F419504

General Info

Members Datasets Scaffolds Average Seq Length
353 198 346 174

Family's Representative Sequence

Representative Sequence 3300046664|Ga0495659_0103147|Ga0495659_0103147_492_1073
Length 193
Sequence MSLDALRETLPAYAKDLSLNLSSLANETVLSDQQKWGCFLASAHAVGQRQMVAATQAAAQAGGLTPEAANAAKAAAAIMGMNNVYYRALHLLSNPEYRTLPARLRMNVIANPGVEKADFELWCTAVSAVNGCGMCLDSHEAELKKHGLPAPLIQAALRIAAVVNAVSRVLQAEEVEAPGDVRRLGLEGAALGA

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
6 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
7 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
103 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
178 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
179 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
180 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
181 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
182 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
183 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
184 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
185 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
186 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
187 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
188 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
189 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
190 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
191 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
192 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
195 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
196 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
197 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
198 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 0.28
Isolates 1.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.18
Nodule 0
Rhizoplane 2.55
Rhizosphere 78.47
Stem 0
Stem Tuber 0
Unclassified 6.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10023328 3300003215 Bacteria 2259
2 rootH2_10080531 3300003320 Bacteria 3215
3 Ga0055536_1001916 3300003781 Bacteria 12067
4 Ga0055530_10001482 3300003791 Bacteria 17041
5 Ga0055531_10002587 3300003794 Bacteria 11983
6 Ga0055531_10038183 3300003794 Bacteria 1446
7 Ga0065165_1001044 3300005262 Bacteria 33434
8 Ga0065165_1003241 3300005262 Bacteria 11800
9 Ga0065715_10248328 3300005293 Bacteria 1176
10 Ga0070658_10270681 3300005327 Bacteria 1445
11 Ga0070658_10276221 3300005327 Bacteria 1429
12 Ga0070683_100342799 3300005329 Bacteria 1423
13 Ga0070683_100522664 3300005329 Bacteria 1134
14 Ga0070690_100357261 3300005330 Bacteria 1062
15 Ga0070670_100027269 3300005331 Bacteria 4914
16 Ga0070670_100099608 3300005331 Bacteria 2501
17 Ga0070670_100538690 3300005331 Bacteria 1041
18 Ga0070680_100045589 3300005336 Bacteria 3565
19 Ga0068868_100349922 3300005338 Bacteria 1265
20 Ga0070660_100010321 3300005339 Bacteria 6596
21 Ga0070660_100144305 3300005339 Bacteria 1911
22 Ga0070668_100004828 3300005347 Bacteria 9994
23 Ga0070668_100006236 3300005347 Bacteria 8832
24 Ga0070668_100013620 3300005347 Bacteria 6073
25 Ga0070668_100074247 3300005347 Bacteria 2653
26 Ga0070668_100088046 3300005347 Bacteria 2444
27 Ga0070669_100084724 3300005353 Bacteria 2366
28 Ga0070671_100014881 3300005355 Bacteria 6287
29 Ga0070671_100578125 3300005355 Bacteria 970
30 Ga0070659_100002533 3300005366 Bacteria 12992
31 Ga0070659_100013614 3300005366 Bacteria 6060
32 Ga0070667_100040810 3300005367 Bacteria 3892
33 Ga0070667_100082151 3300005367 Bacteria 2758
34 Ga0070662_100054667 3300005457 Bacteria 2894
35 Ga0070662_100504127 3300005457 Bacteria 1010
36 Ga0070681_10092988 3300005458 Bacteria 2964
37 Ga0070698_101197566 3300005471 Bacteria 709
38 Ga0070684_100304429 3300005535 Bacteria 1463
39 Ga0070684_100809091 3300005535 Bacteria 876
40 Ga0068853_100021119 3300005539 Bacteria 5421
41 Ga0068853_100060651 3300005539 Bacteria 3269
42 Ga0068853_100266113 3300005539 Bacteria 1577
43 Ga0068853_100873598 3300005539 Bacteria 863
44 Ga0070665_100018581 3300005548 Bacteria 6968
45 Ga0070665_100034717 3300005548 Bacteria 5073
46 Ga0068855_100726333 3300005563 Bacteria 1061
47 Ga0068855_101632679 3300005563 Bacteria 659
48 Ga0070664_100086088 3300005564 Bacteria 2715
49 Ga0068854_101468420 3300005578 Bacteria 618
50 Ga0068852_100213467 3300005616 Bacteria 1832
51 Ga0068859_100003282 3300005617 Bacteria 16458
52 Ga0068859_100049833 3300005617 Bacteria 4206
53 Ga0068859_100275818 3300005617 Bacteria 1774
54 Ga0068859_100698786 3300005617 Bacteria 1105
55 Ga0068859_100768721 3300005617 Bacteria 1052
56 Ga0068864_100011878 3300005618 Bacteria 7189
57 Ga0068863_100031486 3300005841 Bacteria 5060
58 Ga0068863_100070383 3300005841 Bacteria 3308
59 Ga0068863_100095381 3300005841 Bacteria 2823
60 Ga0068863_100115758 3300005841 Bacteria 2555
61 Ga0068863_100127352 3300005841 Bacteria 2430
62 Ga0068863_100399562 3300005841 Bacteria 1344
63 Ga0068863_100458329 3300005841 Bacteria 1252
64 Ga0068858_100246276 3300005842 Bacteria 1697
65 Ga0068858_101053385 3300005842 Bacteria 798
66 Ga0068860_100000027 3300005843 Bacteria 267207
67 Ga0068860_100091737 3300005843 Bacteria 2894
68 Ga0068860_100177627 3300005843 Bacteria 2058
69 Ga0068860_100727949 3300005843 Bacteria 1003
70 Ga0068862_100013540 3300005844 Bacteria 6757
71 Ga0068862_100013722 3300005844 Bacteria 6713
72 Ga0068862_100221994 3300005844 Bacteria 1711
73 Ga0068862_100494593 3300005844 Bacteria 1160
74 Ga0075363_100135948 3300006048 Bacteria 1381
75 Ga0097620_100003282 3300006931 Bacteria 16458
76 Ga0097620_100049831 3300006931 Bacteria 4206
77 Ga0097620_100275800 3300006931 Bacteria 1774
78 Ga0097620_100698760 3300006931 Bacteria 1105
79 Ga0097620_100768827 3300006931 Bacteria 1052
80 Ga0105240_10705546 3300009093 Bacteria 1101
81 Ga0105247_10072615 3300009101 Bacteria 2154
82 Ga0105242_10183360 3300009176 Bacteria 1848
83 Ga0105248_10005575 3300009177 Bacteria 13834
84 Ga0105238_10057638 3300009551 Bacteria 3894
85 Ga0105238_11560215 3300009551 Bacteria 690
86 Ga0105249_10088271 3300009553 Bacteria 2896
87 Ga0105239_10171064 3300010375 Bacteria 2430
88 Ga0157373_10000851 3300013100 Bacteria 23696
89 Ga0157373_10004928 3300013100 Bacteria 10049
90 Ga0157370_10954618 3300013104 Bacteria 777
91 Ga0157374_10960868 3300013296 Bacteria 873
92 Ga0163162_10018044 3300013306 Bacteria 6905
93 Ga0163162_10048059 3300013306 Bacteria 4275
94 Ga0157372_11505519 3300013307 Bacteria 775
95 Ga0157375_10053327 3300013308 Bacteria 3978
96 Ga0157375_11223500 3300013308 Bacteria 881
97 Ga0157375_11262759 3300013308 Bacteria 867
98 Ga0163163_10051019 3300014325 Bacteria 4077
99 Ga0163163_10151366 3300014325 Bacteria 2364
100 Ga0163163_10292106 3300014325 Bacteria 1682
101 Ga0157380_10782501 3300014326 Bacteria 969
102 Ga0157377_10503085 3300014745 Bacteria 847
103 Ga0157379_10001109 3300014968 Bacteria 22021
104 Ga0163161_10879542 3300017792 Bacteria 758
105 Ga0213872_10004761 3300021361 Bacteria 7103
106 Ga0213872_10143306 3300021361 Bacteria 1047
107 Ga0213876_10035199 3300021384 Bacteria 2641
108 Ga0213876_10049871 3300021384 Bacteria 2212
109 Ga0213875_10020340 3300021388 Bacteria 3184
110 Ga0209026_1011724 3300025250 Bacteria 1560
111 Ga0209758_1000852 3300025297 Bacteria 42442
112 Ga0209050_1000053 3300025298 Bacteria 349521
113 Ga0209257_1000289 3300025304 Bacteria 110882
114 Ga0209257_1003257 3300025304 Bacteria 14217
115 Ga0207710_10037378 3300025900 Bacteria 2144
116 Ga0207705_10100515 3300025909 Bacteria 2127
117 Ga0207705_10447960 3300025909 Bacteria 1001
118 Ga0207657_10056416 3300025919 Bacteria 3389
119 Ga0207681_10011289 3300025923 Bacteria 5488
120 Ga0207681_10044523 3300025923 Bacteria 2975
121 Ga0207681_11065680 3300025923 Bacteria 679
122 Ga0207694_10046259 3300025924 Bacteria 3363
123 Ga0207650_10005998 3300025925 Bacteria 8292
124 Ga0207650_10072910 3300025925 Bacteria 2585
125 Ga0207650_10106601 3300025925 Bacteria 2164
126 Ga0207687_10775212 3300025927 Bacteria 817
127 Ga0207644_10008787 3300025931 Bacteria 6614
128 Ga0207644_10163727 3300025931 Bacteria 1731
129 Ga0207644_10295720 3300025931 Bacteria 1303
130 Ga0207690_10000454 3300025932 Bacteria 26405
131 Ga0207690_10035121 3300025932 Bacteria 3235
132 Ga0207706_10069421 3300025933 Bacteria 3099
133 Ga0207706_10197849 3300025933 Bacteria 1762
134 Ga0207711_10003508 3300025941 Bacteria 13577
135 Ga0207711_10398123 3300025941 Bacteria 1279
136 Ga0207661_11189990 3300025944 Bacteria 701
137 Ga0207679_10036692 3300025945 Bacteria 3478
138 Ga0207667_10235927 3300025949 Bacteria 1872
139 Ga0207667_10771939 3300025949 Bacteria 959
140 Ga0207712_10103701 3300025961 Bacteria 2119
141 Ga0207712_10856075 3300025961 Bacteria 801
142 Ga0207668_10024068 3300025972 Bacteria 3925
143 Ga0207668_10025052 3300025972 Bacteria 3856
144 Ga0207668_10031229 3300025972 Bacteria 3506
145 Ga0207668_10053971 3300025972 Bacteria 2787
146 Ga0207658_10008689 3300025986 Bacteria 6900
147 Ga0207658_10019508 3300025986 Bacteria 4690
148 Ga0207677_10219501 3300026023 Bacteria 1524
149 Ga0207677_10396966 3300026023 Bacteria 1169
150 Ga0207677_10741870 3300026023 Bacteria 874
151 Ga0207703_10000853 3300026035 Bacteria 29885
152 Ga0207703_10048905 3300026035 Bacteria 3416
153 Ga0207703_11040272 3300026035 Bacteria 786
154 Ga0207639_10186284 3300026041 Bacteria 1770
155 Ga0207639_10414422 3300026041 Bacteria 1216
156 Ga0207702_10083958 3300026078 Bacteria 2772
157 Ga0207702_10664265 3300026078 Bacteria 1026
158 Ga0207641_10007469 3300026088 Bacteria 9094
159 Ga0207641_10027962 3300026088 Bacteria 4658
160 Ga0207641_10272559 3300026088 Bacteria 1588
161 Ga0207641_10522887 3300026088 Bacteria 1154
162 Ga0207676_10001209 3300026095 Bacteria 19315
163 Ga0207676_10287091 3300026095 Bacteria 1496
164 Ga0207675_100026982 3300026118 Bacteria 5347
165 Ga0207675_100604739 3300026118 Bacteria 1100
166 Ga0207683_10397864 3300026121 Bacteria 1267
167 Ga0207698_10784654 3300026142 Bacteria 954
168 Ga0268266_10027470 3300028379 Bacteria 4838
169 Ga0268266_10332844 3300028379 Bacteria 1423
170 Ga0268266_11180363 3300028379 Bacteria 740
171 Ga0268265_10005954 3300028380 Bacteria 8301
172 Ga0268265_10068325 3300028380 Bacteria 2755
173 Ga0268265_10198184 3300028380 Bacteria 1739
174 Ga0268265_10441979 3300028380 Bacteria 1212
175 Ga0268265_11070053 3300028380 Bacteria 799
176 Ga0268264_10000181 3300028381 Bacteria 134092
177 Ga0268264_10074656 3300028381 Bacteria 2881
178 Ga0268264_10350941 3300028381 Bacteria 1404
179 Ga0268264_10919953 3300028381 Bacteria 878
180 Ga0265334_10028944 3300028573 Bacteria 2221
181 Ga0307517_10002560 3300028786 Bacteria 28963
182 Ga0307517_10092103 3300028786 Bacteria 2469
183 Ga0265338_10027915 3300028800 Bacteria 5648
184 Ga0265338_10185716 3300028800 Bacteria 1580
185 Ga0265338_10185799 3300028800 Bacteria 1580
186 Ga0265338_10447232 3300028800 Bacteria 915
187 Ga0307511_10076363 3300030521 Bacteria 2395
188 Ga0265770_1037437 3300030878 Bacteria 837
189 Ga0265331_10050873 3300031250 Bacteria 1985
190 Ga0265327_10002880 3300031251 Bacteria 17304
191 Ga0307513_10000100 3300031456 Bacteria 125183
192 Ga0307513_10003932 3300031456 Bacteria 19987
193 Ga0307513_10005108 3300031456 Bacteria 17370
194 Ga0307513_10019767 3300031456 Bacteria 8005
195 Ga0265314_10015569 3300031711 Bacteria 6030
196 Ga0265342_10073578 3300031712 Bacteria 1987
197 Ga0307516_10000030 3300031730 Bacteria 159694
198 Ga0307405_10792237 3300031731 Bacteria 793
199 Ga0307405_10803485 3300031731 Bacteria 788
200 Ga0307410_10006353 3300031852 Bacteria 6372
201 Ga0307407_10068711 3300031903 Bacteria 2100
202 Ga0307409_100312172 3300031995 Bacteria 1468
203 Ga0307416_101337795 3300032002 Bacteria 822
204 Ga0307414_10245283 3300032004 Bacteria 1485
205 Ga0307414_10449683 3300032004 Bacteria 1129
206 Ga0307414_10561969 3300032004 Bacteria 1018
207 Ga0307411_10056698 3300032005 Bacteria 2584
208 Ga0307411_10433589 3300032005 Bacteria 1095
209 Ga0373929_0200024 3300035085 Bacteria 559
210 Ga0373946_0012473 3300035171 Bacteria 3182
211 Ga0373927_0000899 3300035695 Bacteria 22619
212 Ga0373927_0692545 3300035695 Bacteria 673
213 Ga0373947_0668376 3300035725 Bacteria 708
214 Ga0373925_0000278 3300037068 Bacteria 53402
215 Ga0395899_0000003 3300037312 Bacteria 1232684
216 Ga0395899_0000190 3300037312 Bacteria 90356
217 Ga0395899_0045996 3300037312 Bacteria 3251
218 Ga0395899_0132459 3300037312 Bacteria 1779
219 Ga0395900_0000002 3300037418 Bacteria 671103
220 Ga0395900_0059940 3300037418 Bacteria 3917
221 Ga0395900_0142510 3300037418 Bacteria 2453
222 Ga0395900_0374892 3300037418 Bacteria 1392
223 Ga0395898_0010662 3300037466 Bacteria 9602
224 Ga0395898_0189779 3300037466 Bacteria 1964
225 Ga0395905_0000283 3300037471 Bacteria 74377
226 Ga0395905_0003618 3300037471 Bacteria 16421
227 Ga0395905_0006506 3300037471 Bacteria 11750
228 Ga0395905_0127073 3300037471 Bacteria 2397
229 Ga0395905_0174802 3300037471 Bacteria 2016
230 Ga0395905_0354591 3300037471 Bacteria 1359
231 Ga0395905_1267709 3300037471 Bacteria 641
232 Ga0436364_1480659 3300037853 Bacteria 6072
233 Ga0395901_0000013 3300038443 Bacteria 375733
234 Ga0395901_0015100 3300038443 Bacteria 7854
235 Ga0395901_0033506 3300038443 Bacteria 5303
236 Ga0395901_0693043 3300038443 Bacteria 1017
237 Ga0436365_0752622 3300039437 Bacteria 2831
238 Ga0436365_1309907 3300039437 Bacteria 1140
239 Ga0436365_1358178 3300039437 Bacteria 6448
240 Ga0436361_0229888 3300039447 Bacteria 983
241 Ga0436361_0726920 3300039447 Bacteria 29762
242 Ga0436361_0988308 3300039447 Bacteria 1987
243 Ga0439445_0151984 3300042004 Bacteria 674
244 Ga0451577_0133521 3300042876 Bacteria 2228
245 Ga0466969_0000108 3300044656 Bacteria 43906
246 Ga0466965_0094609 3300044683 Bacteria 1523
247 Ga0466966_0010049 3300044684 Bacteria 6273
248 Ga0466961_0008154 3300044693 Bacteria 6672
249 Ga0466961_0728782 3300044693 Bacteria 593
250 Ga0466963_0045495 3300044694 Bacteria 2891
251 Ga0466963_0447173 3300044694 Bacteria 912
252 Ga0466964_0298923 3300044706 Bacteria 811
253 Ga0466971_0002488 3300044719 Bacteria 7788
254 Ga0466970_0023985 3300044765 Bacteria 3189
255 Ga0466970_0279207 3300044765 Bacteria 939
256 Ga0466957_0006955 3300044842 Bacteria 6399
257 Ga0466957_0995271 3300044842 Bacteria 602
258 Ga0466960_0164965 3300044901 Bacteria 1192
259 Ga0466959_0000087 3300045049 Bacteria 58860
260 Ga0466959_0065119 3300045049 Bacteria 2645
261 Ga0466958_0004760 3300045836 Bacteria 7217
262 Ga0466967_0765653 3300045976 Bacteria 958
263 Ga0495662_0075797 3300046476 Bacteria 1632
264 Ga0495642_0021452 3300046528 Bacteria 2540
265 Ga0495652_0471090 3300046529 Bacteria 876
266 Ga0495621_0098502 3300046539 Bacteria 1110
267 Ga0495621_0251606 3300046539 Bacteria 722
268 Ga0495668_0053362 3300046616 Bacteria 2235
269 Ga0495668_0103917 3300046616 Bacteria 1554
270 Ga0495668_0171092 3300046616 Bacteria 1190
271 Ga0495611_0006005 3300046648 Bacteria 5181
272 Ga0495659_0103147 3300046664 Bacteria 1107
273 Ga0495669_0000059 3300046684 Bacteria 76021
274 Ga0495613_0011884 3300046689 Bacteria 6471
275 Ga0495672_0327448 3300047320 Bacteria 718
276 Ga0495677_0011667 3300047445 Bacteria 3211
277 Ga0495677_0055895 3300047445 Bacteria 1457
278 Ga0495681_0033094 3300047470 Bacteria 2594
279 Ga0495686_0004794 3300047472 Bacteria 10918
280 Ga0496102_0054501 3300048905 Bacteria 3646
281 Ga0496106_0041910 3300048909 Bacteria 3432
282 Ga0496106_0703726 3300048909 Bacteria 805
283 Ga0496107_0132675 3300048910 Bacteria 1839
284 Ga0496109_0029376 3300048912 Bacteria 4923
285 Ga0496111_0264793 3300048914 Bacteria 1275
286 Ga0496112_0036312 3300048915 Bacteria 4807
287 Ga0496113_0077103 3300048916 Bacteria 2548
288 Ga0496115_0491482 3300048918 Bacteria 987
289 Ga0501033_0083315 3300049570 Bacteria 2344
290 Ga0501033_0146082 3300049570 Bacteria 1708
291 Ga0501034_0002726 3300049571 Bacteria 20781
292 Ga0501034_0591479 3300049571 Bacteria 1016
293 Ga0501034_0896218 3300049571 Bacteria 775
294 Ga0501036_0419248 3300049572 Bacteria 1116
295 Ga0501036_0700135 3300049572 Bacteria 837
296 Ga0501037_0144981 3300049573 Bacteria 1699
297 Ga0501043_0180910 3300049579 Bacteria 1642
298 Ga0501047_0002719 3300049581 Bacteria 16836
299 Ga0501047_0064602 3300049581 Bacteria 3530
300 Ga0501047_0078482 3300049581 Bacteria 3175
301 Ga0501047_0209128 3300049581 Bacteria 1810
302 Ga0501047_0334739 3300049581 Bacteria 1352
303 Ga0501047_0360645 3300049581 Bacteria 1289
304 Ga0501047_0440250 3300049581 Bacteria 1133
305 Ga0501047_0692586 3300049581 Bacteria 837
306 Ga0501048_0169527 3300049582 Bacteria 1546
307 Ga0501080_1017234 3300049742 Bacteria 718
308 Ga0501080_1132637 3300049742 Bacteria 675
309 Ga0501035_0087130 3300049822 Bacteria 2752
310 Ga0501044_0011306 3300049823 Bacteria 9674
311 Ga0501044_0197888 3300049823 Bacteria 1969
312 Ga0501044_0307734 3300049823 Bacteria 1512
313 Ga0501044_1131557 3300049823 Bacteria 652
314 nmdc:mga07m45_207751_c1 3300050496 Bacteria 1139
315 Ga0500643_000458 3300053087 Bacteria 30192
316 Ga0500643_011720 3300053087 Bacteria 3180
317 Ga0500643_018627 3300053087 Bacteria 2300
318 Ga0500643_031697 3300053087 Bacteria 1610
319 Ga0500646_0072035 3300053090 Bacteria 1038
320 Ga0500647_0005072 3300053091 Bacteria 5411
321 Ga0500641_0002770 3300053096 Bacteria 6200
322 Ga0500641_0004691 3300053096 Bacteria 4831
323 Ga0500650_0258136 3300053098 Bacteria 780
324 Ga0500555_147022 3300053103 Bacteria 578
325 Ga0500556_0003825 3300053104 Bacteria 4366
326 Ga0500562_001018 3300053108 Bacteria 6858
327 Ga0500562_008934 3300053108 Bacteria 2531
328 Ga0500572_000396 3300053111 Bacteria 15358
329 Ga0500595_126234 3300053119 Bacteria 722
330 Ga0500597_029059 3300053120 Bacteria 2261
331 Ga0500608_204979 3300053122 Bacteria 811
332 Ga0500614_029752 3300053123 Bacteria 1328
333 Ga0500559_0000016 3300053136 Bacteria 151244
334 Ga0500559_0038619 3300053136 Bacteria 2074
335 Ga0500590_125225 3300053148 Bacteria 1197
336 Ga0500604_0144937 3300053151 Bacteria 804
337 Ga0500616_0024152 3300053153 Bacteria 3382
338 Ga0500616_0056135 3300053153 Bacteria 2056
339 Ga0500622_0003711 3300053156 Bacteria 10011
340 Ga0500622_0018962 3300053156 Bacteria 3655
341 Ga0500636_0023240 3300053177 Bacteria 3665
342 Ga0500645_002367 3300053730 Bacteria 8492
343 Ga0500645_002819 3300053730 Bacteria 7489
344 Ga0500552_010955 3300053733 Bacteria 1128
345 Ga0466962_0007628 3300061719 Bacteria 5186
346 Ga0466962_0017945 3300061719 Bacteria 3405

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035085 Ga0373929_0200024 Ga0373929_0200024_14_418 133
2 3300037466 Ga0395898_0189779 Ga0395898_0189779_1347_1895 152
3 3300005262 Ga0065165_1001044 Ga0065165_100104436 154
4 3300042004 Ga0439445_0151984 Ga0439445_0151984_67_621 154
5 3300003794 Ga0055531_10038183 Ga0055531_100381831 155
6 3300025304 Ga0209257_1003257 Ga0209257_10032579 155
7 3300039447 Ga0436361_0988308 Ga0436361_0988308_682_1215 155
8 3300053087 Ga0500643_018627 Ga0500643_018627_11_544 155
9 3300053098 Ga0500650_0258136 Ga0500650_0258136_210_743 155
10 3300053108 Ga0500562_001018 Ga0500562_001018_3501_4034 155
11 3300053153 Ga0500616_0056135 Ga0500616_0056135_800_1333 155
12 3300053730 Ga0500645_002819 Ga0500645_002819_4278_4811 155
13 3300005617 Ga0068859_100768721 Ga0068859_1007687211 156
14 3300005844 Ga0068862_100221994 Ga0068862_1002219943 156
15 3300006048 Ga0075363_100135948 Ga0075363_1001359482 156
16 3300006931 Ga0097620_100768827 Ga0097620_1007688271 156
17 3300025250 Ga0209026_1011724 Ga0209026_10117243 156
18 3300028380 Ga0268265_10005954 Ga0268265_100059543 156
19 3300049572 Ga0501036_0700135 Ga0501036_0700135_276_812 156
20 3300049581 Ga0501047_0078482 Ga0501047_0078482_1618_2154 156
21 3300049823 Ga0501044_0197888 Ga0501044_0197888_865_1389 156
22 3300049823 Ga0501044_0307734 Ga0501044_0307734_443_979 156
23 3300005347 Ga0070668_100004828 Ga0070668_1000048289 157
24 3300025972 Ga0207668_10025052 Ga0207668_100250524 157
25 3300026118 Ga0207675_100026982 Ga0207675_1000269824 157
26 3300032002 Ga0307416_101337795 Ga0307416_1013377952 157
27 3300049742 Ga0501080_1132637 Ga0501080_1132637_137_664 157
28 3300053090 Ga0500646_0072035 Ga0500646_0072035_52_579 157
29 3300053156 Ga0500622_0003711 Ga0500622_0003711_97_624 157
30 3300005841 Ga0068863_100095381 Ga0068863_1000953813 158
31 3300014325 Ga0163163_10292106 Ga0163163_102921062 158
32 3300046684 Ga0495669_0000059 Ga0495669_0000059_50878_51435 158
33 3300005331 Ga0070670_100538690 Ga0070670_1005386901 159
34 3300005347 Ga0070668_100074247 Ga0070668_1000742472 159
35 3300005841 Ga0068863_100458329 Ga0068863_1004583291 159
36 3300005844 Ga0068862_100013722 Ga0068862_1000137222 159
37 3300025925 Ga0207650_10106601 Ga0207650_101066012 159
38 3300025972 Ga0207668_10024068 Ga0207668_100240683 159
39 3300026088 Ga0207641_10522887 Ga0207641_105228872 159
40 3300028380 Ga0268265_10068325 Ga0268265_100683253 159
41 3300031730 Ga0307516_10000030 Ga0307516_100000301 159
42 3300032004 Ga0307414_10561969 Ga0307414_105619692 159
43 3300037471 Ga0395905_0354591 Ga0395905_0354591_631_1182 159
44 3300025961 Ga0207712_10856075 Ga0207712_108560752 160
45 3300026035 Ga0207703_10048905 Ga0207703_100489052 160
46 3300025923 Ga0207681_11065680 Ga0207681_110656801 162
47 3300031456 Ga0307513_10000100 Ga0307513_1000010066 163
48 3300005842 Ga0068858_100246276 Ga0068858_1002462762 164
49 3300009093 Ga0105240_10705546 Ga0105240_107055462 164
50 3300037471 Ga0395905_0006506 Ga0395905_0006506_11184_11738 164
51 3300049571 Ga0501034_0002726 Ga0501034_0002726_5256_5789 164
52 3300053103 Ga0500555_147022 Ga0500555_147022_28_564 164
53 3300038443 Ga0395901_0693043 Ga0395901_0693043_76_609 166
54 3300021384 Ga0213876_10035199 Ga0213876_100351992 167
55 3300031250 Ga0265331_10050873 Ga0265331_100508733 167
56 3300031251 Ga0265327_10002880 Ga0265327_1000288014 167
57 3300039437 Ga0436365_1358178 Ga0436365_1358178_4684_5214 167
58 3300039447 Ga0436361_0229888 Ga0436361_0229888_99_632 167
59 3300005366 Ga0070659_100013614 Ga0070659_1000136147 168
60 3300025932 Ga0207690_10035121 Ga0207690_100351212 168
61 3300045976 Ga0466967_0765653 Ga0466967_0765653_38_592 168
62 3300031731 Ga0307405_10803485 Ga0307405_108034852 169
63 3300031852 Ga0307410_10006353 Ga0307410_100063532 169
64 3300031903 Ga0307407_10068711 Ga0307407_100687113 169
65 3300032004 Ga0307414_10245283 Ga0307414_102452833 169
66 3300032005 Ga0307411_10056698 Ga0307411_100566981 169
67 3300044683 Ga0466965_0094609 Ga0466965_0094609_577_1107 169
68 3300044694 Ga0466963_0447173 Ga0466963_0447173_43_573 169
69 3300044765 Ga0466970_0279207 Ga0466970_0279207_151_681 169
70 3300044842 Ga0466957_0995271 Ga0466957_0995271_17_547 169
71 3300053119 Ga0500595_126234 Ga0500595_126234_82_612 169
72 3300005617 Ga0068859_100275818 Ga0068859_1002758182 170
73 3300005843 Ga0068860_100727949 Ga0068860_1007279492 170
74 3300006931 Ga0097620_100275800 Ga0097620_1002758002 170
75 3300028381 Ga0268264_10919953 Ga0268264_109199531 170
76 3300049579 Ga0501043_0180910 Ga0501043_0180910_576_1112 170
77 3300049581 Ga0501047_0360645 Ga0501047_0360645_637_1173 170
78 3300013100 Ga0157373_10004928 Ga0157373_100049282 172
79 3300026041 Ga0207639_10414422 Ga0207639_104144221 172
80 3300047472 Ga0495686_0004794 Ga0495686_0004794_10274_10810 172
81 iso_pu_bacteria 2671180139 2671694824 172
82 iso_pu_bacteria 2995463766 2995467401 172
83 3300037312 Ga0395899_0000190 Ga0395899_0000190_42961_43515 173
84 3300037418 Ga0395900_0000002 Ga0395900_0000002_428169_428723 173
85 3300037466 Ga0395898_0010662 Ga0395898_0010662_5588_6142 173
86 3300037471 Ga0395905_0003618 Ga0395905_0003618_6390_6944 173
87 3300038443 Ga0395901_0000013 Ga0395901_0000013_275062_275616 173
88 3300042876 Ga0451577_0133521 Ga0451577_0133521_305_826 173
89 iso_pu_bacteria 2643221699 2644549338 173
90 3300037312 Ga0395899_0045996 Ga0395899_0045996_2276_2800 174
91 3300037418 Ga0395900_0059940 Ga0395900_0059940_2144_2668 174
92 3300037471 Ga0395905_0127073 Ga0395905_0127073_307_831 174
93 3300038443 Ga0395901_0033506 Ga0395901_0033506_2750_3274 174
94 3300044693 Ga0466961_0728782 Ga0466961_0728782_49_573 174
95 3300049571 Ga0501034_0591479 Ga0501034_0591479_31_555 174
96 3300049571 Ga0501034_0896218 Ga0501034_0896218_141_665 174
97 3300049572 Ga0501036_0419248 Ga0501036_0419248_485_1009 174
98 3300049573 Ga0501037_0144981 Ga0501037_0144981_458_982 174
99 3300049581 Ga0501047_0334739 Ga0501047_0334739_753_1277 174
100 3300053087 Ga0500643_011720 Ga0500643_011720_1238_1762 174
101 iso_pu_bacteria 2643221598 2644000975 174
102 iso_pu_bacteria 2643221614 2644087792 174
103 iso_pu_bacteria 2643221661 2644345396 174
104 iso_pu_bacteria 2643221666 2644367148 174
105 3300003320 rootH2_10080531 rootH2_100805312 175
106 3300005841 Ga0068863_100399562 Ga0068863_1003995622 175
107 3300037471 Ga0395905_0000283 Ga0395905_0000283_54847_55374 175
108 3300039437 Ga0436365_1309907 Ga0436365_1309907_96_623 175
109 3300044901 Ga0466960_0164965 Ga0466960_0164965_333_860 175
110 3300045049 Ga0466959_0065119 Ga0466959_0065119_1898_2425 175
111 3300048918 Ga0496115_0491482 Ga0496115_0491482_179_709 175
112 3300061719 Ga0466962_0017945 Ga0466962_0017945_624_1193 175
113 3300003781 Ga0055536_1001916 Ga0055536_100191611 176
114 3300026078 Ga0207702_10083958 Ga0207702_100839582 176
115 3300044656 Ga0466969_0000108 Ga0466969_0000108_40253_40783 176
116 3300044684 Ga0466966_0010049 Ga0466966_0010049_2086_2616 176
117 3300044693 Ga0466961_0008154 Ga0466961_0008154_3124_3654 176
118 3300044694 Ga0466963_0045495 Ga0466963_0045495_1686_2216 176
119 3300044706 Ga0466964_0298923 Ga0466964_0298923_244_774 176
120 3300044719 Ga0466971_0002488 Ga0466971_0002488_1442_1972 176
121 3300044765 Ga0466970_0023985 Ga0466970_0023985_1483_2013 176
122 3300044842 Ga0466957_0006955 Ga0466957_0006955_3855_4385 176
123 3300045049 Ga0466959_0000087 Ga0466959_0000087_1300_1830 176
124 3300045836 Ga0466958_0004760 Ga0466958_0004760_5949_6479 176
125 3300061719 Ga0466962_0007628 Ga0466962_0007628_238_768 176
126 3300005535 Ga0070684_100809091 Ga0070684_1008090912 177
127 3300005539 Ga0068853_100060651 Ga0068853_1000606511 177
128 3300005539 Ga0068853_100266113 Ga0068853_1002661131 177
129 3300005564 Ga0070664_100086088 Ga0070664_1000860882 177
130 3300013100 Ga0157373_10000851 Ga0157373_1000085118 177
131 3300017792 Ga0163161_10879542 Ga0163161_108795421 177
132 3300021361 Ga0213872_10143306 Ga0213872_101433061 177
133 3300021384 Ga0213876_10049871 Ga0213876_100498712 177
134 3300025945 Ga0207679_10036692 Ga0207679_100366923 177
135 3300026041 Ga0207639_10186284 Ga0207639_101862843 177
136 3300028573 Ga0265334_10028944 Ga0265334_100289443 177
137 3300028786 Ga0307517_10002560 Ga0307517_100025607 177
138 3300028800 Ga0265338_10185716 Ga0265338_101857162 177
139 3300028800 Ga0265338_10185799 Ga0265338_101857992 177
140 3300031456 Ga0307513_10005108 Ga0307513_1000510814 177
141 3300031711 Ga0265314_10015569 Ga0265314_100155697 177
142 3300032004 Ga0307414_10449683 Ga0307414_104496831 177
143 3300035695 Ga0373927_0692545 Ga0373927_0692545_74_622 177
144 3300037312 Ga0395899_0000003 Ga0395899_0000003_996099_996632 177
145 3300039437 Ga0436365_0752622 Ga0436365_0752622_1056_1589 177
146 3300046476 Ga0495662_0075797 Ga0495662_0075797_619_1155 177
147 3300049570 Ga0501033_0083315 Ga0501033_0083315_90_623 177
148 3300049581 Ga0501047_0002719 Ga0501047_0002719_4406_4939 177
149 3300053087 Ga0500643_000458 Ga0500643_000458_25672_26205 177
150 3300053087 Ga0500643_031697 Ga0500643_031697_63_596 177
151 3300053096 Ga0500641_0002770 Ga0500641_0002770_5657_6190 177
152 3300053096 Ga0500641_0004691 Ga0500641_0004691_34_567 177
153 3300053104 Ga0500556_0003825 Ga0500556_0003825_3776_4309 177
154 3300053136 Ga0500559_0038619 Ga0500559_0038619_867_1418 177
155 3300053151 Ga0500604_0144937 Ga0500604_0144937_208_741 177
156 3300053153 Ga0500616_0024152 Ga0500616_0024152_2080_2613 177
157 3300053156 Ga0500622_0018962 Ga0500622_0018962_1226_1759 177
158 3300053730 Ga0500645_002367 Ga0500645_002367_3972_4505 177
159 3300003215 JGI25153J46596_10023328 JGI25153J46596_100233282 178
160 3300003791 Ga0055530_10001482 Ga0055530_1000148216 178
161 3300003794 Ga0055531_10002587 Ga0055531_1000258713 178
162 3300005262 Ga0065165_1003241 Ga0065165_100324114 178
163 3300005293 Ga0065715_10248328 Ga0065715_102483282 178
164 3300005327 Ga0070658_10270681 Ga0070658_102706811 178
165 3300005327 Ga0070658_10276221 Ga0070658_102762211 178
166 3300005329 Ga0070683_100342799 Ga0070683_1003427992 178
167 3300005329 Ga0070683_100522664 Ga0070683_1005226641 178
168 3300005330 Ga0070690_100357261 Ga0070690_1003572612 178
169 3300005331 Ga0070670_100027269 Ga0070670_1000272695 178
170 3300005331 Ga0070670_100099608 Ga0070670_1000996081 178
171 3300005336 Ga0070680_100045589 Ga0070680_1000455893 178
172 3300005338 Ga0068868_100349922 Ga0068868_1003499222 178
173 3300005339 Ga0070660_100010321 Ga0070660_1000103214 178
174 3300005339 Ga0070660_100144305 Ga0070660_1001443052 178
175 3300005347 Ga0070668_100006236 Ga0070668_1000062366 178
176 3300005347 Ga0070668_100013620 Ga0070668_1000136206 178
177 3300005347 Ga0070668_100088046 Ga0070668_1000880464 178
178 3300005353 Ga0070669_100084724 Ga0070669_1000847242 178
179 3300005355 Ga0070671_100014881 Ga0070671_1000148814 178
180 3300005355 Ga0070671_100578125 Ga0070671_1005781252 178
181 3300005366 Ga0070659_100002533 Ga0070659_10000253313 178
182 3300005367 Ga0070667_100040810 Ga0070667_1000408103 178
183 3300005367 Ga0070667_100082151 Ga0070667_1000821512 178
184 3300005457 Ga0070662_100054667 Ga0070662_1000546673 178
185 3300005457 Ga0070662_100504127 Ga0070662_1005041271 178
186 3300005458 Ga0070681_10092988 Ga0070681_100929884 178
187 3300005471 Ga0070698_101197566 Ga0070698_1011975661 178
188 3300005535 Ga0070684_100304429 Ga0070684_1003044292 178
189 3300005539 Ga0068853_100021119 Ga0068853_1000211192 178
190 3300005539 Ga0068853_100873598 Ga0068853_1008735981 178
191 3300005548 Ga0070665_100018581 Ga0070665_1000185814 178
192 3300005548 Ga0070665_100034717 Ga0070665_1000347177 178
193 3300005563 Ga0068855_100726333 Ga0068855_1007263332 178
194 3300005563 Ga0068855_101632679 Ga0068855_1016326791 178
195 3300005578 Ga0068854_101468420 Ga0068854_1014684201 178
196 3300005616 Ga0068852_100213467 Ga0068852_1002134672 178
197 3300005617 Ga0068859_100003282 Ga0068859_1000032824 178
198 3300005617 Ga0068859_100049833 Ga0068859_1000498336 178
199 3300005617 Ga0068859_100698786 Ga0068859_1006987862 178
200 3300005618 Ga0068864_100011878 Ga0068864_1000118782 178
201 3300005841 Ga0068863_100031486 Ga0068863_1000314863 178
202 3300005841 Ga0068863_100070383 Ga0068863_1000703834 178
203 3300005841 Ga0068863_100115758 Ga0068863_1001157583 178
204 3300005841 Ga0068863_100127352 Ga0068863_1001273523 178
205 3300005842 Ga0068858_101053385 Ga0068858_1010533852 178
206 3300005843 Ga0068860_100000027 Ga0068860_10000002750 178
207 3300005843 Ga0068860_100091737 Ga0068860_1000917373 178
208 3300005843 Ga0068860_100177627 Ga0068860_1001776272 178
209 3300005844 Ga0068862_100013540 Ga0068862_1000135407 178
210 3300005844 Ga0068862_100494593 Ga0068862_1004945931 178
211 3300006931 Ga0097620_100003282 Ga0097620_1000032824 178
212 3300006931 Ga0097620_100049831 Ga0097620_1000498316 178
213 3300006931 Ga0097620_100698760 Ga0097620_1006987602 178
214 3300009101 Ga0105247_10072615 Ga0105247_100726153 178
215 3300009176 Ga0105242_10183360 Ga0105242_101833602 178
216 3300009177 Ga0105248_10005575 Ga0105248_1000557511 178
217 3300009551 Ga0105238_10057638 Ga0105238_100576385 178
218 3300009551 Ga0105238_11560215 Ga0105238_115602151 178
219 3300009553 Ga0105249_10088271 Ga0105249_100882713 178
220 3300010375 Ga0105239_10171064 Ga0105239_101710644 178
221 3300013104 Ga0157370_10954618 Ga0157370_109546181 178
222 3300013296 Ga0157374_10960868 Ga0157374_109608681 178
223 3300013306 Ga0163162_10018044 Ga0163162_100180445 178
224 3300013306 Ga0163162_10048059 Ga0163162_100480595 178
225 3300013307 Ga0157372_11505519 Ga0157372_115055191 178
226 3300013308 Ga0157375_10053327 Ga0157375_100533275 178
227 3300013308 Ga0157375_11223500 Ga0157375_112235002 178
228 3300013308 Ga0157375_11262759 Ga0157375_112627591 178
229 3300014325 Ga0163163_10051019 Ga0163163_100510194 178
230 3300014325 Ga0163163_10151366 Ga0163163_101513662 178
231 3300014326 Ga0157380_10782501 Ga0157380_107825012 178
232 3300014745 Ga0157377_10503085 Ga0157377_105030852 178
233 3300014968 Ga0157379_10001109 Ga0157379_1000110911 178
234 3300021361 Ga0213872_10004761 Ga0213872_100047615 178
235 3300021388 Ga0213875_10020340 Ga0213875_100203403 178
236 3300025297 Ga0209758_1000852 Ga0209758_100085244 178
237 3300025298 Ga0209050_1000053 Ga0209050_1000053197 178
238 3300025304 Ga0209257_1000289 Ga0209257_100028979 178
239 3300025900 Ga0207710_10037378 Ga0207710_100373782 178
240 3300025909 Ga0207705_10100515 Ga0207705_101005152 178
241 3300025909 Ga0207705_10447960 Ga0207705_104479602 178
242 3300025919 Ga0207657_10056416 Ga0207657_100564164 178
243 3300025923 Ga0207681_10011289 Ga0207681_100112894 178
244 3300025923 Ga0207681_10044523 Ga0207681_100445233 178
245 3300025924 Ga0207694_10046259 Ga0207694_100462594 178
246 3300025925 Ga0207650_10005998 Ga0207650_100059987 178
247 3300025925 Ga0207650_10072910 Ga0207650_100729104 178
248 3300025927 Ga0207687_10775212 Ga0207687_107752121 178
249 3300025931 Ga0207644_10008787 Ga0207644_100087875 178
250 3300025931 Ga0207644_10163727 Ga0207644_101637272 178
251 3300025931 Ga0207644_10295720 Ga0207644_102957202 178
252 3300025932 Ga0207690_10000454 Ga0207690_100004548 178
253 3300025933 Ga0207706_10069421 Ga0207706_100694213 178
254 3300025933 Ga0207706_10197849 Ga0207706_101978492 178
255 3300025941 Ga0207711_10003508 Ga0207711_100035085 178
256 3300025941 Ga0207711_10398123 Ga0207711_103981232 178
257 3300025944 Ga0207661_11189990 Ga0207661_111899901 178
258 3300025949 Ga0207667_10235927 Ga0207667_102359273 178
259 3300025949 Ga0207667_10771939 Ga0207667_107719392 178
260 3300025961 Ga0207712_10103701 Ga0207712_101037012 178
261 3300025972 Ga0207668_10031229 Ga0207668_100312293 178
262 3300025972 Ga0207668_10053971 Ga0207668_100539712 178
263 3300025986 Ga0207658_10008689 Ga0207658_100086897 178
264 3300025986 Ga0207658_10019508 Ga0207658_100195083 178
265 3300026023 Ga0207677_10219501 Ga0207677_102195012 178
266 3300026023 Ga0207677_10396966 Ga0207677_103969662 178
267 3300026023 Ga0207677_10741870 Ga0207677_107418702 178
268 3300026035 Ga0207703_10000853 Ga0207703_1000085331 178
269 3300026035 Ga0207703_11040272 Ga0207703_110402722 178
270 3300026078 Ga0207702_10664265 Ga0207702_106642651 178
271 3300026088 Ga0207641_10007469 Ga0207641_100074696 178
272 3300026088 Ga0207641_10027962 Ga0207641_100279622 178
273 3300026088 Ga0207641_10272559 Ga0207641_102725593 178
274 3300026095 Ga0207676_10001209 Ga0207676_1000120918 178
275 3300026095 Ga0207676_10287091 Ga0207676_102870911 178
276 3300026118 Ga0207675_100604739 Ga0207675_1006047391 178
277 3300026121 Ga0207683_10397864 Ga0207683_103978642 178
278 3300026142 Ga0207698_10784654 Ga0207698_107846541 178
279 3300028379 Ga0268266_10027470 Ga0268266_100274703 178
280 3300028379 Ga0268266_10332844 Ga0268266_103328441 178
281 3300028379 Ga0268266_11180363 Ga0268266_111803632 178
282 3300028380 Ga0268265_10198184 Ga0268265_101981842 178
283 3300028380 Ga0268265_10441979 Ga0268265_104419792 178
284 3300028380 Ga0268265_11070053 Ga0268265_110700531 178
285 3300028381 Ga0268264_10000181 Ga0268264_1000018175 178
286 3300028381 Ga0268264_10074656 Ga0268264_100746563 178
287 3300028381 Ga0268264_10350941 Ga0268264_103509412 178
288 3300028786 Ga0307517_10092103 Ga0307517_100921032 178
289 3300028800 Ga0265338_10027915 Ga0265338_100279153 178
290 3300028800 Ga0265338_10447232 Ga0265338_104472322 178
291 3300030521 Ga0307511_10076363 Ga0307511_100763631 178
292 3300030878 Ga0265770_1037437 Ga0265770_10374371 178
293 3300031456 Ga0307513_10003932 Ga0307513_1000393216 178
294 3300031456 Ga0307513_10019767 Ga0307513_100197677 178
295 3300031712 Ga0265342_10073578 Ga0265342_100735783 178
296 3300031731 Ga0307405_10792237 Ga0307405_107922372 178
297 3300031995 Ga0307409_100312172 Ga0307409_1003121722 178
298 3300032005 Ga0307411_10433589 Ga0307411_104335891 178
299 3300035171 Ga0373946_0012473 Ga0373946_0012473_959_1495 178
300 3300035695 Ga0373927_0000899 Ga0373927_0000899_19821_20357 178
301 3300035725 Ga0373947_0668376 Ga0373947_0668376_138_674 178
302 3300037068 Ga0373925_0000278 Ga0373925_0000278_27591_28127 178
303 3300037312 Ga0395899_0132459 Ga0395899_0132459_71_607 178
304 3300037418 Ga0395900_0142510 Ga0395900_0142510_1536_2072 178
305 3300037418 Ga0395900_0374892 Ga0395900_0374892_698_1234 178
306 3300037471 Ga0395905_0174802 Ga0395905_0174802_709_1245 178
307 3300037471 Ga0395905_1267709 Ga0395905_1267709_62_598 178
308 3300037853 Ga0436364_1480659 Ga0436364_1480659_4766_5302 178
309 3300038443 Ga0395901_0015100 Ga0395901_0015100_1454_1990 178
310 3300039447 Ga0436361_0726920 Ga0436361_0726920_23161_23700 178
311 3300046528 Ga0495642_0021452 Ga0495642_0021452_1843_2379 178
312 3300046529 Ga0495652_0471090 Ga0495652_0471090_185_721 178
313 3300046539 Ga0495621_0098502 Ga0495621_0098502_548_1084 178
314 3300046539 Ga0495621_0251606 Ga0495621_0251606_134_673 178
315 3300046616 Ga0495668_0053362 Ga0495668_0053362_1570_2118 178
316 3300046616 Ga0495668_0103917 Ga0495668_0103917_486_1022 178
317 3300046616 Ga0495668_0171092 Ga0495668_0171092_339_875 178
318 3300046648 Ga0495611_0006005 Ga0495611_0006005_1995_2531 178
319 3300046664 Ga0495659_0103147 Ga0495659_0103147_492_1073 178
320 3300046689 Ga0495613_0011884 Ga0495613_0011884_3039_3575 178
321 3300047320 Ga0495672_0327448 Ga0495672_0327448_147_683 178
322 3300047445 Ga0495677_0011667 Ga0495677_0011667_1544_2080 178
323 3300047445 Ga0495677_0055895 Ga0495677_0055895_794_1351 178
324 3300047470 Ga0495681_0033094 Ga0495681_0033094_703_1239 178
325 3300048905 Ga0496102_0054501 Ga0496102_0054501_1784_2320 178
326 3300048909 Ga0496106_0041910 Ga0496106_0041910_168_704 178
327 3300048909 Ga0496106_0703726 Ga0496106_0703726_97_633 178
328 3300048910 Ga0496107_0132675 Ga0496107_0132675_980_1516 178
329 3300048912 Ga0496109_0029376 Ga0496109_0029376_2745_3281 178
330 3300048914 Ga0496111_0264793 Ga0496111_0264793_630_1166 178
331 3300048915 Ga0496112_0036312 Ga0496112_0036312_2813_3349 178
332 3300048916 Ga0496113_0077103 Ga0496113_0077103_289_825 178
333 3300049570 Ga0501033_0146082 Ga0501033_0146082_1107_1643 178
334 3300049581 Ga0501047_0064602 Ga0501047_0064602_444_980 178
335 3300049581 Ga0501047_0209128 Ga0501047_0209128_52_588 178
336 3300049581 Ga0501047_0440250 Ga0501047_0440250_449_1003 178
337 3300049581 Ga0501047_0692586 Ga0501047_0692586_262_804 178
338 3300049582 Ga0501048_0169527 Ga0501048_0169527_614_1153 178
339 3300049742 Ga0501080_1017234 Ga0501080_1017234_170_706 178
340 3300049822 Ga0501035_0087130 Ga0501035_0087130_1248_1784 178
341 3300049823 Ga0501044_0011306 Ga0501044_0011306_5890_6426 178
342 3300049823 Ga0501044_1131557 Ga0501044_1131557_50_586 178
343 3300050496 nmdc:mga07m45_207751_c1 nmdc:mga07m45_207751_c1_578_1114 178
344 3300053091 Ga0500647_0005072 Ga0500647_0005072_2588_3124 178
345 3300053108 Ga0500562_008934 Ga0500562_008934_1256_1792 178
346 3300053111 Ga0500572_000396 Ga0500572_000396_10840_11376 178
347 3300053120 Ga0500597_029059 Ga0500597_029059_1216_1752 178
348 3300053122 Ga0500608_204979 Ga0500608_204979_207_749 178
349 3300053123 Ga0500614_029752 Ga0500614_029752_669_1205 178
350 3300053136 Ga0500559_0000016 Ga0500559_0000016_142691_143227 178
351 3300053148 Ga0500590_125225 Ga0500590_125225_283_819 178
352 3300053177 Ga0500636_0023240 Ga0500636_0023240_1538_2074 178
353 3300053733 Ga0500552_010955 Ga0500552_010955_308_844 178

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

95

175

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1knc-assembly1.cif.gz_A structure of ahpd from mycobacterium tuberculosis, a novel enzyme with thioredoxin-like activity. 0.9798 2 176
1me5-assembly1.cif.gz_C crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd h132q mutant 0.9759 4 172
1lw1-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd h137f mutant 0.975 4 178
1me5-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd h132q mutant 0.9707 4 176
1knc-assembly1.cif.gz_A structure of ahpd from mycobacterium tuberculosis, a novel enzyme with thioredoxin-like activity. 0.9688 2 176
ID Description Score Start End Superfamily
1gu9D00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9782 5 176 1.20.1290.10
1gu9D00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9613 5 176 1.20.1290.10
1vkeF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9593 114 164 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7496 12 168 1.20.1290.10
3beyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7363 4 92 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A1D2TU50-F1-model_v4 Alkyl hydroperoxide reductase AhpD (EC 1.11.1.28) (Alkylhydroperoxidase AhpD) 1 1 178 GO:0006979
GO:0008785
GO:0015036
GO:0032843
GO:0045454
GO:0051920
AF-A0A2G4K8B4-F1-model_v4 Alkyl hydroperoxide reductase AhpD (EC 1.11.1.28) (Alkylhydroperoxidase AhpD) 0.9983 1 176 GO:0006979
GO:0008785
GO:0015036
GO:0032843
GO:0045454
GO:0051920
AF-Q0AKM4-F1-model_v4 Alkyl hydroperoxide reductase AhpD (EC 1.11.1.28) (Alkylhydroperoxidase AhpD) 0.9932 1 173 GO:0006979
GO:0008785
GO:0015036
GO:0032843
GO:0045454
GO:0051920
AF-B8ITH2-F1-model_v4 Alkyl hydroperoxide reductase AhpD (EC 1.11.1.28) (Alkylhydroperoxidase AhpD) 0.9924 64 133 GO:0006979
GO:0008785
GO:0032843
GO:0051920
AF-A0A1C3XK10-F1-model_v4 Alkyl hydroperoxide reductase AhpD (EC 1.11.1.28) (Alkylhydroperoxidase AhpD) 0.9921 64 173 GO:0006979
GO:0008785
GO:0015036
GO:0032843
GO:0045454
GO:0051920

Feature Viewer

pLDDT pTM Quality
96.92 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map