F419601

General Info

Members Datasets Scaffolds Average Seq Length
354 298 708 327

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1000661|JGI25162J39368_10006618
Length 338
Sequence MTSVRILTETDLRKLVGLDGDTVDCVEQAFAALATQAVEMPPIMRLDIPAHRGEVDVKSAYVPGLDSFAIKVSPGFFNNPSLGLASTNGLMLLLSAHTGLVEALLLDNGYLTDVRTAAAGAVAARHLARPDARVAAIMGAGMQARLQLHALTLVRPIEAARIWARDLTKAEKLALELTAELGFPVTAHADAEDACRGADIIVTTTPSAEPIVDAAWLEPGQHITAMGSDAEHKNEIDPAAIVNASLYVADSLKQTRRLGELHHAISTGLVSEMADFPELGAIVSGKATGRRSYEAITLCDLTGTGVQDTAIARLAYRRAASAGVGQVIETTRASGEPA

Samples

Sample ID Description Type Environment
1 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
29 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
34 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
35 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
36 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
37 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
38 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
39 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
40 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
41 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
42 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
55 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
56 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
59 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
60 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
61 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
62 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
63 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
64 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
65 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
66 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
67 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
70 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
75 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
76 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
77 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
78 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
79 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
80 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
81 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
82 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
83 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
84 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
85 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
86 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
87 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
88 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
89 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
90 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
91 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
92 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
93 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
94 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
97 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
98 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
99 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
100 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
101 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
102 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
103 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
116 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
117 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
118 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
121 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
122 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
123 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
124 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
125 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
126 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
127 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
128 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
129 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
130 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
131 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
132 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
133 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
134 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
135 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
136 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
137 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
138 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
139 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
140 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
141 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
142 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
143 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
144 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
145 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
146 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
147 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
148 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
149 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
150 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
151 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
152 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
153 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
154 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
155 2643221582 Rhizobium sp. Root651 Isolate Unclassified
156 2643221618 Ensifer sp. Root231 Isolate Unclassified
157 2643221655 Ensifer sp. Root1252 Isolate Unclassified
158 2643221693 Rhizobium sp. Root491 Isolate Unclassified
159 2643221712 Ensifer sp. Root258 Isolate Unclassified
160 2718217882 Rhizobium sp. N741 Isolate Nodule
161 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
162 2718218009 Rhizobium sp. N561 Isolate Nodule
163 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
164 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
165 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
166 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
167 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
168 2718218363 Rhizobium sp. N113 Isolate Nodule
169 2718218365 Rhizobium sp. N731 Isolate Nodule
170 2718218366 Rhizobium sp. N621 Isolate Nodule
171 2721755514 Rhizobium sp. N6212 Isolate Nodule
172 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
173 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
174 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
175 2721755810 Rhizobium sp. N871 Isolate Nodule
176 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
177 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
178 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
179 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
180 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
181 2728369365 Rhizobium sp. N1341 Isolate Nodule
182 2728369397 Rhizobium sp. N1314 Isolate Nodule
183 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
184 2751185800 Brucella pituitosa AA2 Isolate Unclassified
185 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
186 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
187 2791355256 Rhizobium sp. M10 Isolate Nodule
188 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
189 2791355262 Rhizobium sp. M1 Isolate Nodule
190 2791355264 Rhizobium sp. S9 Isolate Nodule
191 2791355265 Rhizobium sp. H4 Isolate Nodule
192 2791355266 Rhizobium sp. L43 Isolate Nodule
193 2791355267 Rhizobium sp. L18 Isolate Nodule
194 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
195 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
196 2802429633 Rhizobium anhuiense J3 Isolate Nodule
197 2802429634 Rhizobium anhuiense S10 Isolate Nodule
198 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
199 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
200 2802429637 Rhizobium anhuiense C15 Isolate Nodule
201 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
202 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
203 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
204 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
205 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
206 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
207 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
208 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
209 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
210 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
211 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
212 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
213 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
214 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
215 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
216 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
217 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
218 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
219 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
220 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
221 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
222 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
223 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
224 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
225 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
226 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
227 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
228 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
229 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
230 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
231 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
232 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
233 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
234 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
235 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
236 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
237 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
238 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
239 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
240 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
241 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
242 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
243 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
244 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
245 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
246 2854911287 Brucella lupini LUP21 Isolate Unclassified
247 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
248 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
249 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
250 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
251 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
252 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
253 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
254 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
255 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
256 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
257 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
258 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
259 2933599457 Rhizobium phaseoli M3 Isolate Nodule
260 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
261 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
262 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
263 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
264 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
265 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
266 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
267 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
268 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
269 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
270 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
271 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
272 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
273 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
274 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
275 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
276 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
277 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
278 8005382845 Rhizobium sp. R634 Isolate Nodule
279 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
280 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
281 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
282 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
283 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
284 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
285 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
286 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
287 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
288 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
289 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
290 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
291 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
292 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
293 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
294 8024501048 Rhizobium sp. H4 Isolate Nodule
295 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
296 8056382006 Rhizobium croatiense 13T Isolate Nodule
297 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
298 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 51.13
Metatranscriptomes 0
Isolates 48.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.75
Nodule 34.75
Rhizoplane 0.56
Rhizosphere 24.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000661 3300002737 Bacteria 24376
2 JGI25155J39150_1000043 3300002704 Bacteria 87185
3 JGI25156J39149_1000056 3300002705 Bacteria 87185
4 JGI25154J39366_1000086 3300002738 Bacteria 87185
5 JGI25158J39367_1000174 3300002739 Bacteria 15148
6 JGI25157J39369_1000086 3300002741 Bacteria 81114
7 JGI25152J39213_1000943 3300002773 Bacteria 14268
8 JGI25159J45721_1000461 3300002987 Bacteria 18823
9 JGI25151J46595_10002908 3300003187 Bacteria 9814
10 JGI25165J46597_1000604 3300003214 Bacteria 30711
11 rootL2_10020236 3300003322 Bacteria 23229
12 rootH1_10057386 3300003323 Bacteria 1258
13 JGI25160J50197_1000248 3300003354 Bacteria 41777
14 JGI25160J50197_1004640 3300003354 Bacteria 5897
15 JGI25161J50226_1000183 3300003374 Bacteria 41777
16 JGI25161J50226_1002195 3300003374 Bacteria 5193
17 Ga0055526_1002351 3300003771 Bacteria 12849
18 Ga0055526_1004568 3300003771 Bacteria 8260
19 Ga0055524_1005074 3300003775 Bacteria 5955
20 Ga0055528_1000266 3300003790 Bacteria 44336
21 Ga0055528_1000982 3300003790 Bacteria 18925
22 Ga0055528_1010913 3300003790 Bacteria 3650
23 Ga0055528_1026329 3300003790 Bacteria 1675
24 Ga0055540_1000096 3300003792 Bacteria 96969
25 Ga0055540_1007666 3300003792 Bacteria 4025
26 Ga0055540_1008931 3300003792 Bacteria 3538
27 Ga0058692_1003270 3300003856 Bacteria 5066
28 Ga0055543_1000036 3300004625 Bacteria 126054
29 Ga0055543_1000245 3300004625 Bacteria 41815
30 Ga0055543_1008031 3300004625 Bacteria 2370
31 Ga0065165_1001012 3300005262 Bacteria 34230
32 Ga0065165_1014439 3300005262 Bacteria 3065
33 Ga0070671_100093290 3300005355 Bacteria 2523
34 Ga0075362_10000396 3300006177 Bacteria 12548
35 Ga0075362_10002642 3300006177 Bacteria 6081
36 Ga0075367_10009169 3300006178 Bacteria 5160
37 Ga0075369_10003478 3300006186 Bacteria 5735
38 Ga0075369_10070741 3300006186 Bacteria 1535
39 Ga0075366_10001529 3300006195 Bacteria 11567
40 Ga0114129_10191383 3300009147 Bacteria 2777
41 Ga0123341_1002056 3300009765 Bacteria 16111
42 Ga0123342_1017752 3300009766 Bacteria 5845
43 Ga0105239_10116038 3300010375 Bacteria 2971
44 Ga0157371_10000005 3300013102 Bacteria 416456
45 Ga0157370_10002453 3300013104 Bacteria 22378
46 Ga0214544_1013786 3300021320 Bacteria 9544
47 Ga0209435_100039 3300025206 Bacteria 116879
48 Ga0209436_100253 3300025208 Bacteria 24609
49 Ga0209437_100330 3300025233 Bacteria 59093
50 Ga0209646_1000137 3300025246 Bacteria 116791
51 Ga0209026_1000135 3300025250 Bacteria 117001
52 Ga0209759_1000154 3300025256 Bacteria 119427
53 Ga0209129_1000082 3300025258 Bacteria 183436
54 Ga0209129_1002275 3300025258 Bacteria 9588
55 Ga0209129_1002804 3300025258 Bacteria 8099
56 Ga0209129_1023153 3300025258 Bacteria 1112
57 Ga0209233_1000304 3300025261 Bacteria 59093
58 Ga0209673_1000005 3300025273 Bacteria 692788
59 Ga0209673_1000105 3300025273 Bacteria 186267
60 Ga0209673_1000452 3300025273 Bacteria 69726
61 Ga0209673_1018335 3300025273 Bacteria 2549
62 Ga0209130_1000022 3300025284 Bacteria 361244
63 Ga0209130_1000098 3300025284 Bacteria 142506
64 Ga0209675_1014396 3300025291 Bacteria 2411
65 Ga0209025_1000172 3300025294 Bacteria 160407
66 Ga0209025_1003180 3300025294 Bacteria 15933
67 Ga0209564_1000913 3300025295 Bacteria 38633
68 Ga0209564_1001253 3300025295 Bacteria 28159
69 Ga0209564_1006641 3300025295 Bacteria 6178
70 Ga0209758_1000380 3300025297 Bacteria 77252
71 Ga0209758_1007637 3300025297 Bacteria 7292
72 Ga0209758_1011169 3300025297 Bacteria 5241
73 Ga0209050_1003406 3300025298 Bacteria 11784
74 Ga0209256_1000281 3300025299 Bacteria 89636
75 Ga0209256_1000688 3300025299 Bacteria 45274
76 Ga0209256_1001129 3300025299 Bacteria 30423
77 Ga0209256_1007249 3300025299 Bacteria 5536
78 Ga0207426_1000005 3300025302 Bacteria 1037188
79 Ga0207426_1000069 3300025302 Bacteria 334513
80 Ga0207426_1000350 3300025302 Bacteria 84510
81 Ga0209051_1000027 3300025303 Bacteria 412172
82 Ga0209051_1001030 3300025303 Bacteria 26476
83 Ga0209257_1001771 3300025304 Bacteria 23907
84 Ga0209257_1009039 3300025304 Bacteria 5458
85 Ga0207702_10095101 3300026078 Bacteria 2617
86 Ga0209371_1001420 3300027312 Bacteria 16321
87 Ga0209371_1002392 3300027312 Bacteria 10593
88 Ga0268256_1000478 3300030500 Bacteria 34415
89 Ga0307405_10003864 3300031731 Bacteria 6982
90 Ga0307405_10158512 3300031731 Bacteria 1600
91 Ga0307409_100427370 3300031995 Bacteria 1272
92 Ga0395905_0627101 3300037471 Bacteria 977
93 Ga0439465_0005562 3300041413 Bacteria 4016
94 Ga0439465_0042685 3300041413 Bacteria 1470
95 Ga0439465_0074720 3300041413 Bacteria 1140
96 Ga0451833_0158004 3300041491 Bacteria 3670
97 Ga0451837_0907937 3300041494 Bacteria 1427
98 Ga0451845_0536694 3300041501 Bacteria 4593
99 Ga0451847_0808972 3300041503 Bacteria 1869
100 Ga0451843_1155251 3300041509 Bacteria 995
101 Ga0451853_3257089 3300041512 Bacteria 1709
102 Ga0466969_0049562 3300044656 Bacteria 2072
103 Ga0466966_0025375 3300044684 Bacteria 3872
104 Ga0466963_0000526 3300044694 Bacteria 17929
105 Ga0466970_0000549 3300044765 Bacteria 18375
106 Ga0466957_0003532 3300044842 Bacteria 8605
107 Ga0466959_0051236 3300045049 Bacteria 3029
108 Ga0466958_0022798 3300045836 Bacteria 3670
109 Ga0466967_0007975 3300045976 Bacteria 7706
110 Ga0495617_014738 3300046452 Bacteria 2655
111 Ga0495638_0215439 3300046460 Bacteria 1076
112 Ga0495607_0026357 3300046501 Bacteria 3606
113 Ga0495583_0025787 3300046506 Bacteria 2930
114 Ga0495610_0006123 3300046512 Bacteria 8384
115 Ga0495610_0024033 3300046512 Bacteria 3296
116 Ga0495616_0010680 3300046513 Bacteria 5304
117 Ga0495620_0051716 3300046515 Bacteria 1747
118 Ga0495637_0004068 3300046520 Bacteria 7635
119 Ga0495643_0020523 3300046522 Bacteria 3808
120 Ga0495643_0060245 3300046522 Bacteria 2015
121 Ga0495597_0040892 3300046542 Bacteria 2072
122 Ga0495622_0006938 3300046557 Bacteria 5258
123 Ga0495633_0114132 3300046558 Bacteria 1252
124 Ga0495625_0004199 3300046660 Bacteria 13726
125 Ga0495625_0083609 3300046660 Bacteria 2218
126 Ga0495625_0149712 3300046660 Bacteria 1569
127 Ga0495588_0022081 3300046674 Bacteria 3143
128 Ga0495649_0041228 3300046694 Bacteria 2526
129 Ga0495660_0024572 3300046810 Bacteria 3431
130 Ga0495636_0139184 3300047318 Bacteria 1083
131 Ga0495687_005742 3300047443 Bacteria 7801
132 Ga0495679_010372 3300047446 Bacteria 3660
133 Ga0495673_0040295 3300047469 Bacteria 2112
134 Ga0495681_0002860 3300047470 Bacteria 12195
135 Ga0496112_0009464 3300048915 Bacteria 8782
136 Ga0496116_0039796 3300048919 Bacteria 3245
137 Ga0496117_0000489 3300048920 Bacteria 65533
138 Ga0496118_0011436 3300048921 Bacteria 8664
139 Ga0496118_0208644 3300048921 Bacteria 1149
140 Ga0496121_0033567 3300048924 Bacteria 4640
141 Ga0496121_0067294 3300048924 Bacteria 2904
142 Ga0496121_0074239 3300048924 Bacteria 2721
143 Ga0496121_0104297 3300048924 Bacteria 2179
144 Ga0496122_0004845 3300048925 Bacteria 16391
145 Ga0496122_0005943 3300048925 Bacteria 14286
146 Ga0496122_0006544 3300048925 Bacteria 13325
147 Ga0496123_0002585 3300048926 Bacteria 22022
148 Ga0496123_0008836 3300048926 Bacteria 9181
149 Ga0496124_0009989 3300048927 Bacteria 9692
150 Ga0496124_0015244 3300048927 Bacteria 7377
151 Ga0496124_0189737 3300048927 Bacteria 1574
152 Ga0496125_0000083 3300048928 Bacteria 227168
153 Ga0496125_0080068 3300048928 Bacteria 2501
154 Ga0496126_0068927 3300048929 Bacteria 3156
155 Ga0496126_0165152 3300048929 Bacteria 1890
156 Ga0496126_0317875 3300048929 Bacteria 1280
157 Ga0495682_0014930 3300049460 Bacteria 2943
158 Ga0501032_0253990 3300049569 Bacteria 1141
159 Ga0501033_0022199 3300049570 Bacteria 4789
160 Ga0501043_0149785 3300049579 Bacteria 1826
161 Ga0501047_0173353 3300049581 Bacteria 2026
162 Ga0501047_0334830 3300049581 Bacteria 1352
163 Ga0501069_0060769 3300049585 Bacteria 2110
164 Ga0501073_0042329 3300049589 Bacteria 3215
165 Ga0501074_0230008 3300049590 Bacteria 1320
166 Ga0501035_0129659 3300049822 Bacteria 2199
167 Ga0501044_0075423 3300049823 Bacteria 3424
168 Ga0501044_0325598 3300049823 Bacteria 1460
169 nmdc:mga00v17_22_c1 3300050491 Bacteria 108510
170 nmdc:mga00v17_83727_c1 3300050491 Bacteria 1995
171 nmdc:mga0yw44_2227_c1 3300050492 Bacteria 8173
172 nmdc:mga0k408_162568_c1 3300050493 Bacteria 1330
173 nmdc:mga07m45_75074_c1 3300050496 Bacteria 1926
174 nmdc:mga05p37_243228_c1 3300050507 Bacteria 2162
175 nmdc:mga0sz30_925_c1 3300050516 Bacteria 10574
176 Ga0500569_009805 3300053109 Bacteria 2235
177 Ga0500618_000638 3300053125 Bacteria 21126
178 Ga0500658_0000932 3300053134 Bacteria 11919
179 Ga0500658_0130226 3300053134 Bacteria 1121
180 Ga0500659_0141151 3300053135 Bacteria 1209
181 Ga0500616_0028484 3300053153 Bacteria 3077
182 2509390742 2509276021 Bacteria 7634384
183 2509442045 2509276033 Bacteria 7180565
184 2510136350 2510065019 Bacteria 6903379
185 2510892634 2510461076 Bacteria 8618824
186 2513630491 2513237093 Bacteria 7545552
187 2513711253 2513237103 Bacteria 7647401
188 2514018493 2513237162 Bacteria 7468464
189 2515108705 2515075009 Bacteria 7288508
190 2515632569 2515154113 Bacteria 7807172
191 2515656580 2515154116 Bacteria 7552979
192 2515738188 2515154134 Bacteria 7220242
193 2517040638 2516653077 Bacteria 7555578
194 2517098267 2517093000 Bacteria 7412387
195 2524457360 2524023209 Bacteria 6679728
196 2530648913 2529292951 Bacteria 6916614
197 2537874903 2537561587 Bacteria 5425293
198 2554244235 2554235003 Bacteria 5877155
199 2559297933 2558860242 Bacteria 5568029
200 2585328709 2582581315 Bacteria 7318924
201 2585335606 2582581316 Bacteria 7774528
202 2585530005 2585427526 Bacteria 7258840
203 2585543460 2585427528 Bacteria 6842387
204 2585841924 2585427593 Bacteria 7141551
205 2585899977 2585427608 Bacteria 6544331
206 2585993714 2585427633 Bacteria 6413184
207 2586004563 2585427634 Bacteria 6455027
208 2599603953 2599185210 Bacteria 5624189
209 2616297841 2615840624 Bacteria 6557588
210 2616555706 2615840698 Bacteria 7319877
211 2643917898 2643221582 Bacteria 5804683
212 2644107106 2643221618 Bacteria 7717186
213 2644311411 2643221655 Bacteria 7722067
214 2644522437 2643221693 Bacteria 5513853
215 2644617086 2643221712 Bacteria 7729434
216 2719184676 2718217882 Bacteria 6556348
217 2719668669 2718217997 Bacteria 6740740
218 2719728696 2718218009 Bacteria 6478651
219 2720489362 2718218199 Bacteria 6740745
220 2720610036 2718218232 Bacteria 6720332
221 2720617460 2718218233 Bacteria 6662049
222 2720628606 2718218235 Bacteria 6630699
223 2720772556 2718218269 Bacteria 6906114
224 2721144387 2718218363 Bacteria 6524337
225 2721156340 2718218365 Bacteria 6274507
226 2721161757 2718218366 Bacteria 6425255
227 2722842902 2721755514 Bacteria 6424414
228 2723029995 2721755556 Bacteria 6745503
229 2723564400 2721755684 Bacteria 6859907
230 2723569959 2721755685 Bacteria 6704835
231 2724041721 2721755810 Bacteria 6479005
232 2724092585 2721755819 Bacteria 6906405
233 2724101506 2721755822 Bacteria 6726041
234 2724112968 2721755823 Bacteria 6752556
235 2725949614 2724679232 Bacteria 7646494
236 2730110528 2728369352 Bacteria 6745171
237 2730160791 2728369365 Bacteria 6555560
238 2730295873 2728369397 Bacteria 6274511
239 2739035363 2738541333 Bacteria 7106503
240 2753357884 2751185800 Bacteria 5467370
241 2758640493 2758568016 Bacteria 5645291
242 2766069106 2765235942 Bacteria 7445910
243 2793297827 2791355256 Bacteria 6798008
244 2793312619 2791355259 Bacteria 7254731
245 2793337557 2791355262 Bacteria 6774204
246 2793345566 2791355264 Bacteria 6429314
247 2793354974 2791355265 Bacteria 6539969
248 2793363714 2791355266 Bacteria 7116587
249 2793370350 2791355267 Bacteria 7222458
250 2805927235 2802429605 Bacteria 6875453
251 2805934337 2802429606 Bacteria 6346811
252 2806048285 2802429633 Bacteria 7341974
253 2806056070 2802429634 Bacteria 7083200
254 2806062887 2802429635 Bacteria 7650140
255 2806070491 2802429636 Bacteria 7597525
256 2806077401 2802429637 Bacteria 7067217
257 2808989735 2808606387 Bacteria 5697198
258 2819610981 2818991448 Bacteria 6772224
259 2819642533 2818991453 Bacteria 7181617
260 2834578493 2834578030 Bacteria 3530182
261 2838025311 2838022645 Bacteria 6494267
262 2838031645 2838029111 Bacteria 6603031
263 2838068664 2838068647 Bacteria 6208656
264 2838078445 2838074704 Bacteria 6785777
265 2838669450 2838668709 Bacteria 6671819
266 2838701821 2838701080 Bacteria 6669771
267 2839995533 2839993093 Bacteria 5512535
268 2840770465 2840764183 Bacteria 6358399
269 2841860958 2841859092 Bacteria 5436171
270 2841865944 2841864319 Bacteria 6742987
271 2842164135 2842163707 Bacteria 6916235
272 2842196090 2842192696 Bacteria 6147454
273 2842200877 2842198810 Bacteria 6608673
274 2842209741 2842205361 Bacteria 6340321
275 2842219901 2842217011 Bacteria 7497767
276 2842251755 2842250916 Bacteria 6579627
277 2842264995 2842264693 Bacteria 6472963
278 2842283195 2842278818 Bacteria 6340002
279 2842299084 2842298080 Bacteria 6123127
280 2842320155 2842317721 Bacteria 6793725
281 2842347691 2842341865 Bacteria 7003929
282 2842358550 2842357229 Bacteria 6485165
283 2842364190 2842363717 Bacteria 6844742
284 2842397196 2842395702 Bacteria 6780583
285 2842405775 2842402390 Bacteria 6681310
286 2842412358 2842409023 Bacteria 6687331
287 2842419004 2842415677 Bacteria 6596907
288 2842422810 2842422224 Bacteria 6239196
289 2842428951 2842428310 Bacteria 6767288
290 2842435565 2842434925 Bacteria 6502746
291 2842441573 2842441272 Bacteria 6769273
292 2842463376 2842462802 Bacteria 6588055
293 2842469895 2842469257 Bacteria 6752936
294 2842478377 2842475841 Bacteria 6603183
295 2842489731 2842489311 Bacteria 6620893
296 2842498225 2842495871 Bacteria 6820686
297 2842505677 2842502639 Bacteria 6604161
298 2842511945 2842509118 Bacteria 6850950
299 2842518775 2842515876 Bacteria 5436280
300 2852395007 2852387548 Bacteria 8025568
301 2854900097 2854896431 Bacteria 5869725
302 2854913501 2854911287 Bacteria 5582813
303 2854917252 2854916844 Bacteria 5725939
304 2889794029 2889790730 Bacteria 5689708
305 2889915720 2889914905 Bacteria 5702301
306 2894239427 2894232714 Bacteria 8834183
307 2899260161 2899259804 Bacteria 3320927
308 2899793421 2899792073 Bacteria 4926588
309 2899848300 2899845264 Bacteria 5672268
310 2915652350 2915650412 Bacteria 4288180
311 2926757525 2926754445 Bacteria 5964435
312 2926764889 2926760298 Bacteria 5505990
313 2933014401 2933011516 Bacteria 5439334
314 2933597007 2933594066 Bacteria 5594265
315 2933600282 2933599457 Bacteria 5858799
316 2935903236 2935901341 Bacteria 7341747
317 2936374461 2936367885 Bacteria 7324495
318 2937845857 2937843397 Bacteria 5256375
319 2954015526 2954011201 Bacteria 4762601
320 2961173102 2961170736 Bacteria 7072258
321 2970505696 2970503327 Bacteria 7099517
322 2979810417 2979808191 Bacteria 7179355
323 2996312232 2996310559 Bacteria 6357320
324 3005422338 3005416602 Bacteria 7064308
325 639644825 639633055 Bacteria 7751309
326 650842340 650716007 Bacteria 5573770
327 8003573540 8003570095 Bacteria 5747666
328 8005288502 8005282627 Bacteria 6675747
329 8005290494 8005289223 Bacteria 6634003
330 8005301087 8005301065 Bacteria 6614431
331 8005308005 8005307578 Bacteria 7395396
332 8005320325 8005314921 Bacteria 7072929
333 8005379734 8005376324 Bacteria 6590079
334 8005383503 8005382845 Bacteria 6732062
335 8005431420 8005430974 Bacteria 6689030
336 8005467121 8005460587 Bacteria 7157962
337 8005488051 8005484373 Bacteria 6297373
338 8005502909 8005497431 Bacteria 6477605
339 8005571599 8005570704 Bacteria 6957481
340 8005624060 8005619151 Bacteria 7030230
341 8005629325 8005626139 Bacteria 6534237
342 8005651627 8005645114 Bacteria 6950293
343 8005674339 8005668836 Bacteria 6953162
344 8005685939 8005682033 Bacteria 6726518
345 8005689099 8005688590 Bacteria 6610080
346 8005697824 8005695170 Bacteria 6912330
347 8018132112 8018127388 Bacteria 7351159
348 8023681830 8023680758 Bacteria 7729763
349 8024482330 8024479707 Bacteria 6954785
350 8024507258 8024501048 Bacteria 6427847
351 8056377875 8056375014 Bacteria 7006639
352 8056382541 8056382006 Bacteria 6408074
353 8057576273 8057575449 Bacteria 7367519
354 8057878173 8057874678 Bacteria 7494653
355 JGI25162J39368_1000661
356 JGI25155J39150_1000043
357 JGI25156J39149_1000056
358 JGI25154J39366_1000086
359 JGI25158J39367_1000174
360 JGI25157J39369_1000086
361 JGI25152J39213_1000943
362 JGI25159J45721_1000461
363 JGI25151J46595_10002908
364 JGI25165J46597_1000604
365 rootL2_10020236
366 rootH1_10057386
367 JGI25160J50197_1000248
368 JGI25160J50197_1004640
369 JGI25161J50226_1000183
370 JGI25161J50226_1002195
371 Ga0055526_1002351
372 Ga0055526_1004568
373 Ga0055524_1005074
374 Ga0055528_1000266
375 Ga0055528_1000982
376 Ga0055528_1010913
377 Ga0055528_1026329
378 Ga0055540_1000096
379 Ga0055540_1007666
380 Ga0055540_1008931
381 Ga0058692_1003270
382 Ga0055543_1000036
383 Ga0055543_1000245
384 Ga0055543_1008031
385 Ga0065165_1001012
386 Ga0065165_1014439
387 Ga0070671_100093290
388 Ga0075362_10000396
389 Ga0075362_10002642
390 Ga0075367_10009169
391 Ga0075369_10003478
392 Ga0075369_10070741
393 Ga0075366_10001529
394 Ga0114129_10191383
395 Ga0123341_1002056
396 Ga0123342_1017752
397 Ga0105239_10116038
398 Ga0157371_10000005
399 Ga0157370_10002453
400 Ga0214544_1013786
401 Ga0209435_100039
402 Ga0209436_100253
403 Ga0209437_100330
404 Ga0209646_1000137
405 Ga0209026_1000135
406 Ga0209759_1000154
407 Ga0209129_1000082
408 Ga0209129_1002275
409 Ga0209129_1002804
410 Ga0209129_1023153
411 Ga0209233_1000304
412 Ga0209673_1000005
413 Ga0209673_1000105
414 Ga0209673_1000452
415 Ga0209673_1018335
416 Ga0209130_1000022
417 Ga0209130_1000098
418 Ga0209675_1014396
419 Ga0209025_1000172
420 Ga0209025_1003180
421 Ga0209564_1000913
422 Ga0209564_1001253
423 Ga0209564_1006641
424 Ga0209758_1000380
425 Ga0209758_1007637
426 Ga0209758_1011169
427 Ga0209050_1003406
428 Ga0209256_1000281
429 Ga0209256_1000688
430 Ga0209256_1001129
431 Ga0209256_1007249
432 Ga0207426_1000005
433 Ga0207426_1000069
434 Ga0207426_1000350
435 Ga0209051_1000027
436 Ga0209051_1001030
437 Ga0209257_1001771
438 Ga0209257_1009039
439 Ga0207702_10095101
440 Ga0209371_1001420
441 Ga0209371_1002392
442 Ga0268256_1000478
443 Ga0307405_10003864
444 Ga0307405_10158512
445 Ga0307409_100427370
446 Ga0395905_0627101
447 Ga0439465_0005562
448 Ga0439465_0042685
449 Ga0439465_0074720
450 Ga0451833_0158004
451 Ga0451837_0907937
452 Ga0451845_0536694
453 Ga0451847_0808972
454 Ga0451843_1155251
455 Ga0451853_3257089
456 Ga0466969_0049562
457 Ga0466966_0025375
458 Ga0466963_0000526
459 Ga0466970_0000549
460 Ga0466957_0003532
461 Ga0466959_0051236
462 Ga0466958_0022798
463 Ga0466967_0007975
464 Ga0495617_014738
465 Ga0495638_0215439
466 Ga0495607_0026357
467 Ga0495583_0025787
468 Ga0495610_0006123
469 Ga0495610_0024033
470 Ga0495616_0010680
471 Ga0495620_0051716
472 Ga0495637_0004068
473 Ga0495643_0020523
474 Ga0495643_0060245
475 Ga0495597_0040892
476 Ga0495622_0006938
477 Ga0495633_0114132
478 Ga0495625_0004199
479 Ga0495625_0083609
480 Ga0495625_0149712
481 Ga0495588_0022081
482 Ga0495649_0041228
483 Ga0495660_0024572
484 Ga0495636_0139184
485 Ga0495687_005742
486 Ga0495679_010372
487 Ga0495673_0040295
488 Ga0495681_0002860
489 Ga0496112_0009464
490 Ga0496116_0039796
491 Ga0496117_0000489
492 Ga0496118_0011436
493 Ga0496118_0208644
494 Ga0496121_0033567
495 Ga0496121_0067294
496 Ga0496121_0074239
497 Ga0496121_0104297
498 Ga0496122_0004845
499 Ga0496122_0005943
500 Ga0496122_0006544
501 Ga0496123_0002585
502 Ga0496123_0008836
503 Ga0496124_0009989
504 Ga0496124_0015244
505 Ga0496124_0189737
506 Ga0496125_0000083
507 Ga0496125_0080068
508 Ga0496126_0068927
509 Ga0496126_0165152
510 Ga0496126_0317875
511 Ga0495682_0014930
512 Ga0501032_0253990
513 Ga0501033_0022199
514 Ga0501043_0149785
515 Ga0501047_0173353
516 Ga0501047_0334830
517 Ga0501069_0060769
518 Ga0501073_0042329
519 Ga0501074_0230008
520 Ga0501035_0129659
521 Ga0501044_0075423
522 Ga0501044_0325598
523 nmdc:mga00v17_22_c1
524 nmdc:mga00v17_83727_c1
525 nmdc:mga0yw44_2227_c1
526 nmdc:mga0k408_162568_c1
527 nmdc:mga07m45_75074_c1
528 nmdc:mga05p37_243228_c1
529 nmdc:mga0sz30_925_c1
530 Ga0500569_009805
531 Ga0500618_000638
532 Ga0500658_0000932
533 Ga0500658_0130226
534 Ga0500659_0141151
535 Ga0500616_0028484
536 2509390742
537 2509442045
538 2510136350
539 2510892634
540 2513630491
541 2513711253
542 2514018493
543 2515108705
544 2515632569
545 2515656580
546 2515738188
547 2517040638
548 2517098267
549 2524457360
550 2530648913
551 2537874903
552 2554244235
553 2559297933
554 2585328709
555 2585335606
556 2585530005
557 2585543460
558 2585841924
559 2585899977
560 2585993714
561 2586004563
562 2599603953
563 2616297841
564 2616555706
565 2643917898
566 2644107106
567 2644311411
568 2644522437
569 2644617086
570 2719184676
571 2719668669
572 2719728696
573 2720489362
574 2720610036
575 2720617460
576 2720628606
577 2720772556
578 2721144387
579 2721156340
580 2721161757
581 2722842902
582 2723029995
583 2723564400
584 2723569959
585 2724041721
586 2724092585
587 2724101506
588 2724112968
589 2725949614
590 2730110528
591 2730160791
592 2730295873
593 2739035363
594 2753357884
595 2758640493
596 2766069106
597 2793297827
598 2793312619
599 2793337557
600 2793345566
601 2793354974
602 2793363714
603 2793370350
604 2805927235
605 2805934337
606 2806048285
607 2806056070
608 2806062887
609 2806070491
610 2806077401
611 2808989735
612 2819610981
613 2819642533
614 2834578493
615 2838025311
616 2838031645
617 2838068664
618 2838078445
619 2838669450
620 2838701821
621 2839995533
622 2840770465
623 2841860958
624 2841865944
625 2842164135
626 2842196090
627 2842200877
628 2842209741
629 2842219901
630 2842251755
631 2842264995
632 2842283195
633 2842299084
634 2842320155
635 2842347691
636 2842358550
637 2842364190
638 2842397196
639 2842405775
640 2842412358
641 2842419004
642 2842422810
643 2842428951
644 2842435565
645 2842441573
646 2842463376
647 2842469895
648 2842478377
649 2842489731
650 2842498225
651 2842505677
652 2842511945
653 2842518775
654 2852395007
655 2854900097
656 2854913501
657 2854917252
658 2889794029
659 2889915720
660 2894239427
661 2899260161
662 2899793421
663 2899848300
664 2915652350
665 2926757525
666 2926764889
667 2933014401
668 2933597007
669 2933600282
670 2935903236
671 2936374461
672 2937845857
673 2954015526
674 2961173102
675 2970505696
676 2979810417
677 2996312232
678 3005422338
679 639644825
680 650842340
681 8003573540
682 8005288502
683 8005290494
684 8005301087
685 8005308005
686 8005320325
687 8005379734
688 8005383503
689 8005431420
690 8005467121
691 8005488051
692 8005502909
693 8005571599
694 8005624060
695 8005629325
696 8005651627
697 8005674339
698 8005685939
699 8005689099
700 8005697824
701 8018132112
702 8023681830
703 8024482330
704 8024507258
705 8056377875
706 8056382541
707 8057576273
708 8057878173

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02423

OCD_Mu_crystall

Ornithine cyclodeaminase/mu-crystallin family

3

323

0.96

PF01488

Shikimate_DH

Shikimate / quinate 5-dehydrogenase

121

254

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1omo-assembly1.cif.gz_B alanine dehydrogenase dimer w/bound nad (archaeal) 0.9609 2 331
1omo-assembly1.cif.gz_B alanine dehydrogenase dimer w/bound nad (archaeal) 0.958 2 331
6rqa-assembly1.cif.gz_B crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with nad+ 0.9492 3 330
6rqa-assembly1.cif.gz_B crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with nad+ 0.9435 3 330
6t3e-assembly1.cif.gz_A structure of thermococcus litoralis delta(1)-pyrroline-2-carboxylate reductase in complex with nadh and l-proline 0.9405 5 328
ID Description Score Start End Superfamily
1vllA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9432 129 303 3.40.50.720
1vllA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9379 129 303 3.40.50.720
af_Q9HDZ0_133_310_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9346 134 303 3.40.50.720
1x7dB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9214 129 303 3.40.50.720
af_Q9FLY0_138_305_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9188 139 303 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A848Y772-F1-model_v4 Cyclodeaminase 0.9763 56 330 GO:0005737
AF-A0A436CC16-F1-model_v4 Ectoine utilization protein EutC 0.9744 38 330 GO:0005737
AF-A0A1S7T3R3-F1-model_v4 deleted 0.9741 1 304
AF-A0A527WNU1-F1-model_v4 Ornithine cyclodeaminase family protein 0.9715 174 330 GO:0005737
AF-A0A440JEK7-F1-model_v4 deleted 0.9715 201 330

Map