F419653

General Info

Members Datasets Scaffolds Average Seq Length
354 202 708 190

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10008217|Ga0070709_100082172
Length 221
Sequence MLRAKPFRRATAATDAKQRPGFQNSTPAACAPQMSEDLLALFRKTGALLDGHFVLRSGLHSREYFQCALLLQHTEIAAKVCGRLADKVRKFNCDTVISPALGGIIVGQEVGRSLGKRHIFVEKEEGKLVLRRGFQISPNEKFVVVEDVVTRGGRVQETIDIVRAHGGIVSAVGVIVDRSGAAKPDFGCPFASLIEMNMETFPADNLPSDLAKIPAVKPGSK

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
150 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
202 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 1.69
Rhizosphere 95.2
Stem 0
Stem Tuber 0
Unclassified 16.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10008217 3300005434 Bacteria 5732
2 SwRhRL2b_contig_2742384 2162886007 Bacteria 1000
3 MBSR1b_contig_11670001 2162886012 Bacteria 837
4 rootH2_10310919 3300003320 Bacteria 1761
5 rootL2_10103863 3300003322 Bacteria 10567
6 Ga0065703_1018946 3300005272 Bacteria 4839
7 Ga0065704_10006717 3300005289 Bacteria 3022
8 Ga0065704_10080585 3300005289 Bacteria 3919
9 Ga0065704_10151491 3300005289 Bacteria 1425
10 Ga0065712_10161874 3300005290 Bacteria 1297
11 Ga0065712_10199873 3300005290 Bacteria 1113
12 Ga0065715_10000421 3300005293 Bacteria 13595
13 Ga0065707_10392183 3300005295 Bacteria 863
14 Ga0070658_10467387 3300005327 Unclassified 1088
15 Ga0070658_10482515 3300005327 Bacteria 1070
16 Ga0070676_10076550 3300005328 Unclassified 2020
17 Ga0070676_10077305 3300005328 Bacteria 2011
18 Ga0070676_10160843 3300005328 Bacteria 1445
19 Ga0070683_100065580 3300005329 Bacteria 3381
20 Ga0070670_100094569 3300005331 Bacteria 2570
21 Ga0070670_100352935 3300005331 Unclassified 1292
22 Ga0070670_100599139 3300005331 Bacteria 986
23 Ga0070670_101048000 3300005331 Bacteria 743
24 Ga0070666_10017145 3300005335 Unclassified 4642
25 Ga0070666_10024577 3300005335 Bacteria 3926
26 Ga0070666_10069414 3300005335 Bacteria 2396
27 Ga0070660_100409916 3300005339 Unclassified 1121
28 Ga0070660_101089797 3300005339 Bacteria 676
29 Ga0070689_100015602 3300005340 Bacteria 5544
30 Ga0070668_100042150 3300005347 Bacteria 3498
31 Ga0070668_100295765 3300005347 Bacteria 1356
32 Ga0070669_100023536 3300005353 Bacteria 4409
33 Ga0070669_100200506 3300005353 Unclassified 1570
34 Ga0070669_100307413 3300005353 Unclassified 1277
35 Ga0070675_100011832 3300005354 Bacteria 6837
36 Ga0070675_100642025 3300005354 Bacteria 964
37 Ga0070671_100013870 3300005355 Bacteria 6501
38 Ga0070671_100114408 3300005355 Bacteria 2268
39 Ga0070674_100009944 3300005356 Bacteria 5726
40 Ga0070673_100007746 3300005364 Bacteria 7107
41 Ga0070673_100147459 3300005364 Bacteria 1990
42 Ga0070688_100175086 3300005365 Bacteria 1484
43 Ga0070688_100387446 3300005365 Bacteria 1032
44 Ga0070688_100872890 3300005365 Unclassified 708
45 Ga0070659_100399578 3300005366 Unclassified 1160
46 Ga0070667_100090804 3300005367 Bacteria 2626
47 Ga0070714_100028795 3300005435 Bacteria 4612
48 Ga0070713_100534155 3300005436 Bacteria 1109
49 Ga0070710_10050272 3300005437 Bacteria 2336
50 Ga0070710_10170545 3300005437 Bacteria 1355
51 Ga0070711_100085444 3300005439 Bacteria 2260
52 Ga0070711_100121146 3300005439 Bacteria 1935
53 Ga0070711_100180105 3300005439 Bacteria 1618
54 Ga0070711_100231049 3300005439 Bacteria 1442
55 Ga0070711_100233226 3300005439 Bacteria 1436
56 Ga0070705_100108641 3300005440 Bacteria 1767
57 Ga0070708_100024411 3300005445 Bacteria 5158
58 Ga0070708_100035413 3300005445 Bacteria 4349
59 Ga0070708_100041822 3300005445 Bacteria 4020
60 Ga0070708_100098748 3300005445 Bacteria 2670
61 Ga0070708_100244067 3300005445 Bacteria 1686
62 Ga0070708_100298223 3300005445 Bacteria 1517
63 Ga0070678_100099366 3300005456 Unclassified 2252
64 Ga0068867_100047461 3300005459 Bacteria 3157
65 Ga0070685_10111433 3300005466 Unclassified 1686
66 Ga0070706_100000035 3300005467 Bacteria 152107
67 Ga0070706_100013032 3300005467 Bacteria 7693
68 Ga0070706_100020122 3300005467 Bacteria 6150
69 Ga0070706_100126647 3300005467 Unclassified 2382
70 Ga0070706_100133141 3300005467 Bacteria 2320
71 Ga0070706_100339360 3300005467 Bacteria 1401
72 Ga0070707_100002278 3300005468 Bacteria 18346
73 Ga0070707_100010859 3300005468 Bacteria 8481
74 Ga0070707_100027638 3300005468 Bacteria 5396
75 Ga0070707_100036698 3300005468 Bacteria 4677
76 Ga0070707_100050118 3300005468 Bacteria 4002
77 Ga0070707_100193204 3300005468 Unclassified 1985
78 Ga0070707_100338122 3300005468 Unclassified 1463
79 Ga0070707_100506935 3300005468 Bacteria 1168
80 Ga0070707_101192025 3300005468 Unclassified 728
81 Ga0070707_101240547 3300005468 Unclassified 712
82 Ga0070707_101484443 3300005468 Bacteria 645
83 Ga0070698_100004983 3300005471 Bacteria 14549
84 Ga0070698_100006835 3300005471 Bacteria 12359
85 Ga0070698_100052592 3300005471 Bacteria 4143
86 Ga0070698_100387100 3300005471 Bacteria 1331
87 Ga0070699_100120222 3300005518 Bacteria 2309
88 Ga0070699_100229532 3300005518 Bacteria 1655
89 Ga0070697_100015877 3300005536 Bacteria 5916
90 Ga0070697_100019738 3300005536 Bacteria 5325
91 Ga0070697_100032710 3300005536 Bacteria 4187
92 Ga0070697_100055004 3300005536 Bacteria 3235
93 Ga0070697_100127881 3300005536 Unclassified 2129
94 Ga0070697_100158000 3300005536 Unclassified 1915
95 Ga0068853_100000002 3300005539 Bacteria 485323
96 Ga0068853_100404072 3300005539 Bacteria 1279
97 Ga0070672_100006021 3300005543 Bacteria 8102
98 Ga0070672_100714102 3300005543 Bacteria 878
99 Ga0070695_100073769 3300005545 Bacteria 2241
100 Ga0070665_100522596 3300005548 Unclassified 1198
101 Ga0070665_100758534 3300005548 Bacteria 983
102 Ga0070665_100806791 3300005548 Unclassified 951
103 Ga0068855_100004104 3300005563 Bacteria 17766
104 Ga0070664_100073661 3300005564 Bacteria 2931
105 Ga0070664_100094178 3300005564 Bacteria 2597
106 Ga0068859_100196065 3300005617 Bacteria 2104
107 Ga0068864_100389019 3300005618 Bacteria 1323
108 Ga0068863_100045582 3300005841 Bacteria 4161
109 Ga0068863_100253600 3300005841 Bacteria 1700
110 Ga0068863_100865018 3300005841 Bacteria 903
111 Ga0068858_100105563 3300005842 Bacteria 2629
112 Ga0068858_100255552 3300005842 Bacteria 1665
113 Ga0068858_100487356 3300005842 Unclassified 1190
114 Ga0068858_100703019 3300005842 Bacteria 984
115 Ga0068860_100001252 3300005843 Bacteria 27727
116 Ga0081455_10001011 3300005937 Bacteria 35586
117 Ga0081455_10021737 3300005937 Bacteria 6010
118 Ga0081455_10046729 3300005937 Bacteria 3753
119 Ga0081540_1000018 3300005983 Bacteria 164931
120 Ga0081539_10000287 3300005985 Bacteria 113988
121 Ga0081539_10001712 3300005985 Bacteria 35198
122 Ga0070717_10048038 3300006028 Bacteria 3499
123 Ga0070717_10079637 3300006028 Bacteria 2747
124 Ga0070717_10105847 3300006028 Bacteria 2394
125 Ga0070717_10322837 3300006028 Unclassified 1376
126 Ga0070717_10459014 3300006028 Unclassified 1149
127 Ga0070717_10639900 3300006028 Bacteria 965
128 Ga0070716_100140143 3300006173 Bacteria 1541
129 Ga0070712_100191235 3300006175 Bacteria 1602
130 Ga0070712_100290840 3300006175 Bacteria 1319
131 Ga0070712_100415685 3300006175 Unclassified 1114
132 Ga0070712_100922957 3300006175 Bacteria 753
133 Ga0097621_100012002 3300006237 Bacteria 6411
134 Ga0097621_100299772 3300006237 Unclassified 1419
135 Ga0068871_101061301 3300006358 Unclassified 756
136 Ga0068871_101513720 3300006358 Unclassified 634
137 Ga0075434_100313201 3300006871 Bacteria 1590
138 Ga0075434_100336264 3300006871 Unclassified 1531
139 Ga0097620_100196066 3300006931 Bacteria 2104
140 Ga0075435_100747813 3300007076 Unclassified 851
141 Ga0105240_10000069 3300009093 Bacteria 205335
142 Ga0105240_11191814 3300009093 Unclassified 807
143 Ga0111539_10224743 3300009094 Bacteria 2187
144 Ga0111539_10489170 3300009094 Unclassified 1433
145 Ga0105245_10817842 3300009098 Bacteria 970
146 Ga0114129_10222625 3300009147 Bacteria 2545
147 Ga0105242_10585830 3300009176 Bacteria 1075
148 Ga0105237_10005057 3300009545 Bacteria 14990
149 Ga0105237_10382834 3300009545 Bacteria 1412
150 Ga0105249_10676890 3300009553 Bacteria 1091
151 Ga0105249_10789044 3300009553 Bacteria 1013
152 Ga0105239_10139955 3300010375 Bacteria 2696
153 Ga0105239_10142763 3300010375 Unclassified 2669
154 Ga0105239_10293348 3300010375 Bacteria 1831
155 Ga0105239_11234600 3300010375 Bacteria 862
156 Ga0157374_10000057 3300013296 Bacteria 117036
157 Ga0157374_10010066 3300013296 Bacteria 8118
158 Ga0157374_10033590 3300013296 Bacteria 4681
159 Ga0157374_10136227 3300013296 Bacteria 2381
160 Ga0157378_10026609 3300013297 Bacteria 5098
161 Ga0157378_10150801 3300013297 Bacteria 2166
162 Ga0157378_10382418 3300013297 Bacteria 1383
163 Ga0157378_10752965 3300013297 Unclassified 997
164 Ga0163162_10013581 3300013306 Bacteria 7956
165 Ga0157375_10000006 3300013308 Bacteria 384086
166 Ga0157375_10036685 3300013308 Bacteria 4691
167 Ga0157375_10107973 3300013308 Bacteria 2877
168 Ga0157375_10614325 3300013308 Unclassified 1246
169 Ga0157375_12616870 3300013308 Bacteria 603
170 Ga0157380_10423975 3300014326 Bacteria 1270
171 Ga0182008_10018991 3300014497 Bacteria 3553
172 Ga0157377_10051023 3300014745 Bacteria 2332
173 Ga0157376_10000357 3300014969 Bacteria 30379
174 Ga0157376_10292959 3300014969 Bacteria 1537
175 Ga0157376_11620262 3300014969 Unclassified 682
176 Ga0207697_10000257 3300025315 Bacteria 29235
177 Ga0207697_10005265 3300025315 Bacteria 6029
178 Ga0207697_10013644 3300025315 Bacteria 3386
179 Ga0207697_10020366 3300025315 Unclassified 2716
180 Ga0207688_10004727 3300025901 Bacteria 7416
181 Ga0207680_10027263 3300025903 Unclassified 3179
182 Ga0207699_10016136 3300025906 Bacteria 3898
183 Ga0207645_10119773 3300025907 Bacteria 1708
184 Ga0207645_10236475 3300025907 Bacteria 1206
185 Ga0207684_10000043 3300025910 Bacteria 259939
186 Ga0207684_10002807 3300025910 Bacteria 17312
187 Ga0207684_10004414 3300025910 Bacteria 13249
188 Ga0207684_10018448 3300025910 Bacteria 5974
189 Ga0207684_10027121 3300025910 Bacteria 4885
190 Ga0207695_10000186 3300025913 Bacteria 179847
191 Ga0207671_10004700 3300025914 Bacteria 12906
192 Ga0207671_10128071 3300025914 Bacteria 1946
193 Ga0207693_10076402 3300025915 Bacteria 2623
194 Ga0207693_10128348 3300025915 Bacteria 1993
195 Ga0207693_10179303 3300025915 Bacteria 1667
196 Ga0207693_10280000 3300025915 Bacteria 1307
197 Ga0207693_10348311 3300025915 Bacteria 1159
198 Ga0207663_10366966 3300025916 Bacteria 1094
199 Ga0207646_10004744 3300025922 Bacteria 14638
200 Ga0207646_10005562 3300025922 Bacteria 13229
201 Ga0207646_10012526 3300025922 Bacteria 8143
202 Ga0207646_10128557 3300025922 Unclassified 2279
203 Ga0207646_10382814 3300025922 Unclassified 1271
204 Ga0207681_10058606 3300025923 Bacteria 2637
205 Ga0207650_10287005 3300025925 Bacteria 1341
206 Ga0207659_10097413 3300025926 Bacteria 2210
207 Ga0207659_11085673 3300025926 Bacteria 689
208 Ga0207687_10798275 3300025927 Bacteria 805
209 Ga0207700_10013529 3300025928 Bacteria 5313
210 Ga0207700_10167373 3300025928 Bacteria 1830
211 Ga0207664_10248221 3300025929 Bacteria 1552
212 Ga0207644_10029024 3300025931 Bacteria 3835
213 Ga0207644_10040007 3300025931 Bacteria 3311
214 Ga0207644_10162302 3300025931 Bacteria 1738
215 Ga0207690_10271159 3300025932 Unclassified 1318
216 Ga0207669_10084707 3300025937 Unclassified 2043
217 Ga0207669_10250439 3300025937 Bacteria 1319
218 Ga0207669_10333286 3300025937 Unclassified 1166
219 Ga0207704_10019809 3300025938 Bacteria 3544
220 Ga0207665_10066411 3300025939 Bacteria 2455
221 Ga0207691_10000786 3300025940 Bacteria 31520
222 Ga0207667_10011801 3300025949 Bacteria 10122
223 Ga0207651_10488698 3300025960 Bacteria 1062
224 Ga0207668_10746040 3300025972 Bacteria 863
225 Ga0207658_10082121 3300025986 Bacteria 2474
226 Ga0207677_10967362 3300026023 Bacteria 770
227 Ga0207703_10017102 3300026035 Bacteria 5655
228 Ga0207703_10282555 3300026035 Bacteria 1508
229 Ga0207703_10832532 3300026035 Bacteria 882
230 Ga0207639_10000009 3300026041 Bacteria 432727
231 Ga0207639_10322978 3300026041 Bacteria 1371
232 Ga0207702_10003398 3300026078 Bacteria 14576
233 Ga0207641_10513017 3300026088 Bacteria 1165
234 Ga0207648_10051733 3300026089 Bacteria 3590
235 Ga0207674_10532270 3300026116 Bacteria 1135
236 Ga0207683_10015250 3300026121 Bacteria 6540
237 Ga0268266_10348732 3300028379 Bacteria 1391
238 Ga0268264_10000563 3300028381 Bacteria 45674
239 Ga0265319_1007559 3300028563 Bacteria 4867
240 Ga0265336_10001204 3300028666 Bacteria 12261
241 Ga0265338_10001425 3300028800 Bacteria 38871
242 Ga0265338_10006831 3300028800 Bacteria 14375
243 Ga0265338_10031607 3300028800 Bacteria 5186
244 Ga0265338_10147808 3300028800 Bacteria 1830
245 Ga0265332_10060597 3300031238 Bacteria 1619
246 Ga0265320_10013473 3300031240 Bacteria 4702
247 Ga0265327_10220730 3300031251 Bacteria 852
248 Ga0265316_10009401 3300031344 Bacteria 9003
249 Ga0307513_10051728 3300031456 Bacteria 4429
250 Ga0265313_10001405 3300031595 Bacteria 22549
251 Ga0373936_0086282 3300035113 Bacteria 1311
252 Ga0373953_0250509 3300035117 Unclassified 770
253 Ga0373954_0021485 3300035118 Bacteria 2923
254 Ga0373956_0048156 3300035119 Bacteria 1908
255 Ga0373946_0332190 3300035171 Bacteria 757
256 Ga0373955_0087196 3300035172 Bacteria 1774
257 Ga0373955_0087800 3300035172 Bacteria 1768
258 Ga0316574_0006761 3300035398 Bacteria 6229
259 Ga0373935_0333134 3300035692 Bacteria 1079
260 Ga0373927_0196491 3300035695 Bacteria 1324
261 Ga0373933_0012443 3300035724 Bacteria 4698
262 Ga0373933_0250846 3300035724 Bacteria 1140
263 Ga0373933_0418962 3300035724 Bacteria 875
264 Ga0373933_0799723 3300035724 Unclassified 621
265 Ga0373947_0033205 3300035725 Bacteria 3045
266 Ga0373937_0001191 3300036401 Bacteria 21823
267 Ga0373937_0002365 3300036401 Bacteria 15706
268 Ga0373937_0310960 3300036401 Bacteria 1490
269 Ga0316584_0085069 3300036712 Unclassified 2368
270 Ga0373925_1317450 3300037068 Unclassified 592
271 Ga0395899_0000020 3300037312 Bacteria 404354
272 Ga0395898_0000005 3300037466 Bacteria 621247
273 Ga0395898_0019151 3300037466 Bacteria 6969
274 Ga0395898_0465190 3300037466 Archaea 1204
275 Ga0395898_0800067 3300037466 Unclassified 883
276 Ga0395905_0209432 3300037471 Bacteria 1827
277 Ga0436364_0441573 3300037853 Bacteria 965
278 Ga0395901_0002558 3300038443 Bacteria 18424
279 Ga0395901_0157772 3300038443 Unclassified 2383
280 Ga0395901_0207841 3300038443 Unclassified 2050
281 Ga0395901_0451862 3300038443 Bacteria 1314
282 Ga0436365_0697187 3300039437 Bacteria 3564
283 Ga0436365_1198295 3300039437 Bacteria 7257
284 Ga0436365_1810650 3300039437 Bacteria 50427
285 Ga0436360_1260888 3300039438 Bacteria 4219
286 Ga0436361_0892360 3300039447 Bacteria 4928
287 Ga0436363_1014064 3300039450 Unclassified 1251
288 Ga0436362_0993857 3300039453 Bacteria 2356
289 Ga0451795_1469800 3300041456 Unclassified 1070
290 Ga0451837_1354135 3300041494 Unclassified 798
291 Ga0451577_0010770 3300042876 Bacteria 8701
292 Ga0451577_0101961 3300042876 Unclassified 2564
293 Ga0451577_0199515 3300042876 Bacteria 1806
294 Ga0466965_0008907 3300044683 Bacteria 4652
295 Ga0466966_0180727 3300044684 Bacteria 1280
296 Ga0466963_0101405 3300044694 Bacteria 1971
297 Ga0466964_0015317 3300044706 Bacteria 2917
298 Ga0466971_0000040 3300044719 Bacteria 51554
299 Ga0466957_0019445 3300044842 Bacteria 3995
300 Ga0466957_0034036 3300044842 Bacteria 3056
301 Ga0451576_0024910 3300045051 Bacteria 6456
302 Ga0451576_0174022 3300045051 Bacteria 2247
303 Ga0451576_0241957 3300045051 Bacteria 1885
304 Ga0451576_1148898 3300045051 Bacteria 812
305 Ga0466967_0196551 3300045976 Bacteria 1908
306 Ga0495629_0040550 3300046459 Bacteria 3275
307 Ga0495651_0036790 3300046462 Bacteria 3811
308 Ga0495580_0672156 3300046472 Unclassified 680
309 Ga0495608_0074295 3300046511 Bacteria 2216
310 Ga0495618_0002339 3300046514 Bacteria 12236
311 Ga0495643_0000894 3300046522 Bacteria 31755
312 Ga0495652_0008016 3300046529 Bacteria 9684
313 Ga0495640_0033865 3300046533 Bacteria 3629
314 Ga0495586_0001721 3300046535 Bacteria 11945
315 Ga0495587_0241139 3300046536 Unclassified 1017
316 Ga0495667_0121191 3300046559 Bacteria 1688
317 Ga0495634_0002486 3300046642 Bacteria 15285
318 Ga0495635_0066203 3300046663 Bacteria 2478
319 Ga0495599_0096905 3300046678 Bacteria 1839
320 Ga0495646_0065359 3300046680 Bacteria 2154
321 Ga0495646_0251150 3300046680 Bacteria 947
322 Ga0495647_0027199 3300046681 Bacteria 2101
323 Ga0495613_0002720 3300046689 Bacteria 13263
324 Ga0495613_0262885 3300046689 Bacteria 1202
325 Ga0495624_0422217 3300046690 Unclassified 800
326 Ga0495674_0082798 3300047319 Unclassified 2751
327 Ga0495680_0214882 3300047322 Bacteria 1375
328 Ga0495684_0021703 3300047471 Bacteria 4944
329 Ga0495684_0149343 3300047471 Bacteria 1748
330 Ga0495602_0480325 3300048088 Bacteria 872
331 Ga0496100_0201842 3300048903 Bacteria 1450
332 Ga0496109_0021164 3300048912 Bacteria 5751
333 Ga0496109_0321620 3300048912 Bacteria 1460
334 Ga0496112_0187122 3300048915 Bacteria 2034
335 Ga0496115_0272987 3300048918 Bacteria 1389
336 Ga0496121_0206099 3300048924 Bacteria 1397
337 Ga0501032_0047336 3300049569 Bacteria 2904
338 Ga0501036_0242268 3300049572 Bacteria 1512
339 Ga0501037_0000044 3300049573 Bacteria 117895
340 Ga0501039_0003683 3300049575 Bacteria 11486
341 Ga0501043_0000142 3300049579 Bacteria 67246
342 Ga0501043_0000667 3300049579 Bacteria 30257
343 Ga0501047_0007058 3300049581 Bacteria 10550
344 Ga0501047_0071684 3300049581 Bacteria 3335
345 Ga0501048_0563849 3300049582 Archaea 817
346 Ga0501070_0019648 3300049586 Bacteria 5664
347 Ga0501080_0165749 3300049742 Bacteria 2039
348 Ga0501035_0000001 3300049822 Bacteria 1037138
349 Ga0501044_0004304 3300049823 Bacteria 15966
350 nmdc:mga05p37_329241_c1 3300050507 Unclassified 1805
351 nmdc:mga08y16_935644_c1 3300050511 Unclassified 851
352 Ga0495619_0554089 3300053085 Unclassified 788
353 Ga0500616_0003907 3300053153 Bacteria 10960
354 Ga0466962_0000003 3300061719 Bacteria 187594
355 Ga0070709_10008217
356 SwRhRL2b_contig_2742384
357 MBSR1b_contig_11670001
358 rootH2_10310919
359 rootL2_10103863
360 Ga0065703_1018946
361 Ga0065704_10006717
362 Ga0065704_10080585
363 Ga0065704_10151491
364 Ga0065712_10161874
365 Ga0065712_10199873
366 Ga0065715_10000421
367 Ga0065707_10392183
368 Ga0070658_10467387
369 Ga0070658_10482515
370 Ga0070676_10076550
371 Ga0070676_10077305
372 Ga0070676_10160843
373 Ga0070683_100065580
374 Ga0070670_100094569
375 Ga0070670_100352935
376 Ga0070670_100599139
377 Ga0070670_101048000
378 Ga0070666_10017145
379 Ga0070666_10024577
380 Ga0070666_10069414
381 Ga0070660_100409916
382 Ga0070660_101089797
383 Ga0070689_100015602
384 Ga0070668_100042150
385 Ga0070668_100295765
386 Ga0070669_100023536
387 Ga0070669_100200506
388 Ga0070669_100307413
389 Ga0070675_100011832
390 Ga0070675_100642025
391 Ga0070671_100013870
392 Ga0070671_100114408
393 Ga0070674_100009944
394 Ga0070673_100007746
395 Ga0070673_100147459
396 Ga0070688_100175086
397 Ga0070688_100387446
398 Ga0070688_100872890
399 Ga0070659_100399578
400 Ga0070667_100090804
401 Ga0070714_100028795
402 Ga0070713_100534155
403 Ga0070710_10050272
404 Ga0070710_10170545
405 Ga0070711_100085444
406 Ga0070711_100121146
407 Ga0070711_100180105
408 Ga0070711_100231049
409 Ga0070711_100233226
410 Ga0070705_100108641
411 Ga0070708_100024411
412 Ga0070708_100035413
413 Ga0070708_100041822
414 Ga0070708_100098748
415 Ga0070708_100244067
416 Ga0070708_100298223
417 Ga0070678_100099366
418 Ga0068867_100047461
419 Ga0070685_10111433
420 Ga0070706_100000035
421 Ga0070706_100013032
422 Ga0070706_100020122
423 Ga0070706_100126647
424 Ga0070706_100133141
425 Ga0070706_100339360
426 Ga0070707_100002278
427 Ga0070707_100010859
428 Ga0070707_100027638
429 Ga0070707_100036698
430 Ga0070707_100050118
431 Ga0070707_100193204
432 Ga0070707_100338122
433 Ga0070707_100506935
434 Ga0070707_101192025
435 Ga0070707_101240547
436 Ga0070707_101484443
437 Ga0070698_100004983
438 Ga0070698_100006835
439 Ga0070698_100052592
440 Ga0070698_100387100
441 Ga0070699_100120222
442 Ga0070699_100229532
443 Ga0070697_100015877
444 Ga0070697_100019738
445 Ga0070697_100032710
446 Ga0070697_100055004
447 Ga0070697_100127881
448 Ga0070697_100158000
449 Ga0068853_100000002
450 Ga0068853_100404072
451 Ga0070672_100006021
452 Ga0070672_100714102
453 Ga0070695_100073769
454 Ga0070665_100522596
455 Ga0070665_100758534
456 Ga0070665_100806791
457 Ga0068855_100004104
458 Ga0070664_100073661
459 Ga0070664_100094178
460 Ga0068859_100196065
461 Ga0068864_100389019
462 Ga0068863_100045582
463 Ga0068863_100253600
464 Ga0068863_100865018
465 Ga0068858_100105563
466 Ga0068858_100255552
467 Ga0068858_100487356
468 Ga0068858_100703019
469 Ga0068860_100001252
470 Ga0081455_10001011
471 Ga0081455_10021737
472 Ga0081455_10046729
473 Ga0081540_1000018
474 Ga0081539_10000287
475 Ga0081539_10001712
476 Ga0070717_10048038
477 Ga0070717_10079637
478 Ga0070717_10105847
479 Ga0070717_10322837
480 Ga0070717_10459014
481 Ga0070717_10639900
482 Ga0070716_100140143
483 Ga0070712_100191235
484 Ga0070712_100290840
485 Ga0070712_100415685
486 Ga0070712_100922957
487 Ga0097621_100012002
488 Ga0097621_100299772
489 Ga0068871_101061301
490 Ga0068871_101513720
491 Ga0075434_100313201
492 Ga0075434_100336264
493 Ga0097620_100196066
494 Ga0075435_100747813
495 Ga0105240_10000069
496 Ga0105240_11191814
497 Ga0111539_10224743
498 Ga0111539_10489170
499 Ga0105245_10817842
500 Ga0114129_10222625
501 Ga0105242_10585830
502 Ga0105237_10005057
503 Ga0105237_10382834
504 Ga0105249_10676890
505 Ga0105249_10789044
506 Ga0105239_10139955
507 Ga0105239_10142763
508 Ga0105239_10293348
509 Ga0105239_11234600
510 Ga0157374_10000057
511 Ga0157374_10010066
512 Ga0157374_10033590
513 Ga0157374_10136227
514 Ga0157378_10026609
515 Ga0157378_10150801
516 Ga0157378_10382418
517 Ga0157378_10752965
518 Ga0163162_10013581
519 Ga0157375_10000006
520 Ga0157375_10036685
521 Ga0157375_10107973
522 Ga0157375_10614325
523 Ga0157375_12616870
524 Ga0157380_10423975
525 Ga0182008_10018991
526 Ga0157377_10051023
527 Ga0157376_10000357
528 Ga0157376_10292959
529 Ga0157376_11620262
530 Ga0207697_10000257
531 Ga0207697_10005265
532 Ga0207697_10013644
533 Ga0207697_10020366
534 Ga0207688_10004727
535 Ga0207680_10027263
536 Ga0207699_10016136
537 Ga0207645_10119773
538 Ga0207645_10236475
539 Ga0207684_10000043
540 Ga0207684_10002807
541 Ga0207684_10004414
542 Ga0207684_10018448
543 Ga0207684_10027121
544 Ga0207695_10000186
545 Ga0207671_10004700
546 Ga0207671_10128071
547 Ga0207693_10076402
548 Ga0207693_10128348
549 Ga0207693_10179303
550 Ga0207693_10280000
551 Ga0207693_10348311
552 Ga0207663_10366966
553 Ga0207646_10004744
554 Ga0207646_10005562
555 Ga0207646_10012526
556 Ga0207646_10128557
557 Ga0207646_10382814
558 Ga0207681_10058606
559 Ga0207650_10287005
560 Ga0207659_10097413
561 Ga0207659_11085673
562 Ga0207687_10798275
563 Ga0207700_10013529
564 Ga0207700_10167373
565 Ga0207664_10248221
566 Ga0207644_10029024
567 Ga0207644_10040007
568 Ga0207644_10162302
569 Ga0207690_10271159
570 Ga0207669_10084707
571 Ga0207669_10250439
572 Ga0207669_10333286
573 Ga0207704_10019809
574 Ga0207665_10066411
575 Ga0207691_10000786
576 Ga0207667_10011801
577 Ga0207651_10488698
578 Ga0207668_10746040
579 Ga0207658_10082121
580 Ga0207677_10967362
581 Ga0207703_10017102
582 Ga0207703_10282555
583 Ga0207703_10832532
584 Ga0207639_10000009
585 Ga0207639_10322978
586 Ga0207702_10003398
587 Ga0207641_10513017
588 Ga0207648_10051733
589 Ga0207674_10532270
590 Ga0207683_10015250
591 Ga0268266_10348732
592 Ga0268264_10000563
593 Ga0265319_1007559
594 Ga0265336_10001204
595 Ga0265338_10001425
596 Ga0265338_10006831
597 Ga0265338_10031607
598 Ga0265338_10147808
599 Ga0265332_10060597
600 Ga0265320_10013473
601 Ga0265327_10220730
602 Ga0265316_10009401
603 Ga0307513_10051728
604 Ga0265313_10001405
605 Ga0373936_0086282
606 Ga0373953_0250509
607 Ga0373954_0021485
608 Ga0373956_0048156
609 Ga0373946_0332190
610 Ga0373955_0087196
611 Ga0373955_0087800
612 Ga0316574_0006761
613 Ga0373935_0333134
614 Ga0373927_0196491
615 Ga0373933_0012443
616 Ga0373933_0250846
617 Ga0373933_0418962
618 Ga0373933_0799723
619 Ga0373947_0033205
620 Ga0373937_0001191
621 Ga0373937_0002365
622 Ga0373937_0310960
623 Ga0316584_0085069
624 Ga0373925_1317450
625 Ga0395899_0000020
626 Ga0395898_0000005
627 Ga0395898_0019151
628 Ga0395898_0465190
629 Ga0395898_0800067
630 Ga0395905_0209432
631 Ga0436364_0441573
632 Ga0395901_0002558
633 Ga0395901_0157772
634 Ga0395901_0207841
635 Ga0395901_0451862
636 Ga0436365_0697187
637 Ga0436365_1198295
638 Ga0436365_1810650
639 Ga0436360_1260888
640 Ga0436361_0892360
641 Ga0436363_1014064
642 Ga0436362_0993857
643 Ga0451795_1469800
644 Ga0451837_1354135
645 Ga0451577_0010770
646 Ga0451577_0101961
647 Ga0451577_0199515
648 Ga0466965_0008907
649 Ga0466966_0180727
650 Ga0466963_0101405
651 Ga0466964_0015317
652 Ga0466971_0000040
653 Ga0466957_0019445
654 Ga0466957_0034036
655 Ga0451576_0024910
656 Ga0451576_0174022
657 Ga0451576_0241957
658 Ga0451576_1148898
659 Ga0466967_0196551
660 Ga0495629_0040550
661 Ga0495651_0036790
662 Ga0495580_0672156
663 Ga0495608_0074295
664 Ga0495618_0002339
665 Ga0495643_0000894
666 Ga0495652_0008016
667 Ga0495640_0033865
668 Ga0495586_0001721
669 Ga0495587_0241139
670 Ga0495667_0121191
671 Ga0495634_0002486
672 Ga0495635_0066203
673 Ga0495599_0096905
674 Ga0495646_0065359
675 Ga0495646_0251150
676 Ga0495647_0027199
677 Ga0495613_0002720
678 Ga0495613_0262885
679 Ga0495624_0422217
680 Ga0495674_0082798
681 Ga0495680_0214882
682 Ga0495684_0021703
683 Ga0495684_0149343
684 Ga0495602_0480325
685 Ga0496100_0201842
686 Ga0496109_0021164
687 Ga0496109_0321620
688 Ga0496112_0187122
689 Ga0496115_0272987
690 Ga0496121_0206099
691 Ga0501032_0047336
692 Ga0501036_0242268
693 Ga0501037_0000044
694 Ga0501039_0003683
695 Ga0501043_0000142
696 Ga0501043_0000667
697 Ga0501047_0007058
698 Ga0501047_0071684
699 Ga0501048_0563849
700 Ga0501070_0019648
701 Ga0501080_0165749
702 Ga0501035_0000001
703 Ga0501044_0004304
704 nmdc:mga05p37_329241_c1
705 nmdc:mga08y16_935644_c1
706 Ga0495619_0554089
707 Ga0500616_0003907
708 Ga0466962_0000003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

69

205

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lza-assembly1.cif.gz_A crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.8888 30 163
4paw-assembly1.cif.gz_A structure of hypothetical protein hp1257. 0.8832 4 185
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.8828 30 163
2aee-assembly1.cif.gz_A crystal structure of orotate phosphoribosyltransferase from streptococcus pyogenes 0.8678 2 162
4ohc-assembly1.cif.gz_D crystal structure of orotate phosphoribosyltransferase (oprtase) from burkholderia cenocepacia 0.8535 2 162
ID Description Score Start End Superfamily
4pawB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9137 4 185 3.40.50.2020
4pawB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8813 4 185 3.40.50.2020
af_Q59040_42_210_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8669 31 164 3.40.50.2020
4rv4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8495 2 163 3.40.50.2020
5yw5B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8468 30 163 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A538NGA5-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9908 1 188 GO:0000287
GO:0004588
GO:0019856
GO:0044205
AF-A0A2V6HME3-F1-model_v4 Orotate phosphoribosyltransferase (EC 2.4.2.10) 0.99 1 168 GO:0004588
GO:0019856
GO:0044205
AF-A0A538NGA5-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9856 1 188 GO:0000287
GO:0004588
GO:0019856
GO:0044205
AF-A0A2V6HME3-F1-model_v4 Orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9842 1 168 GO:0004588
GO:0019856
GO:0044205
AF-A0A2V9PQC8-F1-model_v4 Orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9791 1 144 GO:0004588
GO:0019856
GO:0044205

Map