F419504
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 353 | 198 | 346 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300046664|Ga0495659_0103147|Ga0495659_0103147_492_1073 |
| Length | 193 |
| Sequence | MSLDALRETLPAYAKDLSLNLSSLANETVLSDQQKWGCFLASAHAVGQRQMVAATQAAAQAGGLTPEAANAAKAAAAIMGMNNVYYRALHLLSNPEYRTLPARLRMNVIANPGVEKADFELWCTAVSAVNGCGMCLDSHEAELKKHGLPAPLIQAALRIAAVVNAVSRVLQAEEVEAPGDVRRLGLEGAALGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 2 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 3 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 4 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 5 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 6 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 7 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 64 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 65 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 66 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 67 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 100 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 101 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 103 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 105 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 106 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 107 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 109 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 110 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 111 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 112 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 113 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 114 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 115 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 116 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 117 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 118 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 119 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 120 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 121 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 123 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 124 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 125 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 126 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 127 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 128 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 129 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 130 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 131 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 132 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 133 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 134 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 135 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 136 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 137 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 138 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 139 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 140 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 141 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 142 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 143 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 144 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 145 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 159 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 160 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 161 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 163 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 164 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 165 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 166 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 177 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 178 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 179 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 180 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 181 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 182 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 183 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 184 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 185 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 186 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 187 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 188 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 189 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 190 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 191 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 192 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 193 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 194 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 195 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 196 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 197 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 198 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.73 |
| Metatranscriptomes | 0.28 |
| Isolates | 1.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.18 |
| Nodule | 0 |
| Rhizoplane | 2.55 |
| Rhizosphere | 78.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10023328 | 3300003215 | Bacteria | 2259 |
| 2 | rootH2_10080531 | 3300003320 | Bacteria | 3215 |
| 3 | Ga0055536_1001916 | 3300003781 | Bacteria | 12067 |
| 4 | Ga0055530_10001482 | 3300003791 | Bacteria | 17041 |
| 5 | Ga0055531_10002587 | 3300003794 | Bacteria | 11983 |
| 6 | Ga0055531_10038183 | 3300003794 | Bacteria | 1446 |
| 7 | Ga0065165_1001044 | 3300005262 | Bacteria | 33434 |
| 8 | Ga0065165_1003241 | 3300005262 | Bacteria | 11800 |
| 9 | Ga0065715_10248328 | 3300005293 | Bacteria | 1176 |
| 10 | Ga0070658_10270681 | 3300005327 | Bacteria | 1445 |
| 11 | Ga0070658_10276221 | 3300005327 | Bacteria | 1429 |
| 12 | Ga0070683_100342799 | 3300005329 | Bacteria | 1423 |
| 13 | Ga0070683_100522664 | 3300005329 | Bacteria | 1134 |
| 14 | Ga0070690_100357261 | 3300005330 | Bacteria | 1062 |
| 15 | Ga0070670_100027269 | 3300005331 | Bacteria | 4914 |
| 16 | Ga0070670_100099608 | 3300005331 | Bacteria | 2501 |
| 17 | Ga0070670_100538690 | 3300005331 | Bacteria | 1041 |
| 18 | Ga0070680_100045589 | 3300005336 | Bacteria | 3565 |
| 19 | Ga0068868_100349922 | 3300005338 | Bacteria | 1265 |
| 20 | Ga0070660_100010321 | 3300005339 | Bacteria | 6596 |
| 21 | Ga0070660_100144305 | 3300005339 | Bacteria | 1911 |
| 22 | Ga0070668_100004828 | 3300005347 | Bacteria | 9994 |
| 23 | Ga0070668_100006236 | 3300005347 | Bacteria | 8832 |
| 24 | Ga0070668_100013620 | 3300005347 | Bacteria | 6073 |
| 25 | Ga0070668_100074247 | 3300005347 | Bacteria | 2653 |
| 26 | Ga0070668_100088046 | 3300005347 | Bacteria | 2444 |
| 27 | Ga0070669_100084724 | 3300005353 | Bacteria | 2366 |
| 28 | Ga0070671_100014881 | 3300005355 | Bacteria | 6287 |
| 29 | Ga0070671_100578125 | 3300005355 | Bacteria | 970 |
| 30 | Ga0070659_100002533 | 3300005366 | Bacteria | 12992 |
| 31 | Ga0070659_100013614 | 3300005366 | Bacteria | 6060 |
| 32 | Ga0070667_100040810 | 3300005367 | Bacteria | 3892 |
| 33 | Ga0070667_100082151 | 3300005367 | Bacteria | 2758 |
| 34 | Ga0070662_100054667 | 3300005457 | Bacteria | 2894 |
| 35 | Ga0070662_100504127 | 3300005457 | Bacteria | 1010 |
| 36 | Ga0070681_10092988 | 3300005458 | Bacteria | 2964 |
| 37 | Ga0070698_101197566 | 3300005471 | Bacteria | 709 |
| 38 | Ga0070684_100304429 | 3300005535 | Bacteria | 1463 |
| 39 | Ga0070684_100809091 | 3300005535 | Bacteria | 876 |
| 40 | Ga0068853_100021119 | 3300005539 | Bacteria | 5421 |
| 41 | Ga0068853_100060651 | 3300005539 | Bacteria | 3269 |
| 42 | Ga0068853_100266113 | 3300005539 | Bacteria | 1577 |
| 43 | Ga0068853_100873598 | 3300005539 | Bacteria | 863 |
| 44 | Ga0070665_100018581 | 3300005548 | Bacteria | 6968 |
| 45 | Ga0070665_100034717 | 3300005548 | Bacteria | 5073 |
| 46 | Ga0068855_100726333 | 3300005563 | Bacteria | 1061 |
| 47 | Ga0068855_101632679 | 3300005563 | Bacteria | 659 |
| 48 | Ga0070664_100086088 | 3300005564 | Bacteria | 2715 |
| 49 | Ga0068854_101468420 | 3300005578 | Bacteria | 618 |
| 50 | Ga0068852_100213467 | 3300005616 | Bacteria | 1832 |
| 51 | Ga0068859_100003282 | 3300005617 | Bacteria | 16458 |
| 52 | Ga0068859_100049833 | 3300005617 | Bacteria | 4206 |
| 53 | Ga0068859_100275818 | 3300005617 | Bacteria | 1774 |
| 54 | Ga0068859_100698786 | 3300005617 | Bacteria | 1105 |
| 55 | Ga0068859_100768721 | 3300005617 | Bacteria | 1052 |
| 56 | Ga0068864_100011878 | 3300005618 | Bacteria | 7189 |
| 57 | Ga0068863_100031486 | 3300005841 | Bacteria | 5060 |
| 58 | Ga0068863_100070383 | 3300005841 | Bacteria | 3308 |
| 59 | Ga0068863_100095381 | 3300005841 | Bacteria | 2823 |
| 60 | Ga0068863_100115758 | 3300005841 | Bacteria | 2555 |
| 61 | Ga0068863_100127352 | 3300005841 | Bacteria | 2430 |
| 62 | Ga0068863_100399562 | 3300005841 | Bacteria | 1344 |
| 63 | Ga0068863_100458329 | 3300005841 | Bacteria | 1252 |
| 64 | Ga0068858_100246276 | 3300005842 | Bacteria | 1697 |
| 65 | Ga0068858_101053385 | 3300005842 | Bacteria | 798 |
| 66 | Ga0068860_100000027 | 3300005843 | Bacteria | 267207 |
| 67 | Ga0068860_100091737 | 3300005843 | Bacteria | 2894 |
| 68 | Ga0068860_100177627 | 3300005843 | Bacteria | 2058 |
| 69 | Ga0068860_100727949 | 3300005843 | Bacteria | 1003 |
| 70 | Ga0068862_100013540 | 3300005844 | Bacteria | 6757 |
| 71 | Ga0068862_100013722 | 3300005844 | Bacteria | 6713 |
| 72 | Ga0068862_100221994 | 3300005844 | Bacteria | 1711 |
| 73 | Ga0068862_100494593 | 3300005844 | Bacteria | 1160 |
| 74 | Ga0075363_100135948 | 3300006048 | Bacteria | 1381 |
| 75 | Ga0097620_100003282 | 3300006931 | Bacteria | 16458 |
| 76 | Ga0097620_100049831 | 3300006931 | Bacteria | 4206 |
| 77 | Ga0097620_100275800 | 3300006931 | Bacteria | 1774 |
| 78 | Ga0097620_100698760 | 3300006931 | Bacteria | 1105 |
| 79 | Ga0097620_100768827 | 3300006931 | Bacteria | 1052 |
| 80 | Ga0105240_10705546 | 3300009093 | Bacteria | 1101 |
| 81 | Ga0105247_10072615 | 3300009101 | Bacteria | 2154 |
| 82 | Ga0105242_10183360 | 3300009176 | Bacteria | 1848 |
| 83 | Ga0105248_10005575 | 3300009177 | Bacteria | 13834 |
| 84 | Ga0105238_10057638 | 3300009551 | Bacteria | 3894 |
| 85 | Ga0105238_11560215 | 3300009551 | Bacteria | 690 |
| 86 | Ga0105249_10088271 | 3300009553 | Bacteria | 2896 |
| 87 | Ga0105239_10171064 | 3300010375 | Bacteria | 2430 |
| 88 | Ga0157373_10000851 | 3300013100 | Bacteria | 23696 |
| 89 | Ga0157373_10004928 | 3300013100 | Bacteria | 10049 |
| 90 | Ga0157370_10954618 | 3300013104 | Bacteria | 777 |
| 91 | Ga0157374_10960868 | 3300013296 | Bacteria | 873 |
| 92 | Ga0163162_10018044 | 3300013306 | Bacteria | 6905 |
| 93 | Ga0163162_10048059 | 3300013306 | Bacteria | 4275 |
| 94 | Ga0157372_11505519 | 3300013307 | Bacteria | 775 |
| 95 | Ga0157375_10053327 | 3300013308 | Bacteria | 3978 |
| 96 | Ga0157375_11223500 | 3300013308 | Bacteria | 881 |
| 97 | Ga0157375_11262759 | 3300013308 | Bacteria | 867 |
| 98 | Ga0163163_10051019 | 3300014325 | Bacteria | 4077 |
| 99 | Ga0163163_10151366 | 3300014325 | Bacteria | 2364 |
| 100 | Ga0163163_10292106 | 3300014325 | Bacteria | 1682 |
| 101 | Ga0157380_10782501 | 3300014326 | Bacteria | 969 |
| 102 | Ga0157377_10503085 | 3300014745 | Bacteria | 847 |
| 103 | Ga0157379_10001109 | 3300014968 | Bacteria | 22021 |
| 104 | Ga0163161_10879542 | 3300017792 | Bacteria | 758 |
| 105 | Ga0213872_10004761 | 3300021361 | Bacteria | 7103 |
| 106 | Ga0213872_10143306 | 3300021361 | Bacteria | 1047 |
| 107 | Ga0213876_10035199 | 3300021384 | Bacteria | 2641 |
| 108 | Ga0213876_10049871 | 3300021384 | Bacteria | 2212 |
| 109 | Ga0213875_10020340 | 3300021388 | Bacteria | 3184 |
| 110 | Ga0209026_1011724 | 3300025250 | Bacteria | 1560 |
| 111 | Ga0209758_1000852 | 3300025297 | Bacteria | 42442 |
| 112 | Ga0209050_1000053 | 3300025298 | Bacteria | 349521 |
| 113 | Ga0209257_1000289 | 3300025304 | Bacteria | 110882 |
| 114 | Ga0209257_1003257 | 3300025304 | Bacteria | 14217 |
| 115 | Ga0207710_10037378 | 3300025900 | Bacteria | 2144 |
| 116 | Ga0207705_10100515 | 3300025909 | Bacteria | 2127 |
| 117 | Ga0207705_10447960 | 3300025909 | Bacteria | 1001 |
| 118 | Ga0207657_10056416 | 3300025919 | Bacteria | 3389 |
| 119 | Ga0207681_10011289 | 3300025923 | Bacteria | 5488 |
| 120 | Ga0207681_10044523 | 3300025923 | Bacteria | 2975 |
| 121 | Ga0207681_11065680 | 3300025923 | Bacteria | 679 |
| 122 | Ga0207694_10046259 | 3300025924 | Bacteria | 3363 |
| 123 | Ga0207650_10005998 | 3300025925 | Bacteria | 8292 |
| 124 | Ga0207650_10072910 | 3300025925 | Bacteria | 2585 |
| 125 | Ga0207650_10106601 | 3300025925 | Bacteria | 2164 |
| 126 | Ga0207687_10775212 | 3300025927 | Bacteria | 817 |
| 127 | Ga0207644_10008787 | 3300025931 | Bacteria | 6614 |
| 128 | Ga0207644_10163727 | 3300025931 | Bacteria | 1731 |
| 129 | Ga0207644_10295720 | 3300025931 | Bacteria | 1303 |
| 130 | Ga0207690_10000454 | 3300025932 | Bacteria | 26405 |
| 131 | Ga0207690_10035121 | 3300025932 | Bacteria | 3235 |
| 132 | Ga0207706_10069421 | 3300025933 | Bacteria | 3099 |
| 133 | Ga0207706_10197849 | 3300025933 | Bacteria | 1762 |
| 134 | Ga0207711_10003508 | 3300025941 | Bacteria | 13577 |
| 135 | Ga0207711_10398123 | 3300025941 | Bacteria | 1279 |
| 136 | Ga0207661_11189990 | 3300025944 | Bacteria | 701 |
| 137 | Ga0207679_10036692 | 3300025945 | Bacteria | 3478 |
| 138 | Ga0207667_10235927 | 3300025949 | Bacteria | 1872 |
| 139 | Ga0207667_10771939 | 3300025949 | Bacteria | 959 |
| 140 | Ga0207712_10103701 | 3300025961 | Bacteria | 2119 |
| 141 | Ga0207712_10856075 | 3300025961 | Bacteria | 801 |
| 142 | Ga0207668_10024068 | 3300025972 | Bacteria | 3925 |
| 143 | Ga0207668_10025052 | 3300025972 | Bacteria | 3856 |
| 144 | Ga0207668_10031229 | 3300025972 | Bacteria | 3506 |
| 145 | Ga0207668_10053971 | 3300025972 | Bacteria | 2787 |
| 146 | Ga0207658_10008689 | 3300025986 | Bacteria | 6900 |
| 147 | Ga0207658_10019508 | 3300025986 | Bacteria | 4690 |
| 148 | Ga0207677_10219501 | 3300026023 | Bacteria | 1524 |
| 149 | Ga0207677_10396966 | 3300026023 | Bacteria | 1169 |
| 150 | Ga0207677_10741870 | 3300026023 | Bacteria | 874 |
| 151 | Ga0207703_10000853 | 3300026035 | Bacteria | 29885 |
| 152 | Ga0207703_10048905 | 3300026035 | Bacteria | 3416 |
| 153 | Ga0207703_11040272 | 3300026035 | Bacteria | 786 |
| 154 | Ga0207639_10186284 | 3300026041 | Bacteria | 1770 |
| 155 | Ga0207639_10414422 | 3300026041 | Bacteria | 1216 |
| 156 | Ga0207702_10083958 | 3300026078 | Bacteria | 2772 |
| 157 | Ga0207702_10664265 | 3300026078 | Bacteria | 1026 |
| 158 | Ga0207641_10007469 | 3300026088 | Bacteria | 9094 |
| 159 | Ga0207641_10027962 | 3300026088 | Bacteria | 4658 |
| 160 | Ga0207641_10272559 | 3300026088 | Bacteria | 1588 |
| 161 | Ga0207641_10522887 | 3300026088 | Bacteria | 1154 |
| 162 | Ga0207676_10001209 | 3300026095 | Bacteria | 19315 |
| 163 | Ga0207676_10287091 | 3300026095 | Bacteria | 1496 |
| 164 | Ga0207675_100026982 | 3300026118 | Bacteria | 5347 |
| 165 | Ga0207675_100604739 | 3300026118 | Bacteria | 1100 |
| 166 | Ga0207683_10397864 | 3300026121 | Bacteria | 1267 |
| 167 | Ga0207698_10784654 | 3300026142 | Bacteria | 954 |
| 168 | Ga0268266_10027470 | 3300028379 | Bacteria | 4838 |
| 169 | Ga0268266_10332844 | 3300028379 | Bacteria | 1423 |
| 170 | Ga0268266_11180363 | 3300028379 | Bacteria | 740 |
| 171 | Ga0268265_10005954 | 3300028380 | Bacteria | 8301 |
| 172 | Ga0268265_10068325 | 3300028380 | Bacteria | 2755 |
| 173 | Ga0268265_10198184 | 3300028380 | Bacteria | 1739 |
| 174 | Ga0268265_10441979 | 3300028380 | Bacteria | 1212 |
| 175 | Ga0268265_11070053 | 3300028380 | Bacteria | 799 |
| 176 | Ga0268264_10000181 | 3300028381 | Bacteria | 134092 |
| 177 | Ga0268264_10074656 | 3300028381 | Bacteria | 2881 |
| 178 | Ga0268264_10350941 | 3300028381 | Bacteria | 1404 |
| 179 | Ga0268264_10919953 | 3300028381 | Bacteria | 878 |
| 180 | Ga0265334_10028944 | 3300028573 | Bacteria | 2221 |
| 181 | Ga0307517_10002560 | 3300028786 | Bacteria | 28963 |
| 182 | Ga0307517_10092103 | 3300028786 | Bacteria | 2469 |
| 183 | Ga0265338_10027915 | 3300028800 | Bacteria | 5648 |
| 184 | Ga0265338_10185716 | 3300028800 | Bacteria | 1580 |
| 185 | Ga0265338_10185799 | 3300028800 | Bacteria | 1580 |
| 186 | Ga0265338_10447232 | 3300028800 | Bacteria | 915 |
| 187 | Ga0307511_10076363 | 3300030521 | Bacteria | 2395 |
| 188 | Ga0265770_1037437 | 3300030878 | Bacteria | 837 |
| 189 | Ga0265331_10050873 | 3300031250 | Bacteria | 1985 |
| 190 | Ga0265327_10002880 | 3300031251 | Bacteria | 17304 |
| 191 | Ga0307513_10000100 | 3300031456 | Bacteria | 125183 |
| 192 | Ga0307513_10003932 | 3300031456 | Bacteria | 19987 |
| 193 | Ga0307513_10005108 | 3300031456 | Bacteria | 17370 |
| 194 | Ga0307513_10019767 | 3300031456 | Bacteria | 8005 |
| 195 | Ga0265314_10015569 | 3300031711 | Bacteria | 6030 |
| 196 | Ga0265342_10073578 | 3300031712 | Bacteria | 1987 |
| 197 | Ga0307516_10000030 | 3300031730 | Bacteria | 159694 |
| 198 | Ga0307405_10792237 | 3300031731 | Bacteria | 793 |
| 199 | Ga0307405_10803485 | 3300031731 | Bacteria | 788 |
| 200 | Ga0307410_10006353 | 3300031852 | Bacteria | 6372 |
| 201 | Ga0307407_10068711 | 3300031903 | Bacteria | 2100 |
| 202 | Ga0307409_100312172 | 3300031995 | Bacteria | 1468 |
| 203 | Ga0307416_101337795 | 3300032002 | Bacteria | 822 |
| 204 | Ga0307414_10245283 | 3300032004 | Bacteria | 1485 |
| 205 | Ga0307414_10449683 | 3300032004 | Bacteria | 1129 |
| 206 | Ga0307414_10561969 | 3300032004 | Bacteria | 1018 |
| 207 | Ga0307411_10056698 | 3300032005 | Bacteria | 2584 |
| 208 | Ga0307411_10433589 | 3300032005 | Bacteria | 1095 |
| 209 | Ga0373929_0200024 | 3300035085 | Bacteria | 559 |
| 210 | Ga0373946_0012473 | 3300035171 | Bacteria | 3182 |
| 211 | Ga0373927_0000899 | 3300035695 | Bacteria | 22619 |
| 212 | Ga0373927_0692545 | 3300035695 | Bacteria | 673 |
| 213 | Ga0373947_0668376 | 3300035725 | Bacteria | 708 |
| 214 | Ga0373925_0000278 | 3300037068 | Bacteria | 53402 |
| 215 | Ga0395899_0000003 | 3300037312 | Bacteria | 1232684 |
| 216 | Ga0395899_0000190 | 3300037312 | Bacteria | 90356 |
| 217 | Ga0395899_0045996 | 3300037312 | Bacteria | 3251 |
| 218 | Ga0395899_0132459 | 3300037312 | Bacteria | 1779 |
| 219 | Ga0395900_0000002 | 3300037418 | Bacteria | 671103 |
| 220 | Ga0395900_0059940 | 3300037418 | Bacteria | 3917 |
| 221 | Ga0395900_0142510 | 3300037418 | Bacteria | 2453 |
| 222 | Ga0395900_0374892 | 3300037418 | Bacteria | 1392 |
| 223 | Ga0395898_0010662 | 3300037466 | Bacteria | 9602 |
| 224 | Ga0395898_0189779 | 3300037466 | Bacteria | 1964 |
| 225 | Ga0395905_0000283 | 3300037471 | Bacteria | 74377 |
| 226 | Ga0395905_0003618 | 3300037471 | Bacteria | 16421 |
| 227 | Ga0395905_0006506 | 3300037471 | Bacteria | 11750 |
| 228 | Ga0395905_0127073 | 3300037471 | Bacteria | 2397 |
| 229 | Ga0395905_0174802 | 3300037471 | Bacteria | 2016 |
| 230 | Ga0395905_0354591 | 3300037471 | Bacteria | 1359 |
| 231 | Ga0395905_1267709 | 3300037471 | Bacteria | 641 |
| 232 | Ga0436364_1480659 | 3300037853 | Bacteria | 6072 |
| 233 | Ga0395901_0000013 | 3300038443 | Bacteria | 375733 |
| 234 | Ga0395901_0015100 | 3300038443 | Bacteria | 7854 |
| 235 | Ga0395901_0033506 | 3300038443 | Bacteria | 5303 |
| 236 | Ga0395901_0693043 | 3300038443 | Bacteria | 1017 |
| 237 | Ga0436365_0752622 | 3300039437 | Bacteria | 2831 |
| 238 | Ga0436365_1309907 | 3300039437 | Bacteria | 1140 |
| 239 | Ga0436365_1358178 | 3300039437 | Bacteria | 6448 |
| 240 | Ga0436361_0229888 | 3300039447 | Bacteria | 983 |
| 241 | Ga0436361_0726920 | 3300039447 | Bacteria | 29762 |
| 242 | Ga0436361_0988308 | 3300039447 | Bacteria | 1987 |
| 243 | Ga0439445_0151984 | 3300042004 | Bacteria | 674 |
| 244 | Ga0451577_0133521 | 3300042876 | Bacteria | 2228 |
| 245 | Ga0466969_0000108 | 3300044656 | Bacteria | 43906 |
| 246 | Ga0466965_0094609 | 3300044683 | Bacteria | 1523 |
| 247 | Ga0466966_0010049 | 3300044684 | Bacteria | 6273 |
| 248 | Ga0466961_0008154 | 3300044693 | Bacteria | 6672 |
| 249 | Ga0466961_0728782 | 3300044693 | Bacteria | 593 |
| 250 | Ga0466963_0045495 | 3300044694 | Bacteria | 2891 |
| 251 | Ga0466963_0447173 | 3300044694 | Bacteria | 912 |
| 252 | Ga0466964_0298923 | 3300044706 | Bacteria | 811 |
| 253 | Ga0466971_0002488 | 3300044719 | Bacteria | 7788 |
| 254 | Ga0466970_0023985 | 3300044765 | Bacteria | 3189 |
| 255 | Ga0466970_0279207 | 3300044765 | Bacteria | 939 |
| 256 | Ga0466957_0006955 | 3300044842 | Bacteria | 6399 |
| 257 | Ga0466957_0995271 | 3300044842 | Bacteria | 602 |
| 258 | Ga0466960_0164965 | 3300044901 | Bacteria | 1192 |
| 259 | Ga0466959_0000087 | 3300045049 | Bacteria | 58860 |
| 260 | Ga0466959_0065119 | 3300045049 | Bacteria | 2645 |
| 261 | Ga0466958_0004760 | 3300045836 | Bacteria | 7217 |
| 262 | Ga0466967_0765653 | 3300045976 | Bacteria | 958 |
| 263 | Ga0495662_0075797 | 3300046476 | Bacteria | 1632 |
| 264 | Ga0495642_0021452 | 3300046528 | Bacteria | 2540 |
| 265 | Ga0495652_0471090 | 3300046529 | Bacteria | 876 |
| 266 | Ga0495621_0098502 | 3300046539 | Bacteria | 1110 |
| 267 | Ga0495621_0251606 | 3300046539 | Bacteria | 722 |
| 268 | Ga0495668_0053362 | 3300046616 | Bacteria | 2235 |
| 269 | Ga0495668_0103917 | 3300046616 | Bacteria | 1554 |
| 270 | Ga0495668_0171092 | 3300046616 | Bacteria | 1190 |
| 271 | Ga0495611_0006005 | 3300046648 | Bacteria | 5181 |
| 272 | Ga0495659_0103147 | 3300046664 | Bacteria | 1107 |
| 273 | Ga0495669_0000059 | 3300046684 | Bacteria | 76021 |
| 274 | Ga0495613_0011884 | 3300046689 | Bacteria | 6471 |
| 275 | Ga0495672_0327448 | 3300047320 | Bacteria | 718 |
| 276 | Ga0495677_0011667 | 3300047445 | Bacteria | 3211 |
| 277 | Ga0495677_0055895 | 3300047445 | Bacteria | 1457 |
| 278 | Ga0495681_0033094 | 3300047470 | Bacteria | 2594 |
| 279 | Ga0495686_0004794 | 3300047472 | Bacteria | 10918 |
| 280 | Ga0496102_0054501 | 3300048905 | Bacteria | 3646 |
| 281 | Ga0496106_0041910 | 3300048909 | Bacteria | 3432 |
| 282 | Ga0496106_0703726 | 3300048909 | Bacteria | 805 |
| 283 | Ga0496107_0132675 | 3300048910 | Bacteria | 1839 |
| 284 | Ga0496109_0029376 | 3300048912 | Bacteria | 4923 |
| 285 | Ga0496111_0264793 | 3300048914 | Bacteria | 1275 |
| 286 | Ga0496112_0036312 | 3300048915 | Bacteria | 4807 |
| 287 | Ga0496113_0077103 | 3300048916 | Bacteria | 2548 |
| 288 | Ga0496115_0491482 | 3300048918 | Bacteria | 987 |
| 289 | Ga0501033_0083315 | 3300049570 | Bacteria | 2344 |
| 290 | Ga0501033_0146082 | 3300049570 | Bacteria | 1708 |
| 291 | Ga0501034_0002726 | 3300049571 | Bacteria | 20781 |
| 292 | Ga0501034_0591479 | 3300049571 | Bacteria | 1016 |
| 293 | Ga0501034_0896218 | 3300049571 | Bacteria | 775 |
| 294 | Ga0501036_0419248 | 3300049572 | Bacteria | 1116 |
| 295 | Ga0501036_0700135 | 3300049572 | Bacteria | 837 |
| 296 | Ga0501037_0144981 | 3300049573 | Bacteria | 1699 |
| 297 | Ga0501043_0180910 | 3300049579 | Bacteria | 1642 |
| 298 | Ga0501047_0002719 | 3300049581 | Bacteria | 16836 |
| 299 | Ga0501047_0064602 | 3300049581 | Bacteria | 3530 |
| 300 | Ga0501047_0078482 | 3300049581 | Bacteria | 3175 |
| 301 | Ga0501047_0209128 | 3300049581 | Bacteria | 1810 |
| 302 | Ga0501047_0334739 | 3300049581 | Bacteria | 1352 |
| 303 | Ga0501047_0360645 | 3300049581 | Bacteria | 1289 |
| 304 | Ga0501047_0440250 | 3300049581 | Bacteria | 1133 |
| 305 | Ga0501047_0692586 | 3300049581 | Bacteria | 837 |
| 306 | Ga0501048_0169527 | 3300049582 | Bacteria | 1546 |
| 307 | Ga0501080_1017234 | 3300049742 | Bacteria | 718 |
| 308 | Ga0501080_1132637 | 3300049742 | Bacteria | 675 |
| 309 | Ga0501035_0087130 | 3300049822 | Bacteria | 2752 |
| 310 | Ga0501044_0011306 | 3300049823 | Bacteria | 9674 |
| 311 | Ga0501044_0197888 | 3300049823 | Bacteria | 1969 |
| 312 | Ga0501044_0307734 | 3300049823 | Bacteria | 1512 |
| 313 | Ga0501044_1131557 | 3300049823 | Bacteria | 652 |
| 314 | nmdc:mga07m45_207751_c1 | 3300050496 | Bacteria | 1139 |
| 315 | Ga0500643_000458 | 3300053087 | Bacteria | 30192 |
| 316 | Ga0500643_011720 | 3300053087 | Bacteria | 3180 |
| 317 | Ga0500643_018627 | 3300053087 | Bacteria | 2300 |
| 318 | Ga0500643_031697 | 3300053087 | Bacteria | 1610 |
| 319 | Ga0500646_0072035 | 3300053090 | Bacteria | 1038 |
| 320 | Ga0500647_0005072 | 3300053091 | Bacteria | 5411 |
| 321 | Ga0500641_0002770 | 3300053096 | Bacteria | 6200 |
| 322 | Ga0500641_0004691 | 3300053096 | Bacteria | 4831 |
| 323 | Ga0500650_0258136 | 3300053098 | Bacteria | 780 |
| 324 | Ga0500555_147022 | 3300053103 | Bacteria | 578 |
| 325 | Ga0500556_0003825 | 3300053104 | Bacteria | 4366 |
| 326 | Ga0500562_001018 | 3300053108 | Bacteria | 6858 |
| 327 | Ga0500562_008934 | 3300053108 | Bacteria | 2531 |
| 328 | Ga0500572_000396 | 3300053111 | Bacteria | 15358 |
| 329 | Ga0500595_126234 | 3300053119 | Bacteria | 722 |
| 330 | Ga0500597_029059 | 3300053120 | Bacteria | 2261 |
| 331 | Ga0500608_204979 | 3300053122 | Bacteria | 811 |
| 332 | Ga0500614_029752 | 3300053123 | Bacteria | 1328 |
| 333 | Ga0500559_0000016 | 3300053136 | Bacteria | 151244 |
| 334 | Ga0500559_0038619 | 3300053136 | Bacteria | 2074 |
| 335 | Ga0500590_125225 | 3300053148 | Bacteria | 1197 |
| 336 | Ga0500604_0144937 | 3300053151 | Bacteria | 804 |
| 337 | Ga0500616_0024152 | 3300053153 | Bacteria | 3382 |
| 338 | Ga0500616_0056135 | 3300053153 | Bacteria | 2056 |
| 339 | Ga0500622_0003711 | 3300053156 | Bacteria | 10011 |
| 340 | Ga0500622_0018962 | 3300053156 | Bacteria | 3655 |
| 341 | Ga0500636_0023240 | 3300053177 | Bacteria | 3665 |
| 342 | Ga0500645_002367 | 3300053730 | Bacteria | 8492 |
| 343 | Ga0500645_002819 | 3300053730 | Bacteria | 7489 |
| 344 | Ga0500552_010955 | 3300053733 | Bacteria | 1128 |
| 345 | Ga0466962_0007628 | 3300061719 | Bacteria | 5186 |
| 346 | Ga0466962_0017945 | 3300061719 | Bacteria | 3405 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035085 | Ga0373929_0200024 | Ga0373929_0200024_14_418 | 133 |
| 2 | 3300037466 | Ga0395898_0189779 | Ga0395898_0189779_1347_1895 | 152 |
| 3 | 3300005262 | Ga0065165_1001044 | Ga0065165_100104436 | 154 |
| 4 | 3300042004 | Ga0439445_0151984 | Ga0439445_0151984_67_621 | 154 |
| 5 | 3300003794 | Ga0055531_10038183 | Ga0055531_100381831 | 155 |
| 6 | 3300025304 | Ga0209257_1003257 | Ga0209257_10032579 | 155 |
| 7 | 3300039447 | Ga0436361_0988308 | Ga0436361_0988308_682_1215 | 155 |
| 8 | 3300053087 | Ga0500643_018627 | Ga0500643_018627_11_544 | 155 |
| 9 | 3300053098 | Ga0500650_0258136 | Ga0500650_0258136_210_743 | 155 |
| 10 | 3300053108 | Ga0500562_001018 | Ga0500562_001018_3501_4034 | 155 |
| 11 | 3300053153 | Ga0500616_0056135 | Ga0500616_0056135_800_1333 | 155 |
| 12 | 3300053730 | Ga0500645_002819 | Ga0500645_002819_4278_4811 | 155 |
| 13 | 3300005617 | Ga0068859_100768721 | Ga0068859_1007687211 | 156 |
| 14 | 3300005844 | Ga0068862_100221994 | Ga0068862_1002219943 | 156 |
| 15 | 3300006048 | Ga0075363_100135948 | Ga0075363_1001359482 | 156 |
| 16 | 3300006931 | Ga0097620_100768827 | Ga0097620_1007688271 | 156 |
| 17 | 3300025250 | Ga0209026_1011724 | Ga0209026_10117243 | 156 |
| 18 | 3300028380 | Ga0268265_10005954 | Ga0268265_100059543 | 156 |
| 19 | 3300049572 | Ga0501036_0700135 | Ga0501036_0700135_276_812 | 156 |
| 20 | 3300049581 | Ga0501047_0078482 | Ga0501047_0078482_1618_2154 | 156 |
| 21 | 3300049823 | Ga0501044_0197888 | Ga0501044_0197888_865_1389 | 156 |
| 22 | 3300049823 | Ga0501044_0307734 | Ga0501044_0307734_443_979 | 156 |
| 23 | 3300005347 | Ga0070668_100004828 | Ga0070668_1000048289 | 157 |
| 24 | 3300025972 | Ga0207668_10025052 | Ga0207668_100250524 | 157 |
| 25 | 3300026118 | Ga0207675_100026982 | Ga0207675_1000269824 | 157 |
| 26 | 3300032002 | Ga0307416_101337795 | Ga0307416_1013377952 | 157 |
| 27 | 3300049742 | Ga0501080_1132637 | Ga0501080_1132637_137_664 | 157 |
| 28 | 3300053090 | Ga0500646_0072035 | Ga0500646_0072035_52_579 | 157 |
| 29 | 3300053156 | Ga0500622_0003711 | Ga0500622_0003711_97_624 | 157 |
| 30 | 3300005841 | Ga0068863_100095381 | Ga0068863_1000953813 | 158 |
| 31 | 3300014325 | Ga0163163_10292106 | Ga0163163_102921062 | 158 |
| 32 | 3300046684 | Ga0495669_0000059 | Ga0495669_0000059_50878_51435 | 158 |
| 33 | 3300005331 | Ga0070670_100538690 | Ga0070670_1005386901 | 159 |
| 34 | 3300005347 | Ga0070668_100074247 | Ga0070668_1000742472 | 159 |
| 35 | 3300005841 | Ga0068863_100458329 | Ga0068863_1004583291 | 159 |
| 36 | 3300005844 | Ga0068862_100013722 | Ga0068862_1000137222 | 159 |
| 37 | 3300025925 | Ga0207650_10106601 | Ga0207650_101066012 | 159 |
| 38 | 3300025972 | Ga0207668_10024068 | Ga0207668_100240683 | 159 |
| 39 | 3300026088 | Ga0207641_10522887 | Ga0207641_105228872 | 159 |
| 40 | 3300028380 | Ga0268265_10068325 | Ga0268265_100683253 | 159 |
| 41 | 3300031730 | Ga0307516_10000030 | Ga0307516_100000301 | 159 |
| 42 | 3300032004 | Ga0307414_10561969 | Ga0307414_105619692 | 159 |
| 43 | 3300037471 | Ga0395905_0354591 | Ga0395905_0354591_631_1182 | 159 |
| 44 | 3300025961 | Ga0207712_10856075 | Ga0207712_108560752 | 160 |
| 45 | 3300026035 | Ga0207703_10048905 | Ga0207703_100489052 | 160 |
| 46 | 3300025923 | Ga0207681_11065680 | Ga0207681_110656801 | 162 |
| 47 | 3300031456 | Ga0307513_10000100 | Ga0307513_1000010066 | 163 |
| 48 | 3300005842 | Ga0068858_100246276 | Ga0068858_1002462762 | 164 |
| 49 | 3300009093 | Ga0105240_10705546 | Ga0105240_107055462 | 164 |
| 50 | 3300037471 | Ga0395905_0006506 | Ga0395905_0006506_11184_11738 | 164 |
| 51 | 3300049571 | Ga0501034_0002726 | Ga0501034_0002726_5256_5789 | 164 |
| 52 | 3300053103 | Ga0500555_147022 | Ga0500555_147022_28_564 | 164 |
| 53 | 3300038443 | Ga0395901_0693043 | Ga0395901_0693043_76_609 | 166 |
| 54 | 3300021384 | Ga0213876_10035199 | Ga0213876_100351992 | 167 |
| 55 | 3300031250 | Ga0265331_10050873 | Ga0265331_100508733 | 167 |
| 56 | 3300031251 | Ga0265327_10002880 | Ga0265327_1000288014 | 167 |
| 57 | 3300039437 | Ga0436365_1358178 | Ga0436365_1358178_4684_5214 | 167 |
| 58 | 3300039447 | Ga0436361_0229888 | Ga0436361_0229888_99_632 | 167 |
| 59 | 3300005366 | Ga0070659_100013614 | Ga0070659_1000136147 | 168 |
| 60 | 3300025932 | Ga0207690_10035121 | Ga0207690_100351212 | 168 |
| 61 | 3300045976 | Ga0466967_0765653 | Ga0466967_0765653_38_592 | 168 |
| 62 | 3300031731 | Ga0307405_10803485 | Ga0307405_108034852 | 169 |
| 63 | 3300031852 | Ga0307410_10006353 | Ga0307410_100063532 | 169 |
| 64 | 3300031903 | Ga0307407_10068711 | Ga0307407_100687113 | 169 |
| 65 | 3300032004 | Ga0307414_10245283 | Ga0307414_102452833 | 169 |
| 66 | 3300032005 | Ga0307411_10056698 | Ga0307411_100566981 | 169 |
| 67 | 3300044683 | Ga0466965_0094609 | Ga0466965_0094609_577_1107 | 169 |
| 68 | 3300044694 | Ga0466963_0447173 | Ga0466963_0447173_43_573 | 169 |
| 69 | 3300044765 | Ga0466970_0279207 | Ga0466970_0279207_151_681 | 169 |
| 70 | 3300044842 | Ga0466957_0995271 | Ga0466957_0995271_17_547 | 169 |
| 71 | 3300053119 | Ga0500595_126234 | Ga0500595_126234_82_612 | 169 |
| 72 | 3300005617 | Ga0068859_100275818 | Ga0068859_1002758182 | 170 |
| 73 | 3300005843 | Ga0068860_100727949 | Ga0068860_1007279492 | 170 |
| 74 | 3300006931 | Ga0097620_100275800 | Ga0097620_1002758002 | 170 |
| 75 | 3300028381 | Ga0268264_10919953 | Ga0268264_109199531 | 170 |
| 76 | 3300049579 | Ga0501043_0180910 | Ga0501043_0180910_576_1112 | 170 |
| 77 | 3300049581 | Ga0501047_0360645 | Ga0501047_0360645_637_1173 | 170 |
| 78 | 3300013100 | Ga0157373_10004928 | Ga0157373_100049282 | 172 |
| 79 | 3300026041 | Ga0207639_10414422 | Ga0207639_104144221 | 172 |
| 80 | 3300047472 | Ga0495686_0004794 | Ga0495686_0004794_10274_10810 | 172 |
| 81 | iso_pu_bacteria | 2671180139 | 2671694824 | 172 |
| 82 | iso_pu_bacteria | 2995463766 | 2995467401 | 172 |
| 83 | 3300037312 | Ga0395899_0000190 | Ga0395899_0000190_42961_43515 | 173 |
| 84 | 3300037418 | Ga0395900_0000002 | Ga0395900_0000002_428169_428723 | 173 |
| 85 | 3300037466 | Ga0395898_0010662 | Ga0395898_0010662_5588_6142 | 173 |
| 86 | 3300037471 | Ga0395905_0003618 | Ga0395905_0003618_6390_6944 | 173 |
| 87 | 3300038443 | Ga0395901_0000013 | Ga0395901_0000013_275062_275616 | 173 |
| 88 | 3300042876 | Ga0451577_0133521 | Ga0451577_0133521_305_826 | 173 |
| 89 | iso_pu_bacteria | 2643221699 | 2644549338 | 173 |
| 90 | 3300037312 | Ga0395899_0045996 | Ga0395899_0045996_2276_2800 | 174 |
| 91 | 3300037418 | Ga0395900_0059940 | Ga0395900_0059940_2144_2668 | 174 |
| 92 | 3300037471 | Ga0395905_0127073 | Ga0395905_0127073_307_831 | 174 |
| 93 | 3300038443 | Ga0395901_0033506 | Ga0395901_0033506_2750_3274 | 174 |
| 94 | 3300044693 | Ga0466961_0728782 | Ga0466961_0728782_49_573 | 174 |
| 95 | 3300049571 | Ga0501034_0591479 | Ga0501034_0591479_31_555 | 174 |
| 96 | 3300049571 | Ga0501034_0896218 | Ga0501034_0896218_141_665 | 174 |
| 97 | 3300049572 | Ga0501036_0419248 | Ga0501036_0419248_485_1009 | 174 |
| 98 | 3300049573 | Ga0501037_0144981 | Ga0501037_0144981_458_982 | 174 |
| 99 | 3300049581 | Ga0501047_0334739 | Ga0501047_0334739_753_1277 | 174 |
| 100 | 3300053087 | Ga0500643_011720 | Ga0500643_011720_1238_1762 | 174 |
| 101 | iso_pu_bacteria | 2643221598 | 2644000975 | 174 |
| 102 | iso_pu_bacteria | 2643221614 | 2644087792 | 174 |
| 103 | iso_pu_bacteria | 2643221661 | 2644345396 | 174 |
| 104 | iso_pu_bacteria | 2643221666 | 2644367148 | 174 |
| 105 | 3300003320 | rootH2_10080531 | rootH2_100805312 | 175 |
| 106 | 3300005841 | Ga0068863_100399562 | Ga0068863_1003995622 | 175 |
| 107 | 3300037471 | Ga0395905_0000283 | Ga0395905_0000283_54847_55374 | 175 |
| 108 | 3300039437 | Ga0436365_1309907 | Ga0436365_1309907_96_623 | 175 |
| 109 | 3300044901 | Ga0466960_0164965 | Ga0466960_0164965_333_860 | 175 |
| 110 | 3300045049 | Ga0466959_0065119 | Ga0466959_0065119_1898_2425 | 175 |
| 111 | 3300048918 | Ga0496115_0491482 | Ga0496115_0491482_179_709 | 175 |
| 112 | 3300061719 | Ga0466962_0017945 | Ga0466962_0017945_624_1193 | 175 |
| 113 | 3300003781 | Ga0055536_1001916 | Ga0055536_100191611 | 176 |
| 114 | 3300026078 | Ga0207702_10083958 | Ga0207702_100839582 | 176 |
| 115 | 3300044656 | Ga0466969_0000108 | Ga0466969_0000108_40253_40783 | 176 |
| 116 | 3300044684 | Ga0466966_0010049 | Ga0466966_0010049_2086_2616 | 176 |
| 117 | 3300044693 | Ga0466961_0008154 | Ga0466961_0008154_3124_3654 | 176 |
| 118 | 3300044694 | Ga0466963_0045495 | Ga0466963_0045495_1686_2216 | 176 |
| 119 | 3300044706 | Ga0466964_0298923 | Ga0466964_0298923_244_774 | 176 |
| 120 | 3300044719 | Ga0466971_0002488 | Ga0466971_0002488_1442_1972 | 176 |
| 121 | 3300044765 | Ga0466970_0023985 | Ga0466970_0023985_1483_2013 | 176 |
| 122 | 3300044842 | Ga0466957_0006955 | Ga0466957_0006955_3855_4385 | 176 |
| 123 | 3300045049 | Ga0466959_0000087 | Ga0466959_0000087_1300_1830 | 176 |
| 124 | 3300045836 | Ga0466958_0004760 | Ga0466958_0004760_5949_6479 | 176 |
| 125 | 3300061719 | Ga0466962_0007628 | Ga0466962_0007628_238_768 | 176 |
| 126 | 3300005535 | Ga0070684_100809091 | Ga0070684_1008090912 | 177 |
| 127 | 3300005539 | Ga0068853_100060651 | Ga0068853_1000606511 | 177 |
| 128 | 3300005539 | Ga0068853_100266113 | Ga0068853_1002661131 | 177 |
| 129 | 3300005564 | Ga0070664_100086088 | Ga0070664_1000860882 | 177 |
| 130 | 3300013100 | Ga0157373_10000851 | Ga0157373_1000085118 | 177 |
| 131 | 3300017792 | Ga0163161_10879542 | Ga0163161_108795421 | 177 |
| 132 | 3300021361 | Ga0213872_10143306 | Ga0213872_101433061 | 177 |
| 133 | 3300021384 | Ga0213876_10049871 | Ga0213876_100498712 | 177 |
| 134 | 3300025945 | Ga0207679_10036692 | Ga0207679_100366923 | 177 |
| 135 | 3300026041 | Ga0207639_10186284 | Ga0207639_101862843 | 177 |
| 136 | 3300028573 | Ga0265334_10028944 | Ga0265334_100289443 | 177 |
| 137 | 3300028786 | Ga0307517_10002560 | Ga0307517_100025607 | 177 |
| 138 | 3300028800 | Ga0265338_10185716 | Ga0265338_101857162 | 177 |
| 139 | 3300028800 | Ga0265338_10185799 | Ga0265338_101857992 | 177 |
| 140 | 3300031456 | Ga0307513_10005108 | Ga0307513_1000510814 | 177 |
| 141 | 3300031711 | Ga0265314_10015569 | Ga0265314_100155697 | 177 |
| 142 | 3300032004 | Ga0307414_10449683 | Ga0307414_104496831 | 177 |
| 143 | 3300035695 | Ga0373927_0692545 | Ga0373927_0692545_74_622 | 177 |
| 144 | 3300037312 | Ga0395899_0000003 | Ga0395899_0000003_996099_996632 | 177 |
| 145 | 3300039437 | Ga0436365_0752622 | Ga0436365_0752622_1056_1589 | 177 |
| 146 | 3300046476 | Ga0495662_0075797 | Ga0495662_0075797_619_1155 | 177 |
| 147 | 3300049570 | Ga0501033_0083315 | Ga0501033_0083315_90_623 | 177 |
| 148 | 3300049581 | Ga0501047_0002719 | Ga0501047_0002719_4406_4939 | 177 |
| 149 | 3300053087 | Ga0500643_000458 | Ga0500643_000458_25672_26205 | 177 |
| 150 | 3300053087 | Ga0500643_031697 | Ga0500643_031697_63_596 | 177 |
| 151 | 3300053096 | Ga0500641_0002770 | Ga0500641_0002770_5657_6190 | 177 |
| 152 | 3300053096 | Ga0500641_0004691 | Ga0500641_0004691_34_567 | 177 |
| 153 | 3300053104 | Ga0500556_0003825 | Ga0500556_0003825_3776_4309 | 177 |
| 154 | 3300053136 | Ga0500559_0038619 | Ga0500559_0038619_867_1418 | 177 |
| 155 | 3300053151 | Ga0500604_0144937 | Ga0500604_0144937_208_741 | 177 |
| 156 | 3300053153 | Ga0500616_0024152 | Ga0500616_0024152_2080_2613 | 177 |
| 157 | 3300053156 | Ga0500622_0018962 | Ga0500622_0018962_1226_1759 | 177 |
| 158 | 3300053730 | Ga0500645_002367 | Ga0500645_002367_3972_4505 | 177 |
| 159 | 3300003215 | JGI25153J46596_10023328 | JGI25153J46596_100233282 | 178 |
| 160 | 3300003791 | Ga0055530_10001482 | Ga0055530_1000148216 | 178 |
| 161 | 3300003794 | Ga0055531_10002587 | Ga0055531_1000258713 | 178 |
| 162 | 3300005262 | Ga0065165_1003241 | Ga0065165_100324114 | 178 |
| 163 | 3300005293 | Ga0065715_10248328 | Ga0065715_102483282 | 178 |
| 164 | 3300005327 | Ga0070658_10270681 | Ga0070658_102706811 | 178 |
| 165 | 3300005327 | Ga0070658_10276221 | Ga0070658_102762211 | 178 |
| 166 | 3300005329 | Ga0070683_100342799 | Ga0070683_1003427992 | 178 |
| 167 | 3300005329 | Ga0070683_100522664 | Ga0070683_1005226641 | 178 |
| 168 | 3300005330 | Ga0070690_100357261 | Ga0070690_1003572612 | 178 |
| 169 | 3300005331 | Ga0070670_100027269 | Ga0070670_1000272695 | 178 |
| 170 | 3300005331 | Ga0070670_100099608 | Ga0070670_1000996081 | 178 |
| 171 | 3300005336 | Ga0070680_100045589 | Ga0070680_1000455893 | 178 |
| 172 | 3300005338 | Ga0068868_100349922 | Ga0068868_1003499222 | 178 |
| 173 | 3300005339 | Ga0070660_100010321 | Ga0070660_1000103214 | 178 |
| 174 | 3300005339 | Ga0070660_100144305 | Ga0070660_1001443052 | 178 |
| 175 | 3300005347 | Ga0070668_100006236 | Ga0070668_1000062366 | 178 |
| 176 | 3300005347 | Ga0070668_100013620 | Ga0070668_1000136206 | 178 |
| 177 | 3300005347 | Ga0070668_100088046 | Ga0070668_1000880464 | 178 |
| 178 | 3300005353 | Ga0070669_100084724 | Ga0070669_1000847242 | 178 |
| 179 | 3300005355 | Ga0070671_100014881 | Ga0070671_1000148814 | 178 |
| 180 | 3300005355 | Ga0070671_100578125 | Ga0070671_1005781252 | 178 |
| 181 | 3300005366 | Ga0070659_100002533 | Ga0070659_10000253313 | 178 |
| 182 | 3300005367 | Ga0070667_100040810 | Ga0070667_1000408103 | 178 |
| 183 | 3300005367 | Ga0070667_100082151 | Ga0070667_1000821512 | 178 |
| 184 | 3300005457 | Ga0070662_100054667 | Ga0070662_1000546673 | 178 |
| 185 | 3300005457 | Ga0070662_100504127 | Ga0070662_1005041271 | 178 |
| 186 | 3300005458 | Ga0070681_10092988 | Ga0070681_100929884 | 178 |
| 187 | 3300005471 | Ga0070698_101197566 | Ga0070698_1011975661 | 178 |
| 188 | 3300005535 | Ga0070684_100304429 | Ga0070684_1003044292 | 178 |
| 189 | 3300005539 | Ga0068853_100021119 | Ga0068853_1000211192 | 178 |
| 190 | 3300005539 | Ga0068853_100873598 | Ga0068853_1008735981 | 178 |
| 191 | 3300005548 | Ga0070665_100018581 | Ga0070665_1000185814 | 178 |
| 192 | 3300005548 | Ga0070665_100034717 | Ga0070665_1000347177 | 178 |
| 193 | 3300005563 | Ga0068855_100726333 | Ga0068855_1007263332 | 178 |
| 194 | 3300005563 | Ga0068855_101632679 | Ga0068855_1016326791 | 178 |
| 195 | 3300005578 | Ga0068854_101468420 | Ga0068854_1014684201 | 178 |
| 196 | 3300005616 | Ga0068852_100213467 | Ga0068852_1002134672 | 178 |
| 197 | 3300005617 | Ga0068859_100003282 | Ga0068859_1000032824 | 178 |
| 198 | 3300005617 | Ga0068859_100049833 | Ga0068859_1000498336 | 178 |
| 199 | 3300005617 | Ga0068859_100698786 | Ga0068859_1006987862 | 178 |
| 200 | 3300005618 | Ga0068864_100011878 | Ga0068864_1000118782 | 178 |
| 201 | 3300005841 | Ga0068863_100031486 | Ga0068863_1000314863 | 178 |
| 202 | 3300005841 | Ga0068863_100070383 | Ga0068863_1000703834 | 178 |
| 203 | 3300005841 | Ga0068863_100115758 | Ga0068863_1001157583 | 178 |
| 204 | 3300005841 | Ga0068863_100127352 | Ga0068863_1001273523 | 178 |
| 205 | 3300005842 | Ga0068858_101053385 | Ga0068858_1010533852 | 178 |
| 206 | 3300005843 | Ga0068860_100000027 | Ga0068860_10000002750 | 178 |
| 207 | 3300005843 | Ga0068860_100091737 | Ga0068860_1000917373 | 178 |
| 208 | 3300005843 | Ga0068860_100177627 | Ga0068860_1001776272 | 178 |
| 209 | 3300005844 | Ga0068862_100013540 | Ga0068862_1000135407 | 178 |
| 210 | 3300005844 | Ga0068862_100494593 | Ga0068862_1004945931 | 178 |
| 211 | 3300006931 | Ga0097620_100003282 | Ga0097620_1000032824 | 178 |
| 212 | 3300006931 | Ga0097620_100049831 | Ga0097620_1000498316 | 178 |
| 213 | 3300006931 | Ga0097620_100698760 | Ga0097620_1006987602 | 178 |
| 214 | 3300009101 | Ga0105247_10072615 | Ga0105247_100726153 | 178 |
| 215 | 3300009176 | Ga0105242_10183360 | Ga0105242_101833602 | 178 |
| 216 | 3300009177 | Ga0105248_10005575 | Ga0105248_1000557511 | 178 |
| 217 | 3300009551 | Ga0105238_10057638 | Ga0105238_100576385 | 178 |
| 218 | 3300009551 | Ga0105238_11560215 | Ga0105238_115602151 | 178 |
| 219 | 3300009553 | Ga0105249_10088271 | Ga0105249_100882713 | 178 |
| 220 | 3300010375 | Ga0105239_10171064 | Ga0105239_101710644 | 178 |
| 221 | 3300013104 | Ga0157370_10954618 | Ga0157370_109546181 | 178 |
| 222 | 3300013296 | Ga0157374_10960868 | Ga0157374_109608681 | 178 |
| 223 | 3300013306 | Ga0163162_10018044 | Ga0163162_100180445 | 178 |
| 224 | 3300013306 | Ga0163162_10048059 | Ga0163162_100480595 | 178 |
| 225 | 3300013307 | Ga0157372_11505519 | Ga0157372_115055191 | 178 |
| 226 | 3300013308 | Ga0157375_10053327 | Ga0157375_100533275 | 178 |
| 227 | 3300013308 | Ga0157375_11223500 | Ga0157375_112235002 | 178 |
| 228 | 3300013308 | Ga0157375_11262759 | Ga0157375_112627591 | 178 |
| 229 | 3300014325 | Ga0163163_10051019 | Ga0163163_100510194 | 178 |
| 230 | 3300014325 | Ga0163163_10151366 | Ga0163163_101513662 | 178 |
| 231 | 3300014326 | Ga0157380_10782501 | Ga0157380_107825012 | 178 |
| 232 | 3300014745 | Ga0157377_10503085 | Ga0157377_105030852 | 178 |
| 233 | 3300014968 | Ga0157379_10001109 | Ga0157379_1000110911 | 178 |
| 234 | 3300021361 | Ga0213872_10004761 | Ga0213872_100047615 | 178 |
| 235 | 3300021388 | Ga0213875_10020340 | Ga0213875_100203403 | 178 |
| 236 | 3300025297 | Ga0209758_1000852 | Ga0209758_100085244 | 178 |
| 237 | 3300025298 | Ga0209050_1000053 | Ga0209050_1000053197 | 178 |
| 238 | 3300025304 | Ga0209257_1000289 | Ga0209257_100028979 | 178 |
| 239 | 3300025900 | Ga0207710_10037378 | Ga0207710_100373782 | 178 |
| 240 | 3300025909 | Ga0207705_10100515 | Ga0207705_101005152 | 178 |
| 241 | 3300025909 | Ga0207705_10447960 | Ga0207705_104479602 | 178 |
| 242 | 3300025919 | Ga0207657_10056416 | Ga0207657_100564164 | 178 |
| 243 | 3300025923 | Ga0207681_10011289 | Ga0207681_100112894 | 178 |
| 244 | 3300025923 | Ga0207681_10044523 | Ga0207681_100445233 | 178 |
| 245 | 3300025924 | Ga0207694_10046259 | Ga0207694_100462594 | 178 |
| 246 | 3300025925 | Ga0207650_10005998 | Ga0207650_100059987 | 178 |
| 247 | 3300025925 | Ga0207650_10072910 | Ga0207650_100729104 | 178 |
| 248 | 3300025927 | Ga0207687_10775212 | Ga0207687_107752121 | 178 |
| 249 | 3300025931 | Ga0207644_10008787 | Ga0207644_100087875 | 178 |
| 250 | 3300025931 | Ga0207644_10163727 | Ga0207644_101637272 | 178 |
| 251 | 3300025931 | Ga0207644_10295720 | Ga0207644_102957202 | 178 |
| 252 | 3300025932 | Ga0207690_10000454 | Ga0207690_100004548 | 178 |
| 253 | 3300025933 | Ga0207706_10069421 | Ga0207706_100694213 | 178 |
| 254 | 3300025933 | Ga0207706_10197849 | Ga0207706_101978492 | 178 |
| 255 | 3300025941 | Ga0207711_10003508 | Ga0207711_100035085 | 178 |
| 256 | 3300025941 | Ga0207711_10398123 | Ga0207711_103981232 | 178 |
| 257 | 3300025944 | Ga0207661_11189990 | Ga0207661_111899901 | 178 |
| 258 | 3300025949 | Ga0207667_10235927 | Ga0207667_102359273 | 178 |
| 259 | 3300025949 | Ga0207667_10771939 | Ga0207667_107719392 | 178 |
| 260 | 3300025961 | Ga0207712_10103701 | Ga0207712_101037012 | 178 |
| 261 | 3300025972 | Ga0207668_10031229 | Ga0207668_100312293 | 178 |
| 262 | 3300025972 | Ga0207668_10053971 | Ga0207668_100539712 | 178 |
| 263 | 3300025986 | Ga0207658_10008689 | Ga0207658_100086897 | 178 |
| 264 | 3300025986 | Ga0207658_10019508 | Ga0207658_100195083 | 178 |
| 265 | 3300026023 | Ga0207677_10219501 | Ga0207677_102195012 | 178 |
| 266 | 3300026023 | Ga0207677_10396966 | Ga0207677_103969662 | 178 |
| 267 | 3300026023 | Ga0207677_10741870 | Ga0207677_107418702 | 178 |
| 268 | 3300026035 | Ga0207703_10000853 | Ga0207703_1000085331 | 178 |
| 269 | 3300026035 | Ga0207703_11040272 | Ga0207703_110402722 | 178 |
| 270 | 3300026078 | Ga0207702_10664265 | Ga0207702_106642651 | 178 |
| 271 | 3300026088 | Ga0207641_10007469 | Ga0207641_100074696 | 178 |
| 272 | 3300026088 | Ga0207641_10027962 | Ga0207641_100279622 | 178 |
| 273 | 3300026088 | Ga0207641_10272559 | Ga0207641_102725593 | 178 |
| 274 | 3300026095 | Ga0207676_10001209 | Ga0207676_1000120918 | 178 |
| 275 | 3300026095 | Ga0207676_10287091 | Ga0207676_102870911 | 178 |
| 276 | 3300026118 | Ga0207675_100604739 | Ga0207675_1006047391 | 178 |
| 277 | 3300026121 | Ga0207683_10397864 | Ga0207683_103978642 | 178 |
| 278 | 3300026142 | Ga0207698_10784654 | Ga0207698_107846541 | 178 |
| 279 | 3300028379 | Ga0268266_10027470 | Ga0268266_100274703 | 178 |
| 280 | 3300028379 | Ga0268266_10332844 | Ga0268266_103328441 | 178 |
| 281 | 3300028379 | Ga0268266_11180363 | Ga0268266_111803632 | 178 |
| 282 | 3300028380 | Ga0268265_10198184 | Ga0268265_101981842 | 178 |
| 283 | 3300028380 | Ga0268265_10441979 | Ga0268265_104419792 | 178 |
| 284 | 3300028380 | Ga0268265_11070053 | Ga0268265_110700531 | 178 |
| 285 | 3300028381 | Ga0268264_10000181 | Ga0268264_1000018175 | 178 |
| 286 | 3300028381 | Ga0268264_10074656 | Ga0268264_100746563 | 178 |
| 287 | 3300028381 | Ga0268264_10350941 | Ga0268264_103509412 | 178 |
| 288 | 3300028786 | Ga0307517_10092103 | Ga0307517_100921032 | 178 |
| 289 | 3300028800 | Ga0265338_10027915 | Ga0265338_100279153 | 178 |
| 290 | 3300028800 | Ga0265338_10447232 | Ga0265338_104472322 | 178 |
| 291 | 3300030521 | Ga0307511_10076363 | Ga0307511_100763631 | 178 |
| 292 | 3300030878 | Ga0265770_1037437 | Ga0265770_10374371 | 178 |
| 293 | 3300031456 | Ga0307513_10003932 | Ga0307513_1000393216 | 178 |
| 294 | 3300031456 | Ga0307513_10019767 | Ga0307513_100197677 | 178 |
| 295 | 3300031712 | Ga0265342_10073578 | Ga0265342_100735783 | 178 |
| 296 | 3300031731 | Ga0307405_10792237 | Ga0307405_107922372 | 178 |
| 297 | 3300031995 | Ga0307409_100312172 | Ga0307409_1003121722 | 178 |
| 298 | 3300032005 | Ga0307411_10433589 | Ga0307411_104335891 | 178 |
| 299 | 3300035171 | Ga0373946_0012473 | Ga0373946_0012473_959_1495 | 178 |
| 300 | 3300035695 | Ga0373927_0000899 | Ga0373927_0000899_19821_20357 | 178 |
| 301 | 3300035725 | Ga0373947_0668376 | Ga0373947_0668376_138_674 | 178 |
| 302 | 3300037068 | Ga0373925_0000278 | Ga0373925_0000278_27591_28127 | 178 |
| 303 | 3300037312 | Ga0395899_0132459 | Ga0395899_0132459_71_607 | 178 |
| 304 | 3300037418 | Ga0395900_0142510 | Ga0395900_0142510_1536_2072 | 178 |
| 305 | 3300037418 | Ga0395900_0374892 | Ga0395900_0374892_698_1234 | 178 |
| 306 | 3300037471 | Ga0395905_0174802 | Ga0395905_0174802_709_1245 | 178 |
| 307 | 3300037471 | Ga0395905_1267709 | Ga0395905_1267709_62_598 | 178 |
| 308 | 3300037853 | Ga0436364_1480659 | Ga0436364_1480659_4766_5302 | 178 |
| 309 | 3300038443 | Ga0395901_0015100 | Ga0395901_0015100_1454_1990 | 178 |
| 310 | 3300039447 | Ga0436361_0726920 | Ga0436361_0726920_23161_23700 | 178 |
| 311 | 3300046528 | Ga0495642_0021452 | Ga0495642_0021452_1843_2379 | 178 |
| 312 | 3300046529 | Ga0495652_0471090 | Ga0495652_0471090_185_721 | 178 |
| 313 | 3300046539 | Ga0495621_0098502 | Ga0495621_0098502_548_1084 | 178 |
| 314 | 3300046539 | Ga0495621_0251606 | Ga0495621_0251606_134_673 | 178 |
| 315 | 3300046616 | Ga0495668_0053362 | Ga0495668_0053362_1570_2118 | 178 |
| 316 | 3300046616 | Ga0495668_0103917 | Ga0495668_0103917_486_1022 | 178 |
| 317 | 3300046616 | Ga0495668_0171092 | Ga0495668_0171092_339_875 | 178 |
| 318 | 3300046648 | Ga0495611_0006005 | Ga0495611_0006005_1995_2531 | 178 |
| 319 | 3300046664 | Ga0495659_0103147 | Ga0495659_0103147_492_1073 | 178 |
| 320 | 3300046689 | Ga0495613_0011884 | Ga0495613_0011884_3039_3575 | 178 |
| 321 | 3300047320 | Ga0495672_0327448 | Ga0495672_0327448_147_683 | 178 |
| 322 | 3300047445 | Ga0495677_0011667 | Ga0495677_0011667_1544_2080 | 178 |
| 323 | 3300047445 | Ga0495677_0055895 | Ga0495677_0055895_794_1351 | 178 |
| 324 | 3300047470 | Ga0495681_0033094 | Ga0495681_0033094_703_1239 | 178 |
| 325 | 3300048905 | Ga0496102_0054501 | Ga0496102_0054501_1784_2320 | 178 |
| 326 | 3300048909 | Ga0496106_0041910 | Ga0496106_0041910_168_704 | 178 |
| 327 | 3300048909 | Ga0496106_0703726 | Ga0496106_0703726_97_633 | 178 |
| 328 | 3300048910 | Ga0496107_0132675 | Ga0496107_0132675_980_1516 | 178 |
| 329 | 3300048912 | Ga0496109_0029376 | Ga0496109_0029376_2745_3281 | 178 |
| 330 | 3300048914 | Ga0496111_0264793 | Ga0496111_0264793_630_1166 | 178 |
| 331 | 3300048915 | Ga0496112_0036312 | Ga0496112_0036312_2813_3349 | 178 |
| 332 | 3300048916 | Ga0496113_0077103 | Ga0496113_0077103_289_825 | 178 |
| 333 | 3300049570 | Ga0501033_0146082 | Ga0501033_0146082_1107_1643 | 178 |
| 334 | 3300049581 | Ga0501047_0064602 | Ga0501047_0064602_444_980 | 178 |
| 335 | 3300049581 | Ga0501047_0209128 | Ga0501047_0209128_52_588 | 178 |
| 336 | 3300049581 | Ga0501047_0440250 | Ga0501047_0440250_449_1003 | 178 |
| 337 | 3300049581 | Ga0501047_0692586 | Ga0501047_0692586_262_804 | 178 |
| 338 | 3300049582 | Ga0501048_0169527 | Ga0501048_0169527_614_1153 | 178 |
| 339 | 3300049742 | Ga0501080_1017234 | Ga0501080_1017234_170_706 | 178 |
| 340 | 3300049822 | Ga0501035_0087130 | Ga0501035_0087130_1248_1784 | 178 |
| 341 | 3300049823 | Ga0501044_0011306 | Ga0501044_0011306_5890_6426 | 178 |
| 342 | 3300049823 | Ga0501044_1131557 | Ga0501044_1131557_50_586 | 178 |
| 343 | 3300050496 | nmdc:mga07m45_207751_c1 | nmdc:mga07m45_207751_c1_578_1114 | 178 |
| 344 | 3300053091 | Ga0500647_0005072 | Ga0500647_0005072_2588_3124 | 178 |
| 345 | 3300053108 | Ga0500562_008934 | Ga0500562_008934_1256_1792 | 178 |
| 346 | 3300053111 | Ga0500572_000396 | Ga0500572_000396_10840_11376 | 178 |
| 347 | 3300053120 | Ga0500597_029059 | Ga0500597_029059_1216_1752 | 178 |
| 348 | 3300053122 | Ga0500608_204979 | Ga0500608_204979_207_749 | 178 |
| 349 | 3300053123 | Ga0500614_029752 | Ga0500614_029752_669_1205 | 178 |
| 350 | 3300053136 | Ga0500559_0000016 | Ga0500559_0000016_142691_143227 | 178 |
| 351 | 3300053148 | Ga0500590_125225 | Ga0500590_125225_283_819 | 178 |
| 352 | 3300053177 | Ga0500636_0023240 | Ga0500636_0023240_1538_2074 | 178 |
| 353 | 3300053733 | Ga0500552_010955 | Ga0500552_010955_308_844 | 178 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1knc-assembly1.cif.gz_A | structure of ahpd from mycobacterium tuberculosis, a novel enzyme with thioredoxin-like activity. | 0.9798 | 2 | 176 |
| 1me5-assembly1.cif.gz_C | crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd h132q mutant | 0.9759 | 4 | 172 |
| 1lw1-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd h137f mutant | 0.975 | 4 | 178 |
| 1me5-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd h132q mutant | 0.9707 | 4 | 176 |
| 1knc-assembly1.cif.gz_A | structure of ahpd from mycobacterium tuberculosis, a novel enzyme with thioredoxin-like activity. | 0.9688 | 2 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1gu9D00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9782 | 5 | 176 | 1.20.1290.10 |
| 1gu9D00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9613 | 5 | 176 | 1.20.1290.10 |
| 1vkeF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9593 | 114 | 164 | 1.20.1290.10 |
| af_Q2FVE0_2_139_1.20.1290.10 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.7496 | 12 | 168 | 1.20.1290.10 |
| 3beyF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.7363 | 4 | 92 | 1.20.1290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1D2TU50-F1-model_v4 | Alkyl hydroperoxide reductase AhpD (EC 1.11.1.28) (Alkylhydroperoxidase AhpD) | 1 | 1 | 178 |
GO:0006979
GO:0008785 GO:0015036 GO:0032843 GO:0045454 GO:0051920 |
| AF-A0A2G4K8B4-F1-model_v4 | Alkyl hydroperoxide reductase AhpD (EC 1.11.1.28) (Alkylhydroperoxidase AhpD) | 0.9983 | 1 | 176 |
GO:0006979
GO:0008785 GO:0015036 GO:0032843 GO:0045454 GO:0051920 |
| AF-Q0AKM4-F1-model_v4 | Alkyl hydroperoxide reductase AhpD (EC 1.11.1.28) (Alkylhydroperoxidase AhpD) | 0.9932 | 1 | 173 |
GO:0006979
GO:0008785 GO:0015036 GO:0032843 GO:0045454 GO:0051920 |
| AF-B8ITH2-F1-model_v4 | Alkyl hydroperoxide reductase AhpD (EC 1.11.1.28) (Alkylhydroperoxidase AhpD) | 0.9924 | 64 | 133 |
GO:0006979
GO:0008785 GO:0032843 GO:0051920 |
| AF-A0A1C3XK10-F1-model_v4 | Alkyl hydroperoxide reductase AhpD (EC 1.11.1.28) (Alkylhydroperoxidase AhpD) | 0.9921 | 64 | 173 |
GO:0006979
GO:0008785 GO:0015036 GO:0032843 GO:0045454 GO:0051920 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar