F419647

General Info

Members Datasets Scaffolds Average Seq Length
354 214 347 117

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100057136|Ga0070671_1000571362
Length 130
Sequence LKLPGDAGRGTTNAMLYLAIKAGLSGILIALVSEVAKRYPGFGGLIASLPLVSVLGMIWLWRDKPDAANMAAHSEGTFWFVIPSLPMFLLIPAMLRHGFSFWASLAAGCVLTILLYSLMVWAGPRLGLRL

Samples

Sample ID Description Type Environment
1 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
2 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
3 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
4 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
5 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
6 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
7 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
174 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
175 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
176 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
185 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
205 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
206 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
207 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
212 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
213 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
214 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.74
Metatranscriptomes 0.28
Isolates 1.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.95
Nodule 0
Rhizoplane 2.54
Rhizosphere 87.57
Stem 0
Stem Tuber 0
Unclassified 5.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10083274 3300001989 Bacteria 980
2 JGI24739J22299_10083746 3300001989 Bacteria 977
3 JGI24737J22298_10064893 3300001990 Bacteria 1095
4 JGI24737J22298_10145979 3300001990 Bacteria 699
5 JGI24735J21928_10069269 3300002067 Bacteria 1011
6 JGI24742J22300_10031988 3300002244 Bacteria 922
7 Ga0055530_10004432 3300003791 Bacteria 7220
8 Ga0055531_10091453 3300003794 Bacteria 644
9 Ga0065712_10290102 3300005290 Bacteria 873
10 Ga0065715_10004658 3300005293 Bacteria 4230
11 Ga0065707_10146283 3300005295 Bacteria 1710
12 Ga0070658_10097798 3300005327 Bacteria 2424
13 Ga0070658_10522144 3300005327 Bacteria 1027
14 Ga0070676_10243223 3300005328 Bacteria 1198
15 Ga0070683_100228907 3300005329 Bacteria 1767
16 Ga0070670_100026855 3300005331 Bacteria 4952
17 Ga0070670_101082507 3300005331 Bacteria 731
18 Ga0070677_10003222 3300005333 Bacteria 5251
19 Ga0068869_101841497 3300005334 Bacteria 542
20 Ga0070666_10008002 3300005335 Bacteria 6538
21 Ga0070666_10409942 3300005335 Bacteria 975
22 Ga0070680_100957175 3300005336 Bacteria 739
23 Ga0070682_100444475 3300005337 Bacteria 991
24 Ga0070687_100985622 3300005343 Bacteria 610
25 Ga0070661_101105451 3300005344 Bacteria 661
26 Ga0070692_10023723 3300005345 Bacteria 3009
27 Ga0070692_11194788 3300005345 Bacteria 541
28 Ga0070668_100000868 3300005347 Bacteria 21031
29 Ga0070668_100084344 3300005347 Bacteria 2495
30 Ga0070669_100006207 3300005353 Bacteria 8626
31 Ga0070669_100033281 3300005353 Bacteria 3727
32 Ga0070675_100018802 3300005354 Bacteria 5500
33 Ga0070671_100015421 3300005355 Bacteria 6173
34 Ga0070671_100057136 3300005355 Bacteria 3246
35 Ga0070674_100022757 3300005356 Bacteria 4044
36 Ga0070673_100015363 3300005364 Bacteria 5375
37 Ga0070673_101151284 3300005364 Bacteria 726
38 Ga0070659_100112789 3300005366 Bacteria 2196
39 Ga0070659_100619054 3300005366 Bacteria 932
40 Ga0070667_100000197 3300005367 Bacteria 71585
41 Ga0070667_100000548 3300005367 Bacteria 37357
42 Ga0070667_100558308 3300005367 Bacteria 1053
43 Ga0070667_100824799 3300005367 Bacteria 862
44 Ga0070701_10680697 3300005438 Bacteria 690
45 Ga0070694_101547706 3300005444 Bacteria 562
46 Ga0070663_100061631 3300005455 Bacteria 2702
47 Ga0070678_100047551 3300005456 Bacteria 3084
48 Ga0070662_100001740 3300005457 Bacteria 13393
49 Ga0070662_100004921 3300005457 Bacteria 8488
50 Ga0070662_100310248 3300005457 Bacteria 1284
51 Ga0070662_100388229 3300005457 Bacteria 1150
52 Ga0070662_100705129 3300005457 Bacteria 854
53 Ga0070681_10249122 3300005458 Bacteria 1689
54 Ga0070685_10528009 3300005466 Bacteria 839
55 Ga0068853_100131722 3300005539 Bacteria 2239
56 Ga0070672_100056514 3300005543 Bacteria 3078
57 Ga0070665_100245214 3300005548 Bacteria 1792
58 Ga0070665_101296396 3300005548 Bacteria 738
59 Ga0070665_102410218 3300005548 Bacteria 528
60 Ga0068855_100000239 3300005563 Bacteria 69455
61 Ga0068855_100073461 3300005563 Bacteria 3973
62 Ga0068855_100121664 3300005563 Bacteria 2987
63 Ga0068855_100259590 3300005563 Bacteria 1936
64 Ga0068855_102239170 3300005563 Bacteria 548
65 Ga0070664_100058892 3300005564 Bacteria 3267
66 Ga0068857_100449843 3300005577 Bacteria 1204
67 Ga0068854_100027408 3300005578 Bacteria 3927
68 Ga0068854_100427630 3300005578 Bacteria 1101
69 Ga0070702_100383399 3300005615 Bacteria 1000
70 Ga0068852_100696428 3300005616 Bacteria 1026
71 Ga0068859_100012049 3300005617 Bacteria 8687
72 Ga0068859_100189268 3300005617 Bacteria 2142
73 Ga0068864_100203157 3300005618 Bacteria 1821
74 Ga0068866_10819477 3300005718 Bacteria 648
75 Ga0068861_100026293 3300005719 Bacteria 4230
76 Ga0068861_100708135 3300005719 Bacteria 936
77 Ga0068861_101666990 3300005719 Bacteria 630
78 Ga0068870_10092093 3300005840 Bacteria 1697
79 Ga0068863_100000225 3300005841 Bacteria 59865
80 Ga0068863_100020369 3300005841 Bacteria 6341
81 Ga0068863_100039045 3300005841 Bacteria 4518
82 Ga0068858_101145759 3300005842 Bacteria 764
83 Ga0068860_100000290 3300005843 Bacteria 71562
84 Ga0068860_100046668 3300005843 Bacteria 4130
85 Ga0068860_100649251 3300005843 Bacteria 1063
86 Ga0068860_100732442 3300005843 Bacteria 1000
87 Ga0068862_100117307 3300005844 Bacteria 2342
88 Ga0068862_100183711 3300005844 Bacteria 1878
89 Ga0068862_101143459 3300005844 Bacteria 775
90 Ga0097621_100138560 3300006237 Bacteria 2077
91 Ga0097621_100187021 3300006237 Bacteria 1792
92 Ga0075431_100109691 3300006847 Bacteria 2849
93 Ga0068865_100955088 3300006881 Bacteria 748
94 Ga0097620_100012049 3300006931 Bacteria 8687
95 Ga0097620_100189256 3300006931 Bacteria 2142
96 Ga0105240_10090147 3300009093 Bacteria 3748
97 Ga0105240_10261260 3300009093 Unclassified 1997
98 Ga0105240_10340527 3300009093 Bacteria 1704
99 Ga0111539_10152043 3300009094 Bacteria 2709
100 Ga0105245_10000480 3300009098 Bacteria 36564
101 Ga0105243_10142080 3300009148 Bacteria 2049
102 Ga0105243_10226286 3300009148 Bacteria 1656
103 Ga0105243_10819238 3300009148 Bacteria 919
104 Ga0105242_10694473 3300009176 Bacteria 995
105 Ga0105248_10002018 3300009177 Bacteria 22518
106 Ga0105248_10238378 3300009177 Bacteria 2048
107 Ga0105238_10016482 3300009551 Bacteria 7480
108 Ga0105238_10540024 3300009551 Bacteria 1170
109 Ga0105249_10012480 3300009553 Bacteria 7490
110 Ga0105032_106023 3300009979 Bacteria 1018
111 Ga0105239_10000060 3300010375 Bacteria 155195
112 Ga0105239_10435569 3300010375 Bacteria 1486
113 Ga0105239_10962651 3300010375 Bacteria 981
114 Ga0157373_10129498 3300013100 Bacteria 1774
115 Ga0157371_10426750 3300013102 Bacteria 972
116 Ga0157369_10148553 3300013105 Bacteria 2477
117 Ga0157374_10101317 3300013296 Bacteria 2761
118 Ga0157378_10335909 3300013297 Bacteria 1472
119 Ga0163162_12375741 3300013306 Bacteria 609
120 Ga0157375_10122417 3300013308 Bacteria 2713
121 Ga0157375_11050530 3300013308 Bacteria 952
122 Ga0157380_10005946 3300014326 Bacteria 8538
123 Ga0157380_10600729 3300014326 Bacteria 1089
124 Ga0157380_10909768 3300014326 Bacteria 907
125 Ga0157380_11130978 3300014326 Bacteria 823
126 Ga0157377_10287938 3300014745 Bacteria 1079
127 Ga0163161_10086115 3300017792 Bacteria 2319
128 Ga0163161_10258024 3300017792 Bacteria 1360
129 Ga0206356_11205880 3300020070 Bacteria 3497
130 Ga0213876_10007342 3300021384 Bacteria 5996
131 Ga0207427_112809 3300025231 Bacteria 832
132 Ga0209437_119408 3300025233 Bacteria 855
133 Ga0209233_1000142 3300025261 Bacteria 192193
134 Ga0209676_1000704 3300025292 Bacteria 46565
135 Ga0209050_1001078 3300025298 Bacteria 33360
136 Ga0209051_1007655 3300025303 Bacteria 5872
137 Ga0209257_1025143 3300025304 Bacteria 2041
138 Ga0207697_10001912 3300025315 Bacteria 11079
139 Ga0207682_10000039 3300025893 Bacteria 53500
140 Ga0207680_10015870 3300025903 Bacteria 3941
141 Ga0207680_10880795 3300025903 Bacteria 642
142 Ga0207647_10000373 3300025904 Bacteria 36423
143 Ga0207645_10033981 3300025907 Bacteria 3276
144 Ga0207643_10203681 3300025908 Bacteria 1206
145 Ga0207705_10077764 3300025909 Bacteria 2414
146 Ga0207705_10859925 3300025909 Bacteria 703
147 Ga0207695_10118467 3300025913 Bacteria 2619
148 Ga0207695_10694728 3300025913 Bacteria 898
149 Ga0207662_11032648 3300025918 Bacteria 584
150 Ga0207681_10005659 3300025923 Bacteria 7669
151 Ga0207681_10011029 3300025923 Bacteria 5551
152 Ga0207681_10031205 3300025923 Bacteria 3479
153 Ga0207681_11735947 3300025923 Unclassified 521
154 Ga0207694_10125233 3300025924 Bacteria 2055
155 Ga0207650_10009932 3300025925 Bacteria 6512
156 Ga0207650_10489102 3300025925 Bacteria 1027
157 Ga0207650_11547054 3300025925 Bacteria 563
158 Ga0207659_10130563 3300025926 Bacteria 1938
159 Ga0207659_10456507 3300025926 Bacteria 1077
160 Ga0207687_10005522 3300025927 Bacteria 8365
161 Ga0207664_10202089 3300025929 Bacteria 1716
162 Ga0207644_10109523 3300025931 Bacteria 2087
163 Ga0207644_11595044 3300025931 Bacteria 547
164 Ga0207690_10155628 3300025932 Bacteria 1699
165 Ga0207706_10000564 3300025933 Bacteria 39303
166 Ga0207706_10006934 3300025933 Bacteria 10478
167 Ga0207706_10176322 3300025933 Bacteria 1878
168 Ga0207709_11662662 3300025935 Bacteria 531
169 Ga0207669_10127412 3300025937 Bacteria 1742
170 Ga0207704_10874220 3300025938 Bacteria 755
171 Ga0207704_11135126 3300025938 Bacteria 665
172 Ga0207691_10000442 3300025940 Bacteria 41154
173 Ga0207691_11348758 3300025940 Bacteria 588
174 Ga0207711_10003255 3300025941 Bacteria 14149
175 Ga0207661_10126687 3300025944 Bacteria 2182
176 Ga0207661_11122673 3300025944 Bacteria 724
177 Ga0207679_10095546 3300025945 Bacteria 2310
178 Ga0207667_10000007 3300025949 Bacteria 630590
179 Ga0207667_10031138 3300025949 Bacteria 5761
180 Ga0207667_10222023 3300025949 Bacteria 1936
181 Ga0207651_10153051 3300025960 Bacteria 1798
182 Ga0207651_10709746 3300025960 Bacteria 887
183 Ga0207651_11110353 3300025960 Bacteria 709
184 Ga0207668_10000384 3300025972 Bacteria 28142
185 Ga0207668_10329882 3300025972 Bacteria 1269
186 Ga0207668_10545565 3300025972 Bacteria 1003
187 Ga0207658_10000157 3300025986 Bacteria 71628
188 Ga0207658_10000472 3300025986 Bacteria 37417
189 Ga0207658_10119243 3300025986 Bacteria 2100
190 Ga0207658_10728638 3300025986 Bacteria 897
191 Ga0207677_10537376 3300026023 Bacteria 1017
192 Ga0207703_10002630 3300026035 Bacteria 15499
193 Ga0207639_10129139 3300026041 Bacteria 2090
194 Ga0207678_10017347 3300026067 Bacteria 6320
195 Ga0207708_10210698 3300026075 Bacteria 1553
196 Ga0207641_10000367 3300026088 Bacteria 53540
197 Ga0207641_10008059 3300026088 Bacteria 8727
198 Ga0207641_10860522 3300026088 Bacteria 899
199 Ga0207648_10017225 3300026089 Bacteria 6584
200 Ga0207648_10690533 3300026089 Bacteria 945
201 Ga0207676_10880431 3300026095 Bacteria 877
202 Ga0207674_10177146 3300026116 Bacteria 2085
203 Ga0207674_11014575 3300026116 Bacteria 799
204 Ga0207675_100002497 3300026118 Bacteria 18203
205 Ga0207675_100424628 3300026118 Bacteria 1313
206 Ga0207683_10071946 3300026121 Bacteria 3058
207 Ga0209984_1042421 3300027424 Bacteria 657
208 Ga0209983_1090951 3300027665 Bacteria 687
209 Ga0209974_10001862 3300027876 Bacteria 7700
210 Ga0209974_10162896 3300027876 Bacteria 810
211 Ga0207428_10177751 3300027907 Bacteria 1609
212 Ga0268266_10442342 3300028379 Bacteria 1235
213 Ga0268265_10025869 3300028380 Bacteria 4171
214 Ga0268265_10236119 3300028380 Bacteria 1610
215 Ga0268265_11164787 3300028380 Bacteria 767
216 Ga0268264_10000274 3300028381 Bacteria 89144
217 Ga0268264_10095827 3300028381 Bacteria 2569
218 Ga0268264_10385729 3300028381 Bacteria 1342
219 Ga0316182_1261033 3300030745 Bacteria 2386
220 Ga0265327_10102621 3300031251 Bacteria 1378
221 Ga0307513_10745518 3300031456 Bacteria 685
222 Ga0307509_10271564 3300031507 Bacteria 1463
223 Ga0307408_100194350 3300031548 Bacteria 1637
224 Ga0307408_100312206 3300031548 Bacteria 1321
225 Ga0307408_100950733 3300031548 Bacteria 789
226 Ga0307508_10002321 3300031616 Bacteria 20202
227 Ga0307405_10327078 3300031731 Bacteria 1173
228 Ga0307413_10009513 3300031824 Bacteria 4657
229 Ga0307413_10085779 3300031824 Bacteria 2034
230 Ga0307413_10508460 3300031824 Bacteria 969
231 Ga0307413_10748455 3300031824 Bacteria 817
232 Ga0307413_11452753 3300031824 Bacteria 605
233 Ga0307410_10200690 3300031852 Bacteria 1522
234 Ga0307410_10769819 3300031852 Bacteria 816
235 Ga0307410_11265806 3300031852 Bacteria 644
236 Ga0307406_10696750 3300031901 Bacteria 848
237 Ga0307406_10711787 3300031901 Bacteria 839
238 Ga0307407_10080547 3300031903 Bacteria 1968
239 Ga0307407_10115001 3300031903 Bacteria 1695
240 Ga0307412_10014391 3300031911 Bacteria 4664
241 Ga0307412_10607180 3300031911 Bacteria 927
242 Ga0307412_10969535 3300031911 Bacteria 749
243 Ga0307412_11011137 3300031911 Bacteria 735
244 Ga0307409_100014622 3300031995 Bacteria 5114
245 Ga0307409_100018094 3300031995 Bacteria 4722
246 Ga0307409_100037950 3300031995 Bacteria 3557
247 Ga0307409_101350912 3300031995 Bacteria 738
248 Ga0307409_102335356 3300031995 Bacteria 564
249 Ga0307416_100036618 3300032002 Bacteria 3765
250 Ga0307416_100169539 3300032002 Bacteria 2030
251 Ga0307416_100712587 3300032002 Bacteria 1093
252 Ga0307416_100927529 3300032002 Bacteria 972
253 Ga0307416_101317573 3300032002 Bacteria 828
254 Ga0307414_10005634 3300032004 Bacteria 6909
255 Ga0307414_10010213 3300032004 Bacteria 5437
256 Ga0307414_10138359 3300032004 Bacteria 1902
257 Ga0307414_10151143 3300032004 Bacteria 1832
258 Ga0307414_10296028 3300032004 Bacteria 1367
259 Ga0307414_10462513 3300032004 Bacteria 1115
260 Ga0307414_10531362 3300032004 Bacteria 1045
261 Ga0307414_10884027 3300032004 Bacteria 818
262 Ga0307414_10927069 3300032004 Bacteria 799
263 Ga0307414_11800050 3300032004 Bacteria 571
264 Ga0307414_11824765 3300032004 Bacteria 567
265 Ga0307411_10015185 3300032005 Bacteria 4317
266 Ga0307411_10065444 3300032005 Bacteria 2438
267 Ga0307411_10230175 3300032005 Bacteria 1444
268 Ga0307411_10768660 3300032005 Bacteria 845
269 Ga0307411_11094731 3300032005 Bacteria 718
270 Ga0307415_100014760 3300032126 Bacteria 4604
271 Ga0307415_100030780 3300032126 Bacteria 3449
272 Ga0373923_0027959 3300035111 Bacteria 2253
273 Ga0373954_0010630 3300035118 Bacteria 4065
274 Ga0373957_0033829 3300035120 Bacteria 1889
275 Ga0373955_0223838 3300035172 Unclassified 1124
276 Ga0373933_0144378 3300035724 Bacteria 1504
277 Ga0373937_0029511 3300036401 Bacteria 4967
278 Ga0395900_0615086 3300037418 Unclassified 1026
279 Ga0395905_0003773 3300037471 Bacteria 16039
280 Ga0395905_0581315 3300037471 Bacteria 1022
281 Ga0395905_0683933 3300037471 Bacteria 928
282 Ga0395901_0136278 3300038443 Bacteria 2580
283 Ga0436365_0769025 3300039437 Bacteria 8274
284 Ga0436361_0802775 3300039447 Bacteria 819
285 Ga0436363_1241024 3300039450 Bacteria 503
286 Ga0451853_2625060 3300041512 Bacteria 564
287 Ga0439448_0002038 3300042005 Bacteria 5410
288 Ga0439448_0010592 3300042005 Bacteria 2736
289 Ga0439432_109961 3300042006 Bacteria 821
290 Ga0439432_221657 3300042006 Bacteria 546
291 Ga0450912_022108 3300042116 Bacteria 621
292 Ga0439458_0000067 3300042157 Bacteria 18713
293 Ga0439458_0002116 3300042157 Bacteria 4918
294 Ga0495663_0017693 3300046525 Bacteria 2025
295 Ga0495663_0240417 3300046525 Bacteria 640
296 Ga0495621_0016474 3300046539 Bacteria 2373
297 Ga0495621_0021978 3300046539 Bacteria 2109
298 Ga0495622_0183476 3300046557 Bacteria 938
299 Ga0495633_0353749 3300046558 Bacteria 665
300 Ga0495633_0359470 3300046558 Bacteria 659
301 Ga0495625_0000078 3300046660 Bacteria 161613
302 Ga0495659_0022689 3300046664 Bacteria 2126
303 Ga0495659_0028337 3300046664 Bacteria 1938
304 Ga0495669_0027860 3300046684 Bacteria 2472
305 Ga0495669_0468951 3300046684 Bacteria 612
306 Ga0495670_0037606 3300046691 Bacteria 2412
307 Ga0495670_0042328 3300046691 Bacteria 2272
308 Ga0495670_0336532 3300046691 Bacteria 811
309 Ga0495677_0011359 3300047445 Bacteria 3260
310 Ga0495673_0000697 3300047469 Bacteria 32802
311 Ga0496100_1513101 3300048903 Bacteria 530
312 Ga0496102_1696172 3300048905 Bacteria 550
313 Ga0496109_0973312 3300048912 Bacteria 786
314 Ga0496110_0202015 3300048913 Bacteria 1806
315 Ga0496110_1194681 3300048913 Bacteria 669
316 Ga0496111_0068462 3300048914 Bacteria 2580
317 Ga0496114_0126297 3300048917 Bacteria 2205
318 Ga0496115_0847830 3300048918 Bacteria 708
319 Ga0496115_1186796 3300048918 Bacteria 574
320 Ga0496117_0033106 3300048920 Bacteria 3913
321 Ga0496118_0019557 3300048921 Bacteria 6047
322 Ga0496118_0307297 3300048921 Bacteria 867
323 Ga0496119_0036552 3300048922 Bacteria 3204
324 Ga0496121_0001326 3300048924 Bacteria 42390
325 Ga0496121_0062008 3300048924 Bacteria 3065
326 Ga0496124_0384557 3300048927 Bacteria 980
327 Ga0496126_0102342 3300048929 Bacteria 2504
328 Ga0501032_1008297 3300049569 Bacteria 523
329 Ga0501033_0141461 3300049570 Bacteria 1739
330 Ga0501043_0082821 3300049579 Bacteria 2522
331 Ga0501047_0276158 3300049581 Bacteria 1526
332 Ga0501048_0866263 3300049582 Bacteria 649
333 Ga0501198_032402 3300049649 Bacteria 878
334 Ga0501249_021895 3300049679 Bacteria 1397
335 Ga0501249_084105 3300049679 Bacteria 750
336 Ga0501263_079680 3300049760 Unclassified 539
337 Ga0501272_061475 3300049769 Bacteria 537
338 Ga0501035_0512661 3300049822 Bacteria 986
339 Ga0501044_0407003 3300049823 Bacteria 1272
340 Ga0501044_1417302 3300049823 Unclassified 560
341 nmdc:mga06r32_87677_c1 3300050510 Bacteria 3037
342 Ga0495612_0100557 3300053078 Unclassified 1231
343 Ga0500595_061900 3300053119 Bacteria 1128
344 Ga0500559_0027456 3300053136 Bacteria 2429
345 Ga0500559_0117489 3300053136 Bacteria 1235
346 Ga0500559_0162563 3300053136 Bacteria 1049
347 Ga0500645_080722 3300053730 Bacteria 928

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_102410218 Ga0070665_1024102181 104
2 3300009551 Ga0105238_10016482 Ga0105238_100164821 106
3 3300048918 Ga0496115_1186796 Ga0496115_1186796_212_562 110
4 iso_pu_bacteria 2738541275 2738711055 112
5 iso_pu_bacteria 2738541301 2738849480 112
6 iso_pu_bacteria 2738541304 2738865209 112
7 iso_pu_bacteria 2738543022 2739297727 112
8 iso_pu_bacteria 2738543033 2739359405 112
9 iso_pu_bacteria 2928100450 2928103668 112
10 iso_pu_bacteria 2928959182 2928961319 112
11 3300002244 JGI24742J22300_10031988 JGI24742J22300_100319882 115
12 3300005457 Ga0070662_100705129 Ga0070662_1007051292 115
13 3300005563 Ga0068855_100000239 Ga0068855_10000023960 115
14 3300005578 Ga0068854_100027408 Ga0068854_1000274082 115
15 3300009551 Ga0105238_10540024 Ga0105238_105400242 115
16 3300025949 Ga0207667_10000007 Ga0207667_10000007187 115
17 3300001989 JGI24739J22299_10083274 JGI24739J22299_100832742 116
18 3300001989 JGI24739J22299_10083746 JGI24739J22299_100837462 116
19 3300001990 JGI24737J22298_10064893 JGI24737J22298_100648932 116
20 3300001990 JGI24737J22298_10145979 JGI24737J22298_101459792 116
21 3300002067 JGI24735J21928_10069269 JGI24735J21928_100692693 116
22 3300003791 Ga0055530_10004432 Ga0055530_100044326 116
23 3300003794 Ga0055531_10091453 Ga0055531_100914531 116
24 3300005290 Ga0065712_10290102 Ga0065712_102901021 116
25 3300005293 Ga0065715_10004658 Ga0065715_100046582 116
26 3300005295 Ga0065707_10146283 Ga0065707_101462831 116
27 3300005327 Ga0070658_10097798 Ga0070658_100977982 116
28 3300005327 Ga0070658_10522144 Ga0070658_105221442 116
29 3300005328 Ga0070676_10243223 Ga0070676_102432232 116
30 3300005329 Ga0070683_100228907 Ga0070683_1002289072 116
31 3300005331 Ga0070670_100026855 Ga0070670_1000268552 116
32 3300005331 Ga0070670_101082507 Ga0070670_1010825071 116
33 3300005333 Ga0070677_10003222 Ga0070677_100032223 116
34 3300005334 Ga0068869_101841497 Ga0068869_1018414972 116
35 3300005335 Ga0070666_10008002 Ga0070666_100080023 116
36 3300005335 Ga0070666_10409942 Ga0070666_104099422 116
37 3300005336 Ga0070680_100957175 Ga0070680_1009571752 116
38 3300005337 Ga0070682_100444475 Ga0070682_1004444752 116
39 3300005343 Ga0070687_100985622 Ga0070687_1009856221 116
40 3300005344 Ga0070661_101105451 Ga0070661_1011054512 116
41 3300005345 Ga0070692_10023723 Ga0070692_100237231 116
42 3300005345 Ga0070692_11194788 Ga0070692_111947881 116
43 3300005347 Ga0070668_100000868 Ga0070668_1000008684 116
44 3300005347 Ga0070668_100084344 Ga0070668_1000843442 116
45 3300005353 Ga0070669_100006207 Ga0070669_1000062073 116
46 3300005353 Ga0070669_100033281 Ga0070669_1000332812 116
47 3300005354 Ga0070675_100018802 Ga0070675_1000188022 116
48 3300005355 Ga0070671_100015421 Ga0070671_1000154212 116
49 3300005355 Ga0070671_100057136 Ga0070671_1000571362 116
50 3300005356 Ga0070674_100022757 Ga0070674_1000227572 116
51 3300005364 Ga0070673_100015363 Ga0070673_1000153633 116
52 3300005364 Ga0070673_101151284 Ga0070673_1011512841 116
53 3300005366 Ga0070659_100112789 Ga0070659_1001127892 116
54 3300005366 Ga0070659_100619054 Ga0070659_1006190542 116
55 3300005367 Ga0070667_100000197 Ga0070667_1000001978 116
56 3300005367 Ga0070667_100000548 Ga0070667_1000005484 116
57 3300005367 Ga0070667_100558308 Ga0070667_1005583082 116
58 3300005367 Ga0070667_100824799 Ga0070667_1008247992 116
59 3300005438 Ga0070701_10680697 Ga0070701_106806972 116
60 3300005444 Ga0070694_101547706 Ga0070694_1015477062 116
61 3300005455 Ga0070663_100061631 Ga0070663_1000616312 116
62 3300005456 Ga0070678_100047551 Ga0070678_1000475512 116
63 3300005457 Ga0070662_100001740 Ga0070662_1000017401 116
64 3300005457 Ga0070662_100004921 Ga0070662_1000049217 116
65 3300005457 Ga0070662_100310248 Ga0070662_1003102481 116
66 3300005457 Ga0070662_100388229 Ga0070662_1003882292 116
67 3300005458 Ga0070681_10249122 Ga0070681_102491222 116
68 3300005466 Ga0070685_10528009 Ga0070685_105280092 116
69 3300005539 Ga0068853_100131722 Ga0068853_1001317222 116
70 3300005543 Ga0070672_100056514 Ga0070672_1000565142 116
71 3300005548 Ga0070665_100245214 Ga0070665_1002452142 116
72 3300005548 Ga0070665_101296396 Ga0070665_1012963962 116
73 3300005563 Ga0068855_100073461 Ga0068855_1000734612 116
74 3300005563 Ga0068855_100121664 Ga0068855_1001216643 116
75 3300005563 Ga0068855_100259590 Ga0068855_1002595902 116
76 3300005563 Ga0068855_102239170 Ga0068855_1022391701 116
77 3300005564 Ga0070664_100058892 Ga0070664_1000588924 116
78 3300005577 Ga0068857_100449843 Ga0068857_1004498433 116
79 3300005578 Ga0068854_100427630 Ga0068854_1004276302 116
80 3300005615 Ga0070702_100383399 Ga0070702_1003833992 116
81 3300005616 Ga0068852_100696428 Ga0068852_1006964282 116
82 3300005617 Ga0068859_100012049 Ga0068859_10001204910 116
83 3300005617 Ga0068859_100189268 Ga0068859_1001892682 116
84 3300005618 Ga0068864_100203157 Ga0068864_1002031571 116
85 3300005718 Ga0068866_10819477 Ga0068866_108194771 116
86 3300005719 Ga0068861_100026293 Ga0068861_1000262932 116
87 3300005719 Ga0068861_100708135 Ga0068861_1007081352 116
88 3300005719 Ga0068861_101666990 Ga0068861_1016669902 116
89 3300005840 Ga0068870_10092093 Ga0068870_100920932 116
90 3300005841 Ga0068863_100000225 Ga0068863_10000022523 116
91 3300005841 Ga0068863_100020369 Ga0068863_1000203694 116
92 3300005841 Ga0068863_100039045 Ga0068863_1000390452 116
93 3300005842 Ga0068858_101145759 Ga0068858_1011457592 116
94 3300005843 Ga0068860_100000290 Ga0068860_1000002908 116
95 3300005843 Ga0068860_100046668 Ga0068860_1000466683 116
96 3300005843 Ga0068860_100649251 Ga0068860_1006492512 116
97 3300005843 Ga0068860_100732442 Ga0068860_1007324422 116
98 3300005844 Ga0068862_100117307 Ga0068862_1001173073 116
99 3300005844 Ga0068862_100183711 Ga0068862_1001837112 116
100 3300005844 Ga0068862_101143459 Ga0068862_1011434592 116
101 3300006237 Ga0097621_100138560 Ga0097621_1001385602 116
102 3300006237 Ga0097621_100187021 Ga0097621_1001870212 116
103 3300006847 Ga0075431_100109691 Ga0075431_1001096913 116
104 3300006881 Ga0068865_100955088 Ga0068865_1009550881 116
105 3300006931 Ga0097620_100012049 Ga0097620_1000120493 116
106 3300006931 Ga0097620_100189256 Ga0097620_1001892562 116
107 3300009093 Ga0105240_10090147 Ga0105240_100901474 116
108 3300009093 Ga0105240_10261260 Ga0105240_102612602 116
109 3300009093 Ga0105240_10340527 Ga0105240_103405273 116
110 3300009094 Ga0111539_10152043 Ga0111539_101520432 116
111 3300009098 Ga0105245_10000480 Ga0105245_100004808 116
112 3300009148 Ga0105243_10142080 Ga0105243_101420802 116
113 3300009148 Ga0105243_10226286 Ga0105243_102262862 116
114 3300009148 Ga0105243_10819238 Ga0105243_108192382 116
115 3300009176 Ga0105242_10694473 Ga0105242_106944731 116
116 3300009177 Ga0105248_10002018 Ga0105248_100020185 116
117 3300009177 Ga0105248_10238378 Ga0105248_102383782 116
118 3300009553 Ga0105249_10012480 Ga0105249_100124801 116
119 3300009979 Ga0105032_106023 Ga0105032_1060232 116
120 3300010375 Ga0105239_10000060 Ga0105239_10000060117 116
121 3300010375 Ga0105239_10435569 Ga0105239_104355692 116
122 3300010375 Ga0105239_10962651 Ga0105239_109626512 116
123 3300013100 Ga0157373_10129498 Ga0157373_101294982 116
124 3300013102 Ga0157371_10426750 Ga0157371_104267502 116
125 3300013105 Ga0157369_10148553 Ga0157369_101485532 116
126 3300013296 Ga0157374_10101317 Ga0157374_101013173 116
127 3300013297 Ga0157378_10335909 Ga0157378_103359091 116
128 3300013306 Ga0163162_12375741 Ga0163162_123757412 116
129 3300013308 Ga0157375_10122417 Ga0157375_101224172 116
130 3300013308 Ga0157375_11050530 Ga0157375_110505302 116
131 3300014326 Ga0157380_10005946 Ga0157380_1000594615 116
132 3300014326 Ga0157380_10600729 Ga0157380_106007292 116
133 3300014326 Ga0157380_10909768 Ga0157380_109097682 116
134 3300014326 Ga0157380_11130978 Ga0157380_111309782 116
135 3300014745 Ga0157377_10287938 Ga0157377_102879382 116
136 3300017792 Ga0163161_10086115 Ga0163161_100861152 116
137 3300017792 Ga0163161_10258024 Ga0163161_102580242 116
138 3300020070 Ga0206356_11205880 Ga0206356_112058802 116
139 3300021384 Ga0213876_10007342 Ga0213876_100073423 116
140 3300025231 Ga0207427_112809 Ga0207427_1128092 116
141 3300025233 Ga0209437_119408 Ga0209437_1194082 116
142 3300025261 Ga0209233_1000142 Ga0209233_100014223 116
143 3300025292 Ga0209676_1000704 Ga0209676_100070420 116
144 3300025298 Ga0209050_1001078 Ga0209050_100107820 116
145 3300025303 Ga0209051_1007655 Ga0209051_10076555 116
146 3300025304 Ga0209257_1025143 Ga0209257_10251432 116
147 3300025315 Ga0207697_10001912 Ga0207697_100019125 116
148 3300025893 Ga0207682_10000039 Ga0207682_1000003952 116
149 3300025903 Ga0207680_10015870 Ga0207680_100158702 116
150 3300025903 Ga0207680_10880795 Ga0207680_108807952 116
151 3300025904 Ga0207647_10000373 Ga0207647_100003736 116
152 3300025907 Ga0207645_10033981 Ga0207645_100339813 116
153 3300025908 Ga0207643_10203681 Ga0207643_102036812 116
154 3300025909 Ga0207705_10077764 Ga0207705_100777642 116
155 3300025909 Ga0207705_10859925 Ga0207705_108599252 116
156 3300025913 Ga0207695_10118467 Ga0207695_101184674 116
157 3300025913 Ga0207695_10694728 Ga0207695_106947282 116
158 3300025918 Ga0207662_11032648 Ga0207662_110326482 116
159 3300025923 Ga0207681_10005659 Ga0207681_100056592 116
160 3300025923 Ga0207681_10011029 Ga0207681_100110293 116
161 3300025923 Ga0207681_10031205 Ga0207681_100312051 116
162 3300025923 Ga0207681_11735947 Ga0207681_117359471 116
163 3300025924 Ga0207694_10125233 Ga0207694_101252335 116
164 3300025925 Ga0207650_10009932 Ga0207650_100099327 116
165 3300025925 Ga0207650_10489102 Ga0207650_104891022 116
166 3300025925 Ga0207650_11547054 Ga0207650_115470542 116
167 3300025926 Ga0207659_10130563 Ga0207659_101305632 116
168 3300025926 Ga0207659_10456507 Ga0207659_104565072 116
169 3300025927 Ga0207687_10005522 Ga0207687_100055222 116
170 3300025929 Ga0207664_10202089 Ga0207664_102020894 116
171 3300025931 Ga0207644_10109523 Ga0207644_101095234 116
172 3300025931 Ga0207644_11595044 Ga0207644_115950442 116
173 3300025932 Ga0207690_10155628 Ga0207690_101556283 116
174 3300025933 Ga0207706_10000564 Ga0207706_1000056415 116
175 3300025933 Ga0207706_10006934 Ga0207706_100069345 116
176 3300025933 Ga0207706_10176322 Ga0207706_101763222 116
177 3300025935 Ga0207709_11662662 Ga0207709_116626622 116
178 3300025937 Ga0207669_10127412 Ga0207669_101274122 116
179 3300025938 Ga0207704_10874220 Ga0207704_108742202 116
180 3300025938 Ga0207704_11135126 Ga0207704_111351262 116
181 3300025940 Ga0207691_10000442 Ga0207691_1000044216 116
182 3300025940 Ga0207691_11348758 Ga0207691_113487582 116
183 3300025941 Ga0207711_10003255 Ga0207711_100032557 116
184 3300025944 Ga0207661_10126687 Ga0207661_101266872 116
185 3300025944 Ga0207661_11122673 Ga0207661_111226732 116
186 3300025945 Ga0207679_10095546 Ga0207679_100955462 116
187 3300025949 Ga0207667_10031138 Ga0207667_100311384 116
188 3300025949 Ga0207667_10222023 Ga0207667_102220232 116
189 3300025960 Ga0207651_10153051 Ga0207651_101530512 116
190 3300025960 Ga0207651_10709746 Ga0207651_107097462 116
191 3300025960 Ga0207651_11110353 Ga0207651_111103532 116
192 3300025972 Ga0207668_10000384 Ga0207668_100003842 116
193 3300025972 Ga0207668_10329882 Ga0207668_103298822 116
194 3300025972 Ga0207668_10545565 Ga0207668_105455652 116
195 3300025986 Ga0207658_10000157 Ga0207658_100001578 116
196 3300025986 Ga0207658_10000472 Ga0207658_1000047223 116
197 3300025986 Ga0207658_10119243 Ga0207658_101192432 116
198 3300025986 Ga0207658_10728638 Ga0207658_107286382 116
199 3300026023 Ga0207677_10537376 Ga0207677_105373762 116
200 3300026035 Ga0207703_10002630 Ga0207703_100026302 116
201 3300026041 Ga0207639_10129139 Ga0207639_101291393 116
202 3300026067 Ga0207678_10017347 Ga0207678_100173477 116
203 3300026075 Ga0207708_10210698 Ga0207708_102106981 116
204 3300026088 Ga0207641_10000367 Ga0207641_1000036723 116
205 3300026088 Ga0207641_10008059 Ga0207641_100080596 116
206 3300026088 Ga0207641_10860522 Ga0207641_108605222 116
207 3300026089 Ga0207648_10017225 Ga0207648_100172252 116
208 3300026089 Ga0207648_10690533 Ga0207648_106905332 116
209 3300026095 Ga0207676_10880431 Ga0207676_108804311 116
210 3300026116 Ga0207674_10177146 Ga0207674_101771462 116
211 3300026116 Ga0207674_11014575 Ga0207674_110145752 116
212 3300026118 Ga0207675_100002497 Ga0207675_10000249710 116
213 3300026118 Ga0207675_100424628 Ga0207675_1004246282 116
214 3300026121 Ga0207683_10071946 Ga0207683_100719462 116
215 3300027424 Ga0209984_1042421 Ga0209984_10424211 116
216 3300027665 Ga0209983_1090951 Ga0209983_10909512 116
217 3300027876 Ga0209974_10001862 Ga0209974_100018628 116
218 3300027876 Ga0209974_10162896 Ga0209974_101628962 116
219 3300027907 Ga0207428_10177751 Ga0207428_101777512 116
220 3300028379 Ga0268266_10442342 Ga0268266_104423421 116
221 3300028380 Ga0268265_10025869 Ga0268265_100258694 116
222 3300028380 Ga0268265_10236119 Ga0268265_102361192 116
223 3300028380 Ga0268265_11164787 Ga0268265_111647872 116
224 3300028381 Ga0268264_10000274 Ga0268264_1000027474 116
225 3300028381 Ga0268264_10095827 Ga0268264_100958271 116
226 3300028381 Ga0268264_10385729 Ga0268264_103857292 116
227 3300030745 Ga0316182_1261033 Ga0316182_12610333 116
228 3300031251 Ga0265327_10102621 Ga0265327_101026212 116
229 3300031456 Ga0307513_10745518 Ga0307513_107455182 116
230 3300031507 Ga0307509_10271564 Ga0307509_102715642 116
231 3300031548 Ga0307408_100194350 Ga0307408_1001943502 116
232 3300031548 Ga0307408_100312206 Ga0307408_1003122063 116
233 3300031548 Ga0307408_100950733 Ga0307408_1009507331 116
234 3300031616 Ga0307508_10002321 Ga0307508_1000232124 116
235 3300031731 Ga0307405_10327078 Ga0307405_103270782 116
236 3300031824 Ga0307413_10009513 Ga0307413_100095135 116
237 3300031824 Ga0307413_10085779 Ga0307413_100857793 116
238 3300031824 Ga0307413_10508460 Ga0307413_105084602 116
239 3300031824 Ga0307413_10748455 Ga0307413_107484552 116
240 3300031824 Ga0307413_11452753 Ga0307413_114527532 116
241 3300031852 Ga0307410_10200690 Ga0307410_102006903 116
242 3300031852 Ga0307410_10769819 Ga0307410_107698192 116
243 3300031852 Ga0307410_11265806 Ga0307410_112658061 116
244 3300031901 Ga0307406_10696750 Ga0307406_106967502 116
245 3300031901 Ga0307406_10711787 Ga0307406_107117872 116
246 3300031903 Ga0307407_10080547 Ga0307407_100805473 116
247 3300031903 Ga0307407_10115001 Ga0307407_101150012 116
248 3300031911 Ga0307412_10014391 Ga0307412_100143914 116
249 3300031911 Ga0307412_10607180 Ga0307412_106071802 116
250 3300031911 Ga0307412_10969535 Ga0307412_109695353 116
251 3300031911 Ga0307412_11011137 Ga0307412_110111371 116
252 3300031995 Ga0307409_100014622 Ga0307409_1000146224 116
253 3300031995 Ga0307409_100018094 Ga0307409_1000180944 116
254 3300031995 Ga0307409_100037950 Ga0307409_1000379503 116
255 3300031995 Ga0307409_101350912 Ga0307409_1013509121 116
256 3300031995 Ga0307409_102335356 Ga0307409_1023353561 116
257 3300032002 Ga0307416_100036618 Ga0307416_1000366182 116
258 3300032002 Ga0307416_100169539 Ga0307416_1001695391 116
259 3300032002 Ga0307416_100712587 Ga0307416_1007125871 116
260 3300032002 Ga0307416_100927529 Ga0307416_1009275291 116
261 3300032002 Ga0307416_101317573 Ga0307416_1013175732 116
262 3300032004 Ga0307414_10005634 Ga0307414_100056342 116
263 3300032004 Ga0307414_10010213 Ga0307414_100102135 116
264 3300032004 Ga0307414_10138359 Ga0307414_101383592 116
265 3300032004 Ga0307414_10151143 Ga0307414_101511433 116
266 3300032004 Ga0307414_10296028 Ga0307414_102960282 116
267 3300032004 Ga0307414_10462513 Ga0307414_104625132 116
268 3300032004 Ga0307414_10531362 Ga0307414_105313622 116
269 3300032004 Ga0307414_10884027 Ga0307414_108840272 116
270 3300032004 Ga0307414_10927069 Ga0307414_109270691 116
271 3300032004 Ga0307414_11800050 Ga0307414_118000501 116
272 3300032004 Ga0307414_11824765 Ga0307414_118247651 116
273 3300032005 Ga0307411_10015185 Ga0307411_100151853 116
274 3300032005 Ga0307411_10065444 Ga0307411_100654443 116
275 3300032005 Ga0307411_10230175 Ga0307411_102301751 116
276 3300032005 Ga0307411_10768660 Ga0307411_107686601 116
277 3300032005 Ga0307411_11094731 Ga0307411_110947312 116
278 3300032126 Ga0307415_100014760 Ga0307415_1000147602 116
279 3300032126 Ga0307415_100030780 Ga0307415_1000307807 116
280 3300035111 Ga0373923_0027959 Ga0373923_0027959_848_1198 116
281 3300035118 Ga0373954_0010630 Ga0373954_0010630_2836_3186 116
282 3300035120 Ga0373957_0033829 Ga0373957_0033829_98_448 116
283 3300035172 Ga0373955_0223838 Ga0373955_0223838_166_516 116
284 3300035724 Ga0373933_0144378 Ga0373933_0144378_106_456 116
285 3300036401 Ga0373937_0029511 Ga0373937_0029511_4492_4842 116
286 3300037418 Ga0395900_0615086 Ga0395900_0615086_400_750 116
287 3300037471 Ga0395905_0003773 Ga0395905_0003773_6422_6772 116
288 3300037471 Ga0395905_0581315 Ga0395905_0581315_359_709 116
289 3300037471 Ga0395905_0683933 Ga0395905_0683933_45_395 116
290 3300038443 Ga0395901_0136278 Ga0395901_0136278_534_884 116
291 3300039437 Ga0436365_0769025 Ga0436365_0769025_2122_2472 116
292 3300039447 Ga0436361_0802775 Ga0436361_0802775_242_592 116
293 3300039450 Ga0436363_1241024 Ga0436363_1241024_31_381 116
294 3300041512 Ga0451853_2625060 Ga0451853_2625060_144_494 116
295 3300042005 Ga0439448_0002038 Ga0439448_0002038_789_1139 116
296 3300042005 Ga0439448_0010592 Ga0439448_0010592_2052_2402 116
297 3300042006 Ga0439432_109961 Ga0439432_109961_17_367 116
298 3300042006 Ga0439432_221657 Ga0439432_221657_12_362 116
299 3300042116 Ga0450912_022108 Ga0450912_022108_239_589 116
300 3300042157 Ga0439458_0000067 Ga0439458_0000067_11429_11779 116
301 3300042157 Ga0439458_0002116 Ga0439458_0002116_1258_1608 116
302 3300046525 Ga0495663_0017693 Ga0495663_0017693_1498_1848 116
303 3300046525 Ga0495663_0240417 Ga0495663_0240417_15_365 116
304 3300046539 Ga0495621_0016474 Ga0495621_0016474_1232_1582 116
305 3300046539 Ga0495621_0021978 Ga0495621_0021978_1007_1357 116
306 3300046557 Ga0495622_0183476 Ga0495622_0183476_550_900 116
307 3300046558 Ga0495633_0353749 Ga0495633_0353749_91_441 116
308 3300046558 Ga0495633_0359470 Ga0495633_0359470_130_480 116
309 3300046660 Ga0495625_0000078 Ga0495625_0000078_32509_32862 116
310 3300046664 Ga0495659_0022689 Ga0495659_0022689_1661_2011 116
311 3300046664 Ga0495659_0028337 Ga0495659_0028337_1082_1432 116
312 3300046684 Ga0495669_0027860 Ga0495669_0027860_504_854 116
313 3300046684 Ga0495669_0468951 Ga0495669_0468951_250_600 116
314 3300046691 Ga0495670_0037606 Ga0495670_0037606_1786_2136 116
315 3300046691 Ga0495670_0042328 Ga0495670_0042328_1383_1733 116
316 3300046691 Ga0495670_0336532 Ga0495670_0336532_191_541 116
317 3300047445 Ga0495677_0011359 Ga0495677_0011359_1411_1761 116
318 3300047469 Ga0495673_0000697 Ga0495673_0000697_26053_26403 116
319 3300048903 Ga0496100_1513101 Ga0496100_1513101_80_430 116
320 3300048905 Ga0496102_1696172 Ga0496102_1696172_45_395 116
321 3300048912 Ga0496109_0973312 Ga0496109_0973312_189_539 116
322 3300048913 Ga0496110_0202015 Ga0496110_0202015_1018_1410 116
323 3300048913 Ga0496110_1194681 Ga0496110_1194681_262_612 116
324 3300048914 Ga0496111_0068462 Ga0496111_0068462_570_962 116
325 3300048917 Ga0496114_0126297 Ga0496114_0126297_455_847 116
326 3300048918 Ga0496115_0847830 Ga0496115_0847830_106_465 116
327 3300048920 Ga0496117_0033106 Ga0496117_0033106_2648_2998 116
328 3300048921 Ga0496118_0019557 Ga0496118_0019557_2231_2581 116
329 3300048921 Ga0496118_0307297 Ga0496118_0307297_372_731 116
330 3300048922 Ga0496119_0036552 Ga0496119_0036552_1152_1502 116
331 3300048924 Ga0496121_0001326 Ga0496121_0001326_1663_2022 116
332 3300048924 Ga0496121_0062008 Ga0496121_0062008_1987_2337 116
333 3300048927 Ga0496124_0384557 Ga0496124_0384557_102_452 116
334 3300048929 Ga0496126_0102342 Ga0496126_0102342_1609_1968 116
335 3300049569 Ga0501032_1008297 Ga0501032_1008297_161_511 116
336 3300049570 Ga0501033_0141461 Ga0501033_0141461_1225_1575 116
337 3300049579 Ga0501043_0082821 Ga0501043_0082821_536_886 116
338 3300049581 Ga0501047_0276158 Ga0501047_0276158_969_1319 116
339 3300049582 Ga0501048_0866263 Ga0501048_0866263_288_638 116
340 3300049649 Ga0501198_032402 Ga0501198_032402_21_371 116
341 3300049679 Ga0501249_021895 Ga0501249_021895_635_985 116
342 3300049679 Ga0501249_084105 Ga0501249_084105_227_577 116
343 3300049760 Ga0501263_079680 Ga0501263_079680_100_450 116
344 3300049769 Ga0501272_061475 Ga0501272_061475_142_492 116
345 3300049822 Ga0501035_0512661 Ga0501035_0512661_383_733 116
346 3300049823 Ga0501044_0407003 Ga0501044_0407003_354_704 116
347 3300049823 Ga0501044_1417302 Ga0501044_1417302_149_499 116
348 3300050510 nmdc:mga06r32_87677_c1 nmdc:mga06r32_87677_c1_1545_1895 116
349 3300053078 Ga0495612_0100557 Ga0495612_0100557_329_679 116
350 3300053119 Ga0500595_061900 Ga0500595_061900_306_656 116
351 3300053136 Ga0500559_0027456 Ga0500559_0027456_1627_1977 116
352 3300053136 Ga0500559_0117489 Ga0500559_0117489_828_1178 116
353 3300053136 Ga0500559_0162563 Ga0500559_0162563_210_560 116
354 3300053730 Ga0500645_080722 Ga0500645_080722_347_697 116

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c5q-assembly1.cif.gz_B crystal structure of yeast yer010cp 0.7804 59 98
8f4r-assembly1.cif.gz_C gentamicin bound aminoglycoside efflux pump acrd 0.4926 9 106
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.4691 9 101
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.4512 9 101
4brb-assembly2.cif.gz_E crystal structure of the integral membrane enzyme dgka-ref, delta 7 0.4371 37 109
ID Description Score Start End Superfamily
af_Q2FUQ7_4_112_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7375 12 110 1.10.10.1740
af_Q2FUQ7_4_112_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.677 12 110 1.10.10.1740
af_Q2FUQ6_7_117_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6699 9 106 1.10.10.1740
af_Q2FUQ6_7_117_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6065 9 106 1.10.10.1740
5d56C00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.554 36 113 1.10.287.3610
ID Description Score Start End GO Terms
AF-A0A3S0R4L8-F1-model_v4 DUF3147 family protein 0.9354 1 116 GO:0016020
AF-A0A1V1V2P5-F1-model_v4 DUF3147 family protein 0.935 1 116 GO:0016020
AF-B0T6A3-F1-model_v4 Peptide ABC transporter permease 0.9307 1 116 GO:0016020
AF-A0A844Y3C9-F1-model_v4 DUF3147 family protein 0.9293 15 116 GO:0016020
AF-A0A4R7DQI2-F1-model_v4 deleted 0.9269 3 114

Feature Viewer

pLDDT pTM Quality
89.05 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map