria 1831
235 Ga0451576_0000570 3300045051 Bacteria 78726
236 Ga0451576_0002197 3300045051 Bacteria 30078
237 Ga0451576_0002214 3300045051 Bacteria 29931
238 Ga0451576_0003219 3300045051 Bacteria 22759
239 Ga0451576_0018983 3300045051 Bacteria 7512
240 Ga0451576_0070436 3300045051 Bacteria 3640
241 Ga0451576_0125989 3300045051 Bacteria 2668
242 Ga0495591_000781 3300046458 Bacteria 22669
243 Ga0495591_004619 3300046458 Bacteria 6636
244 Ga0495650_0010358 3300046471 Bacteria 5210
245 Ga0495605_0000278 3300046474 Bacteria 57625
246 Ga0495605_0000930 3300046474 Bacteria 20030
247 Ga0495584_0019638 3300046491 Bacteria 3432
248 Ga0495594_0000635 3300046499 Bacteria 18070
249 Ga0495607_0001805 3300046501 Bacteria 18284
250 Ga0495607_0010360 3300046501 Bacteria 6272
251 Ga0495583_0000504 3300046506 Bacteria 56210
252 Ga0495583_0003618 3300046506 Bacteria 11573
253 Ga0495583_0006029 3300046506 Bacteria 8032
254 Ga0495606_0000631 3300046507 Bacteria 55444
255 Ga0495616_0026315 3300046513 Bacteria 3098
256 Ga0495620_0000153 3300046515 Bacteria 56187
257 Ga0495620_0004357 3300046515 Bacteria 7994
258 Ga0495620_0045690 3300046515 Bacteria 1894
259 Ga0495631_0026244 3300046518 Bacteria 2677
260 Ga0495632_0006335 3300046519 Bacteria 7634
261 Ga0495637_0001314 3300046520 Bacteria 14925
262 Ga0495637_0041094 3300046520 Bacteria 1986
263 Ga0495643_0001069 3300046522 Bacteria 27292
264 Ga0495643_0021682 3300046522 Bacteria 3680
265 Ga0495643_0032702 3300046522 Bacteria 2884
266 Ga0495643_0084734 3300046522 Bacteria 1644
267 Ga0495648_0002836 3300046524 Bacteria 15600
268 Ga0495648_0007939 3300046524 Bacteria 8417
269 Ga0495654_0001456 3300046530 Bacteria 16218
270 Ga0495654_0007193 3300046530 Bacteria 6243
271 Ga0495609_0000166 3300046538 Bacteria 69064
272 Ga0495597_0003210 3300046542 Bacteria 9734
273 Ga0495633_0000291 3300046558 Bacteria 57655
274 Ga0495668_0031331 3300046616 Bacteria 2997
275 Ga0495668_0052087 3300046616 Bacteria 2265
276 Ga0495611_0003776 3300046648 Bacteria 6613
277 Ga0495661_0000277 3300046665 Bacteria 58877
278 Ga0495661_0000294 3300046665 Bacteria 56661
279 Ga0495661_0004957 3300046665 Bacteria 9520
280 Ga0495661_0035843 3300046665 Bacteria 3110
281 Ga0495658_0056871 3300046683 Bacteria 2232
282 Ga0495671_0001637 3300046692 Bacteria 14695
283 Ga0495671_0006472 3300046692 Bacteria 6767
284 Ga0495671_0008224 3300046692 Bacteria 5884
285 Ga0495649_0009394 3300046694 Bacteria 5819
286 Ga0495649_0037076 3300046694 Bacteria 2677
287 Ga0495589_0000676 3300046794 Bacteria 22317
288 Ga0495660_0008552 3300046810 Bacteria 5992
289 Ga0495660_0054678 3300046810 Bacteria 2162
290 Ga0495672_0011861 3300047320 Bacteria 6119
291 Ga0495683_0000196 3300047323 Bacteria 57478
292 Ga0495679_000987 3300047446 Bacteria 17554
293 Ga0495673_0002977 3300047469 Bacteria 11414
294 Ga0495673_0005263 3300047469 Bacteria 7856
295 Ga0495673_0013086 3300047469 Bacteria 4370
296 Ga0495673_0047142 3300047469 Bacteria 1905
297 Ga0495681_0014262 3300047470 Bacteria 4565
298 Ga0495681_0070300 3300047470 Bacteria 1587
299 Ga0495686_0256649 3300047472 Bacteria 980
300 Ga0496110_0056624 3300048913 Bacteria 3450
301 Ga0496110_0069820 3300048913 Bacteria 3112
302 Ga0496114_0323513 3300048917 Bacteria 1363
303 Ga0496118_0030448 3300048921 Bacteria 4503
304 Ga0496121_0004825 3300048924 Bacteria 17756
305 Ga0496122_0004379 3300048925 Bacteria 17595
306 Ga0496123_0051205 3300048926 Bacteria 2751
307 Ga0496124_0008721 3300048927 Bacteria 10535
308 Ga0496124_0088934 3300048927 Bacteria 2523
309 Ga0496125_0065367 3300048928 Bacteria 2882
310 Ga0496125_0065827 3300048928 Bacteria 2867
311 Ga0495678_000268 3300049459 Bacteria 57604
312 Ga0495678_001974 3300049459 Bacteria 14782
313 Ga0495678_020969 3300049459 Bacteria 2884
314 Ga0495678_021986 3300049459 Bacteria 2797
315 Ga0495678_074383 3300049459 Bacteria 1236
316 Ga0495682_0000911 3300049460 Bacteria 18044
317 Ga0501226_000033 3300049853 Bacteria 72088
318 Ga0501226_001139 3300049853 Bacteria 3448
319 Ga0590071_008764 3300059421 Bacteria 2378
320 Ga0590075_017512 3300059424 Bacteria 1766
321 2547372183 2547132103 Bacteria 5115736
322 2574430140 2574179768 Bacteria 4907129
323 2599502354 2599185188 Bacteria 6164180
324 2599933948 2599185300 Bacteria 6062622
325 2599945763 2599185302 Bacteria 5954930
326 2599956757 2599185304 Bacteria 5951361
327 2599975278 2599185307 Bacteria 6194719
328 2599984848 2599185309 Bacteria 5969593
329 2599988067 2599185310 Bacteria 6014457
330 2599998857 2599185312 Bacteria 5912071
331 2600046395 2599185320 Bacteria 5963263
332 2600446015 2600254954 Bacteria 5100516
333 2671586790 2671180115 Bacteria 5353919
334 2678265846 2675903515 Bacteria 6580491
335 2738690343 2738541271 Bacteria 5657310
336 2738716209 2738541276 Bacteria 4690596
337 2739243171 2738543012 Bacteria 7115078
338 2739266117 2738543016 Bacteria 5657564
339 2739289802 2738543020 Bacteria 5718238
340 2739295114 2738543021 Bacteria 5718241
341 2745007078 2744054620 Bacteria 6551379
342 2808906411 2808606373 Bacteria 4423627
343 2842808017 2842805378 Bacteria 5385175
344 2842855319 2842854478 Bacteria 6143501
345 2843693353 2843690924 Bacteria 5169057
346 2846042172 2846037992 Bacteria 4526407
347 2891635434 2891633521 Bacteria 4602265
348 2952254664 2952252522 Bacteria 4171745
349 3007867049 3007866637 Bacteria 5899198
350 3007872415 3007872151 Bacteria 5268868
351 639788484 639633007 Bacteria 4376040
352 8056148466 8056143049 Bacteria 6307666
353 8057162112 8057160832 Bacteria 3268302
354 Ga0453683_0003829
355 JGI25162J39368_1000324
356 Ga0055536_1002226
357 Ga0055530_10000513
358 Ga0065714_10073876
359 Ga0065704_10004129
360 Ga0070676_10046988
361 Ga0070690_100010188
362 Ga0070670_100055153
363 Ga0070670_100161245
364 Ga0070670_100576262
365 Ga0070677_10002876
366 Ga0070677_10059486
367 Ga0068869_100044334
368 Ga0068869_100075250
369 Ga0070666_10037552
370 Ga0070666_10183020
371 Ga0070689_100432188
372 Ga0070668_100021137
373 Ga0070669_100139066
374 Ga0070675_100078373
375 Ga0070675_100250704
376 Ga0070671_100026746
377 Ga0070674_100041648
378 Ga0070673_100031143
379 Ga0070673_100097338
380 Ga0070688_100008002
381 Ga0070667_100085286
382 Ga0070667_100172050
383 Ga0070701_10010200
384 Ga0070700_100070528
385 Ga0070663_100011363
386 Ga0070678_100065251
387 Ga0068867_100001996
388 Ga0068867_100039635
389 Ga0068867_100052301
390 Ga0070685_10014498
391 Ga0070672_100064646
392 Ga0070672_100153989
393 Ga0070686_100011188
394 Ga0070665_100044468
395 Ga0070702_100011121
396 Ga0068859_100098082
397 Ga0068861_100077737
398 Ga0068870_10081643
399 Ga0068863_100064255
400 Ga0068858_100082584
401 Ga0068858_100348235
402 Ga0068860_100023269
403 Ga0068860_100103557
404 Ga0097621_100156307
405 Ga0068871_100151288
406 Ga0068865_100129698
407 Ga0097620_100098090
408 Ga0079104_1000446
409 Ga0105251_10002972
410 Ga0111539_10165996
411 Ga0105245_10050253
412 Ga0105243_10000562
413 Ga0105243_10008193
414 Ga0105242_10061382
415 Ga0105248_10281729
416 Ga0105249_10027654
417 Ga0105246_10239317
418 Ga0157370_10001229
419 Ga0157374_10000924
420 Ga0157374_10170265
421 Ga0157378_10014121
422 Ga0163162_10393978
423 Ga0157372_10408185
424 Ga0157375_10421854
425 Ga0163163_10509086
426 Ga0157380_10044769
427 Ga0157377_10000160
428 Ga0157377_10031810
429 Ga0157379_10165797
430 Ga0157379_10174883
431 Ga0157376_10081833
432 Ga0163161_10006283
433 Ga0163161_10052234
434 Ga0213872_10000045
435 Ga0213872_10000440
436 Ga0213872_10000674
437 Ga0213872_10000924
438 Ga0213872_10045708
439 Ga0209563_100088
440 Ga0207697_10002805
441 Ga0207655_1000040
442 Ga0207713_1018085
443 Ga0207682_10000452
444 Ga0207682_10034045
445 Ga0207680_10025188
446 Ga0207645_10002682
447 Ga0207645_10006835
448 Ga0207643_10015061
449 Ga0207681_10127809
450 Ga0207650_10017423
451 Ga0207650_10226348
452 Ga0207659_10154679
453 Ga0207659_10481720
454 Ga0207687_10127530
455 Ga0207687_10316202
456 Ga0207644_10005959
457 Ga0207706_10011334
458 Ga0207686_10312203
459 Ga0207709_10001469
460 Ga0207709_10025100
461 Ga0207709_10209372
462 Ga0207704_10012780
463 Ga0207691_10083457
464 Ga0207691_10148368
465 Ga0207711_10075412
466 Ga0207689_10029433
467 Ga0207689_10095991
468 Ga0207651_10291832
469 Ga0207712_10074248
470 Ga0207668_10049131
471 Ga0207640_10171655
472 Ga0207658_10038011
473 Ga0207677_10216368
474 Ga0207703_10651475
475 Ga0207678_10015363
476 Ga0207708_10001857
477 Ga0207641_10078495
478 Ga0207648_10000574
479 Ga0207648_10007623
480 Ga0207648_10059527
481 Ga0207676_10058160
482 Ga0207676_10087630
483 Ga0207676_10584726
484 Ga0207683_10154293
485 Ga0207698_10437987
486 Ga0209281_1000060
487 Ga0268266_10109761
488 Ga0268264_10033611
489 Ga0268264_10084747
490 Ga0265336_10000371
491 Ga0307515_10062795
492 Ga0307515_10235312
493 Ga0265338_10073015
494 Ga0265324_10000092
495 Ga0265324_10004594
496 Ga0265324_10004656
497 Ga0316183_1125898
498 Ga0316181_1085618
499 Ga0265330_10006726
500 Ga0265328_10000016
501 Ga0265328_10012526
502 Ga0265328_10059576
503 Ga0265320_10030055
504 Ga0265325_10011063
505 Ga0265329_10011030
506 Ga0265331_10000144
507 Ga0265331_10001968
508 Ga0265331_10005310
509 Ga0265331_10012237
510 Ga0265331_10015686
511 Ga0265331_10020077
512 Ga0265331_10022860
513 Ga0265331_10027619
514 Ga0265331_10038495
515 Ga0265327_10000077
516 Ga0265327_10000314
517 Ga0265327_10000528
518 Ga0265327_10008311
519 Ga0265327_10009180
520 Ga0265327_10011473
521 Ga0265327_10015687
522 Ga0265327_10043507
523 Ga0307408_100000574
524 Ga0307408_100000699
525 Ga0265313_10121038
526 Ga0316575_10000042
527 Ga0316575_10012962
528 Ga0265314_10000207
529 Ga0265314_10011151
530 Ga0265314_10012644
531 Ga0265342_10010154
532 Ga0307516_10000048
533 Ga0307516_10045769
534 Ga0307405_10029699
535 Ga0307405_10050695
536 Ga0307405_10289159
537 Ga0307406_10000834
538 Ga0307406_10033559
539 Ga0307412_10026499
540 Ga0307412_10029707
541 Ga0307416_100489451
542 Ga0316593_10000385
543 Ga0316593_10016802
544 Ga0373937_0030010
545 Ga0316582_0044559
546 Ga0395905_0151398
547 Ga0400490_03127
548 Ga0400490_04196
549 Ga0400491_09838
550 Ga0400483_058231
551 Ga0400483_063003
552 Ga0400483_079712
553 Ga0400483_222800
554 Ga0400489_11147
555 Ga0436361_0014095
556 Ga0436361_0207523
557 Ga0436361_0308044
558 Ga0436361_0512442
559 Ga0436361_0743645
560 Ga0436361_0781475
561 Ga0436361_1111363
562 Ga0439438_006206
563 Ga0439447_013369
564 Ga0439447_027584
565 Ga0439466_0027089
566 Ga0439431_0000429
567 Ga0439432_000568
568 Ga0439432_009578
569 Ga0439451_005209
570 Ga0439452_022478
571 Ga0439463_000657
572 Ga0450911_000205
573 Ga0439446_0025056
574 Ga0451577_0006776
575 Ga0451577_0026660
576 Ga0451577_0091271
577 Ga0451577_0116821
578 Ga0451577_0139848
579 Ga0451577_0386926
580 Ga0451577_0832713
581 Ga0451577_0925343
582 Ga0453684_0014391
583 Ga0453684_0028934
584 Ga0453684_0087007
585 Ga0453684_0104860
586 Ga0453684_0255981
587 Ga0453684_0298581
588 Ga0451576_0000570
589 Ga0451576_0002197
590 Ga0451576_0002214
591 Ga0451576_0003219
592 Ga0451576_0018983
593 Ga0451576_0070436
594 Ga0451576_0125989
595 Ga0495591_000781
596 Ga0495591_004619
597 Ga0495650_0010358
598 Ga0495605_0000278
599 Ga0495605_0000930
600 Ga0495584_0019638
601 Ga0495594_0000635
602 Ga0495607_0001805
603 Ga0495607_0010360
604 Ga0495583_0000504
605 Ga0495583_0003618
606 Ga0495583_0006029
607 Ga0495606_0000631
608 Ga0495616_0026315
609 Ga0495620_0000153
610 Ga0495620_0004357
611 Ga0495620_0045690
612 Ga0495631_0026244
613 Ga0495632_0006335
614 Ga0495637_0001314
615 Ga0495637_0041094
616 Ga0495643_0001069
617 Ga0495643_0021682
618 Ga0495643_0032702
619 Ga0495643_0084734
620 Ga0495648_0002836
621 Ga0495648_0007939
622 Ga0495654_0001456
623 Ga0495654_0007193
624 Ga0495609_0000166
625 Ga0495597_0003210
626 Ga0495633_0000291
627 Ga0495668_0031331
628 Ga0495668_0052087
629 Ga0495611_0003776
630 Ga0495661_0000277
631 Ga0495661_0000294
632 Ga0495661_0004957
633 Ga0495661_0035843
634 Ga0495658_0056871
635 Ga0495671_0001637
636 Ga0495671_0006472
637 Ga0495671_0008224
638 Ga0495649_0009394
639 Ga0495649_0037076
640 Ga0495589_0000676
641 Ga0495660_0008552
642 Ga0495660_0054678
643 Ga0495672_0011861
644 Ga0495683_0000196
645 Ga0495679_000987
646 Ga0495673_0002977
647 Ga0495673_0005263
648 Ga0495673_0013086
649 Ga0495673_0047142
650 Ga0495681_0014262
651 Ga0495681_0070300
652 Ga0495686_0256649
653 Ga0496110_0056624
654 Ga0496110_0069820
655 Ga0496114_0323513
656 Ga0496118_0030448
657 Ga0496121_0004825
658 Ga0496122_0004379
659 Ga0496123_0051205
660 Ga0496124_0008721
661 Ga0496124_0088934
662 Ga0496125_0065367
663 Ga0496125_0065827
664 Ga0495678_000268
665 Ga0495678_001974
666 Ga0495678_020969
667 Ga0495678_021986
668 Ga0495678_074383
669 Ga0495682_0000911
670 Ga0501226_000033
671 Ga0501226_001139
672 Ga0590071_008764
673 Ga0590075_017512
674 2547372183
675 2574430140
676 2599502354
677 2599933948
678 2599945763
679 2599956757
680 2599975278
681 2599984848
682 2599988067
683 2599998857
684 2600046395
685 2600446015
686 2671586790
687 2678265846
688 2738690343
689 2738716209
690 2739243171
691 2739266117
692 2739289802
693 2739295114
694 2745007078
695 2808906411
696 2842808017
697 2842855319
698 2843693353
699 2846042172
700 2891635434
701 2952254664
702 3007867049
703 3007872415
704 639788484
705 8056148466
706 8057162112

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00218

IGPS

Indole-3-glycerol phosphate synthase

38

293

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6y88-assembly8.cif.gz_H igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp 0.9818 2 265
6y88-assembly8.cif.gz_H igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp 0.9781 2 265
3t55-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with phenoxymethyl benzoic acid (pmba) 0.9614 5 265
2c3z-assembly1.cif.gz_A crystal structure of a truncated variant of indole-3-glycerol phosphate synthase from sulfolobus solfataricus 0.9554 43 253
6y88-assembly7.cif.gz_G igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp 0.9508 12 265
ID Description Score Start End Superfamily
2c3zA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9554 43 253 3.20.20.70
af_B4FS35_106_381_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9536 1 264 3.20.20.70
af_P00909_2_259_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9426 3 267 3.20.20.70
af_Q0JCI6_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9414 37 264 3.20.20.70
3t40A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9397 5 264 3.20.20.70
ID Description Score Start End GO Terms
AF-T1ARB3-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.9961 85 226 GO:0000162
GO:0004425
GO:0004640
GO:0016757
AF-K0ICW5-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.9918 17 266 GO:0000162
GO:0004425
GO:0004640
GO:0006568
AF-D5X013-F1-model_v4 Indole-3-glycerol phosphate synthase (IGPS) (EC 4.1.1.48) 0.9907 6 264 GO:0000162
GO:0004425
GO:0004640
GO:0006568
AF-A0A531M3W6-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.9879 70 215 GO:0000162
GO:0004425
GO:0004640
AF-A0A023XAN1-F1-model_v4 deleted 0.9868 6 264

Map