F419632

General Info

Members Datasets Scaffolds Average Seq Length
354 137 708 160

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100042342|Ga0070670_1000423422
Length 181
Sequence MRQVLWPDQQKNIFIMKNSILKGISLGCTCLIFACNEKKAESATPEVNEQVVVDKEQIKKEIQAKEDAFAAVYNSGELKSIGYYADDATSFFQNRPPLVGKEAIIKFLKDDVVSSSDRISFNTNEVFVSGDGNFVVEIGSFKVVDSVKAPINTGNYMTLFEKRNGKYVAVRDMSASDRPVN

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
124 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
125 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
129 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
135 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
136 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
137 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.41
Nodule 0
Rhizoplane 0.85
Rhizosphere 96.89
Stem 0
Stem Tuber 0
Unclassified 6.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100042342 3300005331 Bacteria 3914
2 Ga0065714_10004789 3300005288 Bacteria 5010
3 Ga0065714_10065838 3300005288 Bacteria 8332
4 Ga0065714_10066381 3300005288 Bacteria 6968
5 Ga0065714_10142409 3300005288 Bacteria 1159
6 Ga0065714_10458750 3300005288 Bacteria 548
7 Ga0065712_10035084 3300005290 Bacteria 1002
8 Ga0065712_10116592 3300005290 Bacteria 1733
9 Ga0065712_10228790 3300005290 Bacteria 1018
10 Ga0065712_10450375 3300005290 Bacteria 686
11 Ga0065712_10520604 3300005290 Bacteria 636
12 Ga0065715_10101653 3300005293 Bacteria 3183
13 Ga0065715_10169592 3300005293 Bacteria 1558
14 Ga0065715_10630912 3300005293 Bacteria 690
15 Ga0065707_10139237 3300005295 Bacteria 1795
16 Ga0065707_10410282 3300005295 Bacteria 842
17 Ga0065707_10558051 3300005295 Bacteria 716
18 Ga0065707_10670635 3300005295 Bacteria 653
19 Ga0070676_10429941 3300005328 Bacteria 924
20 Ga0070683_100001377 3300005329 Bacteria 18639
21 Ga0070683_100009771 3300005329 Bacteria 8219
22 Ga0070683_100017250 3300005329 Bacteria 6378
23 Ga0070683_100580928 3300005329 Bacteria 1072
24 Ga0070690_100210665 3300005330 Bacteria 1357
25 Ga0070670_100011716 3300005331 Bacteria 7501
26 Ga0070670_100309940 3300005331 Unclassified 1382
27 Ga0070670_100394876 3300005331 Bacteria 1220
28 Ga0070670_100722050 3300005331 Bacteria 897
29 Ga0070670_100724561 3300005331 Bacteria 895
30 Ga0070677_10092164 3300005333 Bacteria 1320
31 Ga0070677_10497051 3300005333 Bacteria 660
32 Ga0068869_100107071 3300005334 Bacteria 2122
33 Ga0068869_100144546 3300005334 Bacteria 1840
34 Ga0068869_100437682 3300005334 Bacteria 1082
35 Ga0070666_10141131 3300005335 Bacteria 1678
36 Ga0070666_10267006 3300005335 Bacteria 1214
37 Ga0068868_100095909 3300005338 Bacteria 2395
38 Ga0068868_100649754 3300005338 Bacteria 939
39 Ga0068868_101589424 3300005338 Unclassified 614
40 Ga0070660_100094987 3300005339 Bacteria 2356
41 Ga0070689_100003212 3300005340 Bacteria 10830
42 Ga0070689_100006497 3300005340 Bacteria 8101
43 Ga0070689_100014192 3300005340 Bacteria 5781
44 Ga0070691_10045312 3300005341 Bacteria 2087
45 Ga0070687_100421410 3300005343 Bacteria 881
46 Ga0070661_100001116 3300005344 Bacteria 18846
47 Ga0070661_100009327 3300005344 Bacteria 6789
48 Ga0070661_100166583 3300005344 Bacteria 1672
49 Ga0070669_100244230 3300005353 Bacteria 1427
50 Ga0070675_100191802 3300005354 Bacteria 1771
51 Ga0070675_100310406 3300005354 Bacteria 1391
52 Ga0070675_100350477 3300005354 Bacteria 1309
53 Ga0070675_100386706 3300005354 Bacteria 1246
54 Ga0070675_100931028 3300005354 Bacteria 797
55 Ga0070671_100076786 3300005355 Unclassified 2791
56 Ga0070671_100233296 3300005355 Bacteria 1562
57 Ga0070671_100338831 3300005355 Bacteria 1282
58 Ga0070671_100443187 3300005355 Bacteria 1114
59 Ga0070674_100527706 3300005356 Bacteria 987
60 Ga0070674_101105546 3300005356 Bacteria 700
61 Ga0070673_100025047 3300005364 Bacteria 4384
62 Ga0070673_100276782 3300005364 Bacteria 1471
63 Ga0070673_100285902 3300005364 Bacteria 1448
64 Ga0070673_100332774 3300005364 Bacteria 1344
65 Ga0070673_100517733 3300005364 Bacteria 1081
66 Ga0070688_100023880 3300005365 Bacteria 3601
67 Ga0070688_100337745 3300005365 Bacteria 1099
68 Ga0070688_100547649 3300005365 Bacteria 879
69 Ga0070688_100932151 3300005365 Bacteria 686
70 Ga0070659_100009921 3300005366 Bacteria 7002
71 Ga0070659_100330939 3300005366 Bacteria 1275
72 Ga0070667_100168297 3300005367 Bacteria 1933
73 Ga0070667_100495313 3300005367 Bacteria 1120
74 Ga0070667_101124953 3300005367 Bacteria 734
75 Ga0070701_10211918 3300005438 Bacteria 1151
76 Ga0070701_10338207 3300005438 Bacteria 936
77 Ga0070663_100402354 3300005455 Bacteria 1119
78 Ga0070663_100418384 3300005455 Bacteria 1099
79 Ga0070678_100066478 3300005456 Bacteria 2680
80 Ga0070662_100036208 3300005457 Bacteria 3490
81 Ga0068867_100068060 3300005459 Bacteria 2657
82 Ga0068867_100559667 3300005459 Bacteria 992
83 Ga0068867_101434629 3300005459 Bacteria 641
84 Ga0070685_10006718 3300005466 Bacteria 5871
85 Ga0070685_10160822 3300005466 Bacteria 1431
86 Ga0070685_10372573 3300005466 Unclassified 982
87 Ga0070684_100010603 3300005535 Bacteria 7308
88 Ga0070684_100112849 3300005535 Bacteria 2439
89 Ga0070684_100206920 3300005535 Bacteria 1788
90 Ga0070684_100289950 3300005535 Bacteria 1500
91 Ga0070684_100449758 3300005535 Bacteria 1191
92 Ga0068853_100010747 3300005539 Bacteria 7413
93 Ga0068853_100749895 3300005539 Bacteria 933
94 Ga0070672_100048168 3300005543 Bacteria 3310
95 Ga0070672_100145466 3300005543 Bacteria 1958
96 Ga0070672_100224914 3300005543 Bacteria 1575
97 Ga0070672_100365504 3300005543 Bacteria 1232
98 Ga0070672_101558512 3300005543 Unclassified 592
99 Ga0070686_100012454 3300005544 Bacteria 4847
100 Ga0070693_100637557 3300005547 Bacteria 773
101 Ga0070665_100170641 3300005548 Bacteria 2176
102 Ga0068855_100865141 3300005563 Bacteria 957
103 Ga0070664_100002080 3300005564 Bacteria 15990
104 Ga0070664_100045678 3300005564 Bacteria 3699
105 Ga0070664_100185225 3300005564 Bacteria 1852
106 Ga0070664_100236274 3300005564 Bacteria 1639
107 Ga0070664_100546409 3300005564 Bacteria 1071
108 Ga0070664_100702193 3300005564 Bacteria 942
109 Ga0070664_100878039 3300005564 Bacteria 840
110 Ga0070664_101689697 3300005564 Unclassified 600
111 Ga0068857_100019642 3300005577 Bacteria 5936
112 Ga0068857_100029973 3300005577 Bacteria 4801
113 Ga0068857_100372357 3300005577 Bacteria 1325
114 Ga0068857_100499722 3300005577 Bacteria 1141
115 Ga0068857_101069793 3300005577 Bacteria 778
116 Ga0068856_100122299 3300005614 Bacteria 2605
117 Ga0068852_100136038 3300005616 Bacteria 2269
118 Ga0068852_100137967 3300005616 Bacteria 2253
119 Ga0068852_100415101 3300005616 Bacteria 1327
120 Ga0068852_100435836 3300005616 Bacteria 1295
121 Ga0068852_100900460 3300005616 Bacteria 902
122 Ga0068852_101488637 3300005616 Bacteria 699
123 Ga0068859_100111477 3300005617 Unclassified 2799
124 Ga0068859_100286720 3300005617 Bacteria 1739
125 Ga0068859_100670622 3300005617 Bacteria 1128
126 Ga0068859_100772003 3300005617 Bacteria 1049
127 Ga0068864_100005460 3300005618 Bacteria 10425
128 Ga0068864_100299978 3300005618 Unclassified 1504
129 Ga0068851_10174107 3300005834 Bacteria 1189
130 Ga0068870_10123973 3300005840 Bacteria 1492
131 Ga0068870_10161280 3300005840 Bacteria 1330
132 Ga0068863_100002433 3300005841 Bacteria 18489
133 Ga0068863_100035454 3300005841 Bacteria 4752
134 Ga0068863_100091255 3300005841 Bacteria 2889
135 Ga0068863_100394860 3300005841 Bacteria 1352
136 Ga0068863_101761667 3300005841 Bacteria 629
137 Ga0068858_100014253 3300005842 Bacteria 7493
138 Ga0068858_101024297 3300005842 Bacteria 809
139 Ga0068860_100402159 3300005843 Bacteria 1355
140 Ga0068862_100309833 3300005844 Bacteria 1455
141 Ga0070715_10074761 3300006163 Bacteria 1523
142 Ga0070716_100791593 3300006173 Bacteria 733
143 Ga0097621_100010603 3300006237 Bacteria 6752
144 Ga0097621_100047732 3300006237 Bacteria 3470
145 Ga0097621_100081025 3300006237 Bacteria 2701
146 Ga0097621_100711256 3300006237 Bacteria 925
147 Ga0097621_101112091 3300006237 Bacteria 742
148 Ga0068871_100044858 3300006358 Bacteria 3557
149 Ga0068871_100378712 3300006358 Bacteria 1257
150 Ga0068871_100556475 3300006358 Bacteria 1039
151 Ga0068871_100903450 3300006358 Bacteria 819
152 Ga0068871_101662088 3300006358 Bacteria 605
153 Ga0097620_100111481 3300006931 Unclassified 2799
154 Ga0097620_100286741 3300006931 Bacteria 1739
155 Ga0097620_100308917 3300006931 Bacteria 1675
156 Ga0097620_100670622 3300006931 Bacteria 1128
157 Ga0097620_100772025 3300006931 Bacteria 1049
158 Ga0111539_10478748 3300009094 Unclassified 1450
159 Ga0111539_11302616 3300009094 Bacteria 843
160 Ga0105241_10128009 3300009174 Bacteria 2052
161 Ga0105242_10004052 3300009176 Bacteria 11382
162 Ga0105242_10036905 3300009176 Bacteria 3923
163 Ga0105242_10077324 3300009176 Bacteria 2776
164 Ga0105242_10639080 3300009176 Bacteria 1033
165 Ga0105242_10836376 3300009176 Bacteria 915
166 Ga0105248_10166719 3300009177 Bacteria 2483
167 Ga0105249_10376812 3300009553 Bacteria 1444
168 Ga0105246_10845283 3300011119 Bacteria 816
169 Ga0105246_11173726 3300011119 Bacteria 705
170 Ga0157371_10198783 3300013102 Bacteria 1437
171 Ga0157370_10450211 3300013104 Bacteria 1184
172 Ga0157370_10527474 3300013104 Bacteria 1083
173 Ga0157370_11150439 3300013104 Bacteria 701
174 Ga0157374_10002340 3300013296 Bacteria 16006
175 Ga0157374_10019998 3300013296 Bacteria 5935
176 Ga0157374_10056510 3300013296 Bacteria 3664
177 Ga0157374_10071633 3300013296 Bacteria 3269
178 Ga0157374_10159084 3300013296 Bacteria 2200
179 Ga0157374_10505073 3300013296 Bacteria 1214
180 Ga0157378_10032309 3300013297 Bacteria 4625
181 Ga0157378_10129657 3300013297 Bacteria 2333
182 Ga0157378_10177231 3300013297 Bacteria 2003
183 Ga0157378_11022555 3300013297 Bacteria 861
184 Ga0163162_10003946 3300013306 Bacteria 14228
185 Ga0163162_10017620 3300013306 Bacteria 6988
186 Ga0163162_10325384 3300013306 Bacteria 1670
187 Ga0163162_10345166 3300013306 Bacteria 1621
188 Ga0163162_10609458 3300013306 Bacteria 1217
189 Ga0163162_10756957 3300013306 Bacteria 1090
190 Ga0163162_10934178 3300013306 Bacteria 979
191 Ga0163162_11459791 3300013306 Bacteria 779
192 Ga0163162_12500273 3300013306 Bacteria 594
193 Ga0157375_10002632 3300013308 Bacteria 15545
194 Ga0157375_10006840 3300013308 Bacteria 9935
195 Ga0157375_10092232 3300013308 Unclassified 3092
196 Ga0157375_10149536 3300013308 Bacteria 2469
197 Ga0157375_10171621 3300013308 Bacteria 2316
198 Ga0157375_10195335 3300013308 Bacteria 2179
199 Ga0157375_10441946 3300013308 Bacteria 1466
200 Ga0157375_10534371 3300013308 Bacteria 1335
201 Ga0157375_11603946 3300013308 Bacteria 769
202 Ga0157375_11999744 3300013308 Unclassified 689
203 Ga0163163_10000395 3300014325 Bacteria 41350
204 Ga0163163_10003906 3300014325 Bacteria 12713
205 Ga0163163_10300506 3300014325 Bacteria 1658
206 Ga0163163_11890708 3300014325 Bacteria 657
207 Ga0157380_10067610 3300014326 Bacteria 2878
208 Ga0157380_10142887 3300014326 Bacteria 2059
209 Ga0157380_10332257 3300014326 Bacteria 1414
210 Ga0157380_10351050 3300014326 Bacteria 1380
211 Ga0157380_10438333 3300014326 Bacteria 1251
212 Ga0157377_10288201 3300014745 Bacteria 1079
213 Ga0157377_10350096 3300014745 Bacteria 991
214 Ga0157379_10009414 3300014968 Bacteria 8511
215 Ga0157379_10077631 3300014968 Bacteria 2973
216 Ga0157379_10836572 3300014968 Bacteria 870
217 Ga0157379_10926219 3300014968 Bacteria 828
218 Ga0157376_10004341 3300014969 Bacteria 9857
219 Ga0157376_10039340 3300014969 Bacteria 3856
220 Ga0163161_10004808 3300017792 Bacteria 9409
221 Ga0163161_10258310 3300017792 Bacteria 1360
222 Ga0207697_10067603 3300025315 Bacteria 1494
223 Ga0207656_10703477 3300025321 Unclassified 517
224 Ga0207682_10129208 3300025893 Bacteria 1127
225 Ga0207642_10534244 3300025899 Bacteria 722
226 Ga0207688_10275812 3300025901 Bacteria 1023
227 Ga0207680_10168494 3300025903 Bacteria 1474
228 Ga0207647_10272893 3300025904 Bacteria 966
229 Ga0207645_10393919 3300025907 Bacteria 931
230 Ga0207645_10629948 3300025907 Bacteria 728
231 Ga0207643_10484183 3300025908 Bacteria 790
232 Ga0207643_10588977 3300025908 Bacteria 715
233 Ga0207654_10611825 3300025911 Bacteria 778
234 Ga0207707_10605460 3300025912 Bacteria 927
235 Ga0207662_10024285 3300025918 Bacteria 3487
236 Ga0207662_10028519 3300025918 Bacteria 3228
237 Ga0207657_10104351 3300025919 Bacteria 2348
238 Ga0207657_10311610 3300025919 Bacteria 1246
239 Ga0207649_10001588 3300025920 Bacteria 13208
240 Ga0207649_10012128 3300025920 Bacteria 4771
241 Ga0207681_10507232 3300025923 Bacteria 988
242 Ga0207681_10513346 3300025923 Bacteria 983
243 Ga0207650_10006673 3300025925 Bacteria 7875
244 Ga0207650_10020082 3300025925 Bacteria 4706
245 Ga0207650_10340867 3300025925 Bacteria 1231
246 Ga0207650_10638736 3300025925 Bacteria 897
247 Ga0207650_10641593 3300025925 Bacteria 895
248 Ga0207650_10693626 3300025925 Unclassified 860
249 Ga0207650_11462092 3300025925 Unclassified 581
250 Ga0207659_10047873 3300025926 Bacteria 3026
251 Ga0207659_10318842 3300025926 Bacteria 1282
252 Ga0207659_10367915 3300025926 Bacteria 1196
253 Ga0207659_10874659 3300025926 Bacteria 773
254 Ga0207659_11459934 3300025926 Unclassified 586
255 Ga0207644_10104650 3300025931 Bacteria 2131
256 Ga0207644_10582208 3300025931 Bacteria 928
257 Ga0207644_10591019 3300025931 Unclassified 921
258 Ga0207644_11043928 3300025931 Bacteria 686
259 Ga0207690_10016604 3300025932 Bacteria 4483
260 Ga0207690_10894803 3300025932 Bacteria 736
261 Ga0207706_10034368 3300025933 Bacteria 4510
262 Ga0207686_10013753 3300025934 Bacteria 4488
263 Ga0207686_10477859 3300025934 Bacteria 963
264 Ga0207686_10725357 3300025934 Bacteria 792
265 Ga0207686_11071829 3300025934 Bacteria 656
266 Ga0207670_10017491 3300025936 Bacteria 4333
267 Ga0207670_10053587 3300025936 Bacteria 2718
268 Ga0207670_10507452 3300025936 Bacteria 980
269 Ga0207669_10023619 3300025937 Bacteria 3289
270 Ga0207669_10070504 3300025937 Bacteria 2192
271 Ga0207691_10204997 3300025940 Bacteria 1715
272 Ga0207691_10284414 3300025940 Bacteria 1423
273 Ga0207691_10312136 3300025940 Bacteria 1349
274 Ga0207691_10512478 3300025940 Bacteria 1018
275 Ga0207711_10607289 3300025941 Bacteria 1021
276 Ga0207689_10053727 3300025942 Bacteria 3319
277 Ga0207689_10357794 3300025942 Bacteria 1214
278 Ga0207661_10008180 3300025944 Bacteria 7465
279 Ga0207661_10024658 3300025944 Bacteria 4560
280 Ga0207661_10133229 3300025944 Bacteria 2131
281 Ga0207661_10557672 3300025944 Bacteria 1050
282 Ga0207661_10855809 3300025944 Bacteria 837
283 Ga0207679_10000521 3300025945 Bacteria 25962
284 Ga0207679_10400142 3300025945 Bacteria 1208
285 Ga0207679_10587968 3300025945 Bacteria 1002
286 Ga0207679_10617789 3300025945 Bacteria 978
287 Ga0207679_10757323 3300025945 Unclassified 883
288 Ga0207679_10786882 3300025945 Bacteria 867
289 Ga0207667_10139262 3300025949 Bacteria 2498
290 Ga0207651_10141621 3300025960 Bacteria 1858
291 Ga0207651_10261576 3300025960 Bacteria 1421
292 Ga0207651_10748037 3300025960 Bacteria 864
293 Ga0207651_11262358 3300025960 Bacteria 664
294 Ga0207712_10694318 3300025961 Bacteria 888
295 Ga0207668_11239562 3300025972 Bacteria 671
296 Ga0207677_10060545 3300026023 Bacteria 2618
297 Ga0207677_10325847 3300026023 Bacteria 1278
298 Ga0207677_10517883 3300026023 Bacteria 1034
299 Ga0207677_10571936 3300026023 Bacteria 988
300 Ga0207677_10918181 3300026023 Bacteria 790
301 Ga0207677_11378882 3300026023 Bacteria 649
302 Ga0207703_10684770 3300026035 Bacteria 974
303 Ga0207639_10019736 3300026041 Bacteria 4812
304 Ga0207678_10195077 3300026067 Bacteria 1731
305 Ga0207678_10727443 3300026067 Bacteria 874
306 Ga0207641_10000627 3300026088 Bacteria 38592
307 Ga0207641_10020388 3300026088 Bacteria 5444
308 Ga0207641_10122146 3300026088 Bacteria 2326
309 Ga0207641_10428921 3300026088 Bacteria 1274
310 Ga0207648_10089391 3300026089 Bacteria 2691
311 Ga0207648_10104747 3300026089 Bacteria 2481
312 Ga0207648_10325472 3300026089 Bacteria 1382
313 Ga0207648_11379594 3300026089 Bacteria 662
314 Ga0207676_10001120 3300026095 Bacteria 20318
315 Ga0207676_10084973 3300026095 Unclassified 2581
316 Ga0207674_10011288 3300026116 Bacteria 10040
317 Ga0207674_10021928 3300026116 Bacteria 6869
318 Ga0207674_10062008 3300026116 Bacteria 3777
319 Ga0207674_10336055 3300026116 Unclassified 1460
320 Ga0207674_10447668 3300026116 Unclassified 1248
321 Ga0207683_10544697 3300026121 Bacteria 1073
322 Ga0207683_10709843 3300026121 Bacteria 932
323 Ga0207683_10899689 3300026121 Bacteria 822
324 Ga0207698_10101611 3300026142 Bacteria 2385
325 Ga0207698_10440539 3300026142 Bacteria 1255
326 Ga0207698_10591172 3300026142 Bacteria 1093
327 Ga0207698_11053651 3300026142 Bacteria 825
328 Ga0207698_11164682 3300026142 Bacteria 785
329 Ga0268266_10211894 3300028379 Bacteria 1777
330 Ga0268265_10463734 3300028380 Bacteria 1186
331 Ga0307509_10005400 3300031507 Bacteria 17788
332 Ga0373927_0023455 3300035695 Bacteria 4042
333 Ga0373937_0231011 3300036401 Bacteria 1742
334 Ga0373937_0655638 3300036401 Bacteria 995
335 Ga0373937_0831381 3300036401 Bacteria 872
336 Ga0395905_0562752 3300037471 Bacteria 1041
337 Ga0436365_0765974 3300039437 Bacteria 1221
338 Ga0439436_0088959 3300041404 Bacteria 860
339 Ga0451789_0164617 3300041443 Bacteria 540
340 Ga0451851_1101427 3300041507 Unclassified 660
341 Ga0453684_0028714 3300044712 Bacteria 7923
342 Ga0495664_0088425 3300046477 Bacteria 1862
343 Ga0495598_0210180 3300046537 Bacteria 706
344 Ga0495621_0031230 3300046539 Bacteria 1826
345 Ga0495667_0173274 3300046559 Bacteria 1386
346 Ga0496101_1074025 3300048904 Bacteria 632
347 Ga0496104_0366213 3300048907 Bacteria 1354
348 nmdc:mga08y16_135717_c1 3300050511 Bacteria 2557
349 nmdc:mga08y16_636688_c1 3300050511 Bacteria 1072
350 Ga0500578_0000003 3300053086 Bacteria 266033
351 Ga0500578_0199197 3300053086 Bacteria 1226
352 Ga0500650_0192627 3300053098 Bacteria 931
353 Ga0500554_095386 3300053102 Bacteria 992
354 Ga0500637_0298381 3300053178 Bacteria 880
355 Ga0070670_100042342
356 Ga0065714_10004789
357 Ga0065714_10065838
358 Ga0065714_10066381
359 Ga0065714_10142409
360 Ga0065714_10458750
361 Ga0065712_10035084
362 Ga0065712_10116592
363 Ga0065712_10228790
364 Ga0065712_10450375
365 Ga0065712_10520604
366 Ga0065715_10101653
367 Ga0065715_10169592
368 Ga0065715_10630912
369 Ga0065707_10139237
370 Ga0065707_10410282
371 Ga0065707_10558051
372 Ga0065707_10670635
373 Ga0070676_10429941
374 Ga0070683_100001377
375 Ga0070683_100009771
376 Ga0070683_100017250
377 Ga0070683_100580928
378 Ga0070690_100210665
379 Ga0070670_100011716
380 Ga0070670_100309940
381 Ga0070670_100394876
382 Ga0070670_100722050
383 Ga0070670_100724561
384 Ga0070677_10092164
385 Ga0070677_10497051
386 Ga0068869_100107071
387 Ga0068869_100144546
388 Ga0068869_100437682
389 Ga0070666_10141131
390 Ga0070666_10267006
391 Ga0068868_100095909
392 Ga0068868_100649754
393 Ga0068868_101589424
394 Ga0070660_100094987
395 Ga0070689_100003212
396 Ga0070689_100006497
397 Ga0070689_100014192
398 Ga0070691_10045312
399 Ga0070687_100421410
400 Ga0070661_100001116
401 Ga0070661_100009327
402 Ga0070661_100166583
403 Ga0070669_100244230
404 Ga0070675_100191802
405 Ga0070675_100310406
406 Ga0070675_100350477
407 Ga0070675_100386706
408 Ga0070675_100931028
409 Ga0070671_100076786
410 Ga0070671_100233296
411 Ga0070671_100338831
412 Ga0070671_100443187
413 Ga0070674_100527706
414 Ga0070674_101105546
415 Ga0070673_100025047
416 Ga0070673_100276782
417 Ga0070673_100285902
418 Ga0070673_100332774
419 Ga0070673_100517733
420 Ga0070688_100023880
421 Ga0070688_100337745
422 Ga0070688_100547649
423 Ga0070688_100932151
424 Ga0070659_100009921
425 Ga0070659_100330939
426 Ga0070667_100168297
427 Ga0070667_100495313
428 Ga0070667_101124953
429 Ga0070701_10211918
430 Ga0070701_10338207
431 Ga0070663_100402354
432 Ga0070663_100418384
433 Ga0070678_100066478
434 Ga0070662_100036208
435 Ga0068867_100068060
436 Ga0068867_100559667
437 Ga0068867_101434629
438 Ga0070685_10006718
439 Ga0070685_10160822
440 Ga0070685_10372573
441 Ga0070684_100010603
442 Ga0070684_100112849
443 Ga0070684_100206920
444 Ga0070684_100289950
445 Ga0070684_100449758
446 Ga0068853_100010747
447 Ga0068853_100749895
448 Ga0070672_100048168
449 Ga0070672_100145466
450 Ga0070672_100224914
451 Ga0070672_100365504
452 Ga0070672_101558512
453 Ga0070686_100012454
454 Ga0070693_100637557
455 Ga0070665_100170641
456 Ga0068855_100865141
457 Ga0070664_100002080
458 Ga0070664_100045678
459 Ga0070664_100185225
460 Ga0070664_100236274
461 Ga0070664_100546409
462 Ga0070664_100702193
463 Ga0070664_100878039
464 Ga0070664_101689697
465 Ga0068857_100019642
466 Ga0068857_100029973
467 Ga0068857_100372357
468 Ga0068857_100499722
469 Ga0068857_101069793
470 Ga0068856_100122299
471 Ga0068852_100136038
472 Ga0068852_100137967
473 Ga0068852_100415101
474 Ga0068852_100435836
475 Ga0068852_100900460
476 Ga0068852_101488637
477 Ga0068859_100111477
478 Ga0068859_100286720
479 Ga0068859_100670622
480 Ga0068859_100772003
481 Ga0068864_100005460
482 Ga0068864_100299978
483 Ga0068851_10174107
484 Ga0068870_10123973
485 Ga0068870_10161280
486 Ga0068863_100002433
487 Ga0068863_100035454
488 Ga0068863_100091255
489 Ga0068863_100394860
490 Ga0068863_101761667
491 Ga0068858_100014253
492 Ga0068858_101024297
493 Ga0068860_100402159
494 Ga0068862_100309833
495 Ga0070715_10074761
496 Ga0070716_100791593
497 Ga0097621_100010603
498 Ga0097621_100047732
499 Ga0097621_100081025
500 Ga0097621_100711256
501 Ga0097621_101112091
502 Ga0068871_100044858
503 Ga0068871_100378712
504 Ga0068871_100556475
505 Ga0068871_100903450
506 Ga0068871_101662088
507 Ga0097620_100111481
508 Ga0097620_100286741
509 Ga0097620_100308917
510 Ga0097620_100670622
511 Ga0097620_100772025
512 Ga0111539_10478748
513 Ga0111539_11302616
514 Ga0105241_10128009
515 Ga0105242_10004052
516 Ga0105242_10036905
517 Ga0105242_10077324
518 Ga0105242_10639080
519 Ga0105242_10836376
520 Ga0105248_10166719
521 Ga0105249_10376812
522 Ga0105246_10845283
523 Ga0105246_11173726
524 Ga0157371_10198783
525 Ga0157370_10450211
526 Ga0157370_10527474
527 Ga0157370_11150439
528 Ga0157374_10002340
529 Ga0157374_10019998
530 Ga0157374_10056510
531 Ga0157374_10071633
532 Ga0157374_10159084
533 Ga0157374_10505073
534 Ga0157378_10032309
535 Ga0157378_10129657
536 Ga0157378_10177231
537 Ga0157378_11022555
538 Ga0163162_10003946
539 Ga0163162_10017620
540 Ga0163162_10325384
541 Ga0163162_10345166
542 Ga0163162_10609458
543 Ga0163162_10756957
544 Ga0163162_10934178
545 Ga0163162_11459791
546 Ga0163162_12500273
547 Ga0157375_10002632
548 Ga0157375_10006840
549 Ga0157375_10092232
550 Ga0157375_10149536
551 Ga0157375_10171621
552 Ga0157375_10195335
553 Ga0157375_10441946
554 Ga0157375_10534371
555 Ga0157375_11603946
556 Ga0157375_11999744
557 Ga0163163_10000395
558 Ga0163163_10003906
559 Ga0163163_10300506
560 Ga0163163_11890708
561 Ga0157380_10067610
562 Ga0157380_10142887
563 Ga0157380_10332257
564 Ga0157380_10351050
565 Ga0157380_10438333
566 Ga0157377_10288201
567 Ga0157377_10350096
568 Ga0157379_10009414
569 Ga0157379_10077631
570 Ga0157379_10836572
571 Ga0157379_10926219
572 Ga0157376_10004341
573 Ga0157376_10039340
574 Ga0163161_10004808
575 Ga0163161_10258310
576 Ga0207697_10067603
577 Ga0207656_10703477
578 Ga0207682_10129208
579 Ga0207642_10534244
580 Ga0207688_10275812
581 Ga0207680_10168494
582 Ga0207647_10272893
583 Ga0207645_10393919
584 Ga0207645_10629948
585 Ga0207643_10484183
586 Ga0207643_10588977
587 Ga0207654_10611825
588 Ga0207707_10605460
589 Ga0207662_10024285
590 Ga0207662_10028519
591 Ga0207657_10104351
592 Ga0207657_10311610
593 Ga0207649_10001588
594 Ga0207649_10012128
595 Ga0207681_10507232
596 Ga0207681_10513346
597 Ga0207650_10006673
598 Ga0207650_10020082
599 Ga0207650_10340867
600 Ga0207650_10638736
601 Ga0207650_10641593
602 Ga0207650_10693626
603 Ga0207650_11462092
604 Ga0207659_10047873
605 Ga0207659_10318842
606 Ga0207659_10367915
607 Ga0207659_10874659
608 Ga0207659_11459934
609 Ga0207644_10104650
610 Ga0207644_10582208
611 Ga0207644_10591019
612 Ga0207644_11043928
613 Ga0207690_10016604
614 Ga0207690_10894803
615 Ga0207706_10034368
616 Ga0207686_10013753
617 Ga0207686_10477859
618 Ga0207686_10725357
619 Ga0207686_11071829
620 Ga0207670_10017491
621 Ga0207670_10053587
622 Ga0207670_10507452
623 Ga0207669_10023619
624 Ga0207669_10070504
625 Ga0207691_10204997
626 Ga0207691_10284414
627 Ga0207691_10312136
628 Ga0207691_10512478
629 Ga0207711_10607289
630 Ga0207689_10053727
631 Ga0207689_10357794
632 Ga0207661_10008180
633 Ga0207661_10024658
634 Ga0207661_10133229
635 Ga0207661_10557672
636 Ga0207661_10855809
637 Ga0207679_10000521
638 Ga0207679_10400142
639 Ga0207679_10587968
640 Ga0207679_10617789
641 Ga0207679_10757323
642 Ga0207679_10786882
643 Ga0207667_10139262
644 Ga0207651_10141621
645 Ga0207651_10261576
646 Ga0207651_10748037
647 Ga0207651_11262358
648 Ga0207712_10694318
649 Ga0207668_11239562
650 Ga0207677_10060545
651 Ga0207677_10325847
652 Ga0207677_10517883
653 Ga0207677_10571936
654 Ga0207677_10918181
655 Ga0207677_11378882
656 Ga0207703_10684770
657 Ga0207639_10019736
658 Ga0207678_10195077
659 Ga0207678_10727443
660 Ga0207641_10000627
661 Ga0207641_10020388
662 Ga0207641_10122146
663 Ga0207641_10428921
664 Ga0207648_10089391
665 Ga0207648_10104747
666 Ga0207648_10325472
667 Ga0207648_11379594
668 Ga0207676_10001120
669 Ga0207676_10084973
670 Ga0207674_10011288
671 Ga0207674_10021928
672 Ga0207674_10062008
673 Ga0207674_10336055
674 Ga0207674_10447668
675 Ga0207683_10544697
676 Ga0207683_10709843
677 Ga0207683_10899689
678 Ga0207698_10101611
679 Ga0207698_10440539
680 Ga0207698_10591172
681 Ga0207698_11053651
682 Ga0207698_11164682
683 Ga0268266_10211894
684 Ga0268265_10463734
685 Ga0307509_10005400
686 Ga0373927_0023455
687 Ga0373937_0231011
688 Ga0373937_0655638
689 Ga0373937_0831381
690 Ga0395905_0562752
691 Ga0436365_0765974
692 Ga0439436_0088959
693 Ga0451789_0164617
694 Ga0451851_1101427
695 Ga0453684_0028714
696 Ga0495664_0088425
697 Ga0495598_0210180
698 Ga0495621_0031230
699 Ga0495667_0173274
700 Ga0496101_1074025
701 Ga0496104_0366213
702 nmdc:mga08y16_135717_c1
703 nmdc:mga08y16_636688_c1
704 Ga0500578_0000003
705 Ga0500578_0199197
706 Ga0500650_0192627
707 Ga0500554_095386
708 Ga0500637_0298381

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ieo-assembly1.cif.gz_A structure of cdl2.3a, a computationally designed vitamin-d3 binder 0.8746 39 160
5iep-assembly1.cif.gz_A structure of cdl2.3b, a computationally designed vitamin-d3 binder 0.87 40 160
4ovm-assembly3.cif.gz_F crystal structure of sgcj protein from streptomyces carzinostaticus 0.8654 38 157
5ien-assembly2.cif.gz_B structure of cdl2.2, a computationally designed vitamin-d3 binder 0.8596 39 160
3hx8-assembly2.cif.gz_C crystal structure of putative ketosteroid isomerase (np_103587.1) from mesorhizobium loti at 1.45 a resolution 0.8593 40 162
ID Description Score Start End Superfamily
af_A0A078BPG0_5_119_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9019 41 157 3.10.450.50
af_A0A078BPG0_5_119_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8797 41 157 3.10.450.50
5iepA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.87 40 160 3.10.450.50
5iepA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8436 40 160 3.10.450.50
af_Q7KPV8_5_124_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8394 37 157 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A524PRE9-F1-model_v4 Nuclear transport factor 2 family protein 0.9765 27 163
AF-A0A1M5IT53-F1-model_v4 Ketosteroid isomerase homolog 0.9338 24 162 GO:0016853
AF-A0A2G0CD39-F1-model_v4 DUF4440 domain-containing protein 0.9219 37 161
AF-A0A7Y1TNR0-F1-model_v4 SnoaL-like domain-containing protein 0.9199 29 163
AF-A0A521EUP7-F1-model_v4 Ketosteroid isomerase homolog 0.9135 20 163 GO:0016853

Map