F419781

General Info

Members Datasets Scaffolds Average Seq Length
354 230 708 281

Family's Representative Sequence

Representative Sequence 3300025297|Ga0209758_1021235|Ga0209758_10212352
Length 271
Sequence VTTPRAASSPSSASRLGLAFGLLSGALLALAPQAASAQGRLDAQYEATLAGIPVGKGAWTIEIGDDTFAASAQGGTAGLLKAFSGGSGSGASVGRVVGSETIRMSLANGNVKEFSFDPVPPVDPDRIPVLEAHRKGVLDPMTGSMLRVAGNGELLSPDSCRTGTGVFDGRLRYDLKLDYKRMEMVKAERGYHGPALVCAIYFTPVAGYIPDRPVIKYLAAERRIEIAFVPIAGTRILVPFRMSIPTPLGLAMLEATSFVTSAAPPRVAKTN

Samples

Sample ID Description Type Environment
1 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
99 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
100 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
110 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
111 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
112 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
113 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
114 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
123 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
199 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
200 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
201 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
202 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
203 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
204 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
205 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
206 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
207 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
208 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
209 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
210 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
211 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
212 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
213 2791355199
214 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
215 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
216 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
217 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
218 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
219 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
220 2906610324
221 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
222 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
223 2922425934
224 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
225 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
226 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
227 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
228 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
229 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
230 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.73
Metatranscriptomes 0
Isolates 6.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.52
Nodule 6.21
Rhizoplane 8.47
Rhizosphere 75.42
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209758_1021235 3300025297 Bacteria 3035
2 JGI24740J21852_10002093 3300001979 Bacteria 9125
3 JGI24739J22299_10007291 3300001989 Bacteria 4155
4 JGI24737J22298_10003234 3300001990 Bacteria 5779
5 JGI25153J46596_10003308 3300003215 Bacteria 9059
6 rootH1_10061607 3300003323 Bacteria 1696
7 Ga0070689_100002201 3300005340 Bacteria 12643
8 Ga0070668_100053698 3300005347 Bacteria 3107
9 Ga0070671_100101933 3300005355 Bacteria 2408
10 Ga0070674_100116578 3300005356 Bacteria 1970
11 Ga0070674_100205347 3300005356 Bacteria 1524
12 Ga0070688_100239073 3300005365 Viruses 1288
13 Ga0070667_100170744 3300005367 Bacteria 1920
14 Ga0070667_100289790 3300005367 Bacteria 1472
15 Ga0070709_10051686 3300005434 Bacteria 2580
16 Ga0070714_100020830 3300005435 Bacteria 5359
17 Ga0070714_100212866 3300005435 Bacteria 1772
18 Ga0070714_100382018 3300005435 Bacteria 1328
19 Ga0070713_100008303 3300005436 Bacteria 7364
20 Ga0070713_100073018 3300005436 Bacteria 2904
21 Ga0070713_100210845 3300005436 Bacteria 1758
22 Ga0070710_10019490 3300005437 Bacteria 3505
23 Ga0070710_10149847 3300005437 Bacteria 1438
24 Ga0070711_100024689 3300005439 Bacteria 3925
25 Ga0070711_100040086 3300005439 Bacteria 3157
26 Ga0070700_100147368 3300005441 Bacteria 1606
27 Ga0070678_100241466 3300005456 Bacteria 1511
28 Ga0070681_10077962 3300005458 Bacteria 3270
29 Ga0070681_10281968 3300005458 Bacteria 1572
30 Ga0068867_100107016 3300005459 Bacteria 2143
31 Ga0070679_100267070 3300005530 Bacteria 1666
32 Ga0068853_100009176 3300005539 Bacteria 7968
33 Ga0068853_100174264 3300005539 Bacteria 1948
34 Ga0068853_100325519 3300005539 Bacteria 1425
35 Ga0070665_100019635 3300005548 Bacteria 6782
36 Ga0068855_100034950 3300005563 Bacteria 5989
37 Ga0068855_100045602 3300005563 Bacteria 5185
38 Ga0068855_100154745 3300005563 Bacteria 2605
39 Ga0068855_100262918 3300005563 Bacteria 1921
40 Ga0068857_100025539 3300005577 Bacteria 5201
41 Ga0068857_100029534 3300005577 Bacteria 4838
42 Ga0068854_100031348 3300005578 Bacteria 3694
43 Ga0068854_100034023 3300005578 Bacteria 3557
44 Ga0068854_100234590 3300005578 Bacteria 1458
45 Ga0068856_100007580 3300005614 Bacteria 10590
46 Ga0068856_100079394 3300005614 Bacteria 3254
47 Ga0068856_100147029 3300005614 Bacteria 2364
48 Ga0068852_100009383 3300005616 Bacteria 7266
49 Ga0068852_100042060 3300005616 Bacteria 3867
50 Ga0068852_100273229 3300005616 Bacteria 1627
51 Ga0068859_100146461 3300005617 Bacteria 2437
52 Ga0068866_10168790 3300005718 Viruses 1283
53 Ga0068851_10003386 3300005834 Bacteria 7094
54 Ga0068863_100235975 3300005841 Bacteria 1765
55 Ga0068858_100276740 3300005842 Unclassified 1598
56 Ga0068860_100219591 3300005843 Bacteria 1846
57 Ga0068862_100650281 3300005844 Viruses 1017
58 Ga0081540_1004792 3300005983 Bacteria 10198
59 Ga0081540_1031472 3300005983 Bacteria 2916
60 Ga0081539_10000129 3300005985 Bacteria 178675
61 Ga0075364_10206570 3300006051 Bacteria 1332
62 Ga0070716_100065335 3300006173 Bacteria 2118
63 Ga0070716_100170808 3300006173 Bacteria 1418
64 Ga0070712_100177584 3300006175 Bacteria 1657
65 Ga0097621_100296627 3300006237 Bacteria 1427
66 Ga0075370_10121401 3300006353 Bacteria 1521
67 Ga0075434_100045020 3300006871 Bacteria 4377
68 Ga0097620_100146466 3300006931 Bacteria 2437
69 Ga0099822_1006293 3300006943 Bacteria 15490
70 Ga0105240_10006010 3300009093 Bacteria 17947
71 Ga0105240_10007471 3300009093 Bacteria 15866
72 Ga0105240_10272953 3300009093 Bacteria 1946
73 Ga0105241_10001634 3300009174 Bacteria 17089
74 Ga0105248_10030839 3300009177 Bacteria 5990
75 Ga0105248_10173144 3300009177 Bacteria 2433
76 Ga0105248_10310704 3300009177 Bacteria 1775
77 Ga0105237_10149766 3300009545 Bacteria 2329
78 Ga0105237_10157612 3300009545 Bacteria 2267
79 Ga0105237_10420543 3300009545 Bacteria 1342
80 Ga0105238_10002664 3300009551 Bacteria 17754
81 Ga0105238_10020931 3300009551 Bacteria 6663
82 Ga0105238_10187939 3300009551 Bacteria 2042
83 Ga0105238_10352548 3300009551 Bacteria 1461
84 Ga0105249_10226870 3300009553 Bacteria 1841
85 Ga0105239_10013167 3300010375 Bacteria 9190
86 Ga0105239_10026772 3300010375 Bacteria 6346
87 Ga0105239_10373383 3300010375 Bacteria 1612
88 Ga0157370_10094139 3300013104 Bacteria 2811
89 Ga0157370_10113979 3300013104 Bacteria 2526
90 Ga0157369_10076101 3300013105 Bacteria 3598
91 Ga0163162_10168946 3300013306 Bacteria 2311
92 Ga0157372_10324763 3300013307 Bacteria 1792
93 Ga0157375_10280689 3300013308 Bacteria 1828
94 Ga0163163_10188624 3300014325 Bacteria 2110
95 Ga0163163_10203786 3300014325 Bacteria 2027
96 Ga0157379_10026455 3300014968 Bacteria 5165
97 Ga0157379_10372278 3300014968 Unclassified 1310
98 Ga0157376_10468649 3300014969 Bacteria 1232
99 Ga0209758_1001222 3300025297 Bacteria 32186
100 Ga0207656_10000685 3300025321 Bacteria 11094
101 Ga0207692_10017420 3300025898 Bacteria 3204
102 Ga0207642_10041211 3300025899 Bacteria 2020
103 Ga0207647_10000749 3300025904 Bacteria 25445
104 Ga0207685_10014818 3300025905 Bacteria 2451
105 Ga0207699_10273602 3300025906 Bacteria 1171
106 Ga0207645_10075590 3300025907 Bacteria 2156
107 Ga0207654_10000073 3300025911 Bacteria 66148
108 Ga0207707_10242856 3300025912 Bacteria 1565
109 Ga0207695_10000366 3300025913 Bacteria 103345
110 Ga0207695_10028375 3300025913 Bacteria 6209
111 Ga0207671_10095369 3300025914 Bacteria 2246
112 Ga0207693_10004841 3300025915 Bacteria 11329
113 Ga0207693_10119160 3300025915 Bacteria 2073
114 Ga0207663_10022320 3300025916 Bacteria 3616
115 Ga0207660_10349019 3300025917 Bacteria 1186
116 Ga0207649_10080762 3300025920 Bacteria 2104
117 Ga0207652_10134677 3300025921 Bacteria 2206
118 Ga0207681_10004826 3300025923 Bacteria 8284
119 Ga0207694_10000139 3300025924 Bacteria 74561
120 Ga0207694_10033707 3300025924 Bacteria 3923
121 Ga0207644_10107780 3300025931 Bacteria 2102
122 Ga0207670_10043654 3300025936 Bacteria 2962
123 Ga0207669_10048611 3300025937 Bacteria 2521
124 Ga0207704_10219863 3300025938 Bacteria 1405
125 Ga0207665_10004430 3300025939 Bacteria 9329
126 Ga0207665_10084912 3300025939 Bacteria 2185
127 Ga0207711_10041830 3300025941 Bacteria 3903
128 Ga0207711_10537730 3300025941 Bacteria 1090
129 Ga0207667_10015597 3300025949 Bacteria 8620
130 Ga0207667_10026231 3300025949 Bacteria 6368
131 Ga0207667_10314574 3300025949 Bacteria 1599
132 Ga0207667_10443223 3300025949 Bacteria 1320
133 Ga0207640_10009130 3300025981 Bacteria 5538
134 Ga0207640_10027881 3300025981 Bacteria 3446
135 Ga0207658_10215162 3300025986 Bacteria 1613
136 Ga0207703_10163157 3300026035 Bacteria 1953
137 Ga0207703_10228942 3300026035 Bacteria 1666
138 Ga0207639_10001776 3300026041 Bacteria 14520
139 Ga0207639_10010041 3300026041 Bacteria 6547
140 Ga0207639_10486586 3300026041 Bacteria 1125
141 Ga0207678_10055968 3300026067 Bacteria 3397
142 Ga0207702_10000491 3300026078 Bacteria 44501
143 Ga0207702_10014883 3300026078 Bacteria 6453
144 Ga0207641_10119775 3300026088 Bacteria 2347
145 Ga0207676_10030569 3300026095 Bacteria 4044
146 Ga0207674_10012447 3300026116 Bacteria 9507
147 Ga0207674_10012615 3300026116 Bacteria 9445
148 Ga0207675_100095580 3300026118 Bacteria 2796
149 Ga0207675_100492818 3300026118 Bacteria 1219
150 Ga0207698_10002187 3300026142 Bacteria 11577
151 Ga0207698_10118752 3300026142 Bacteria 2234
152 Ga0207698_10183258 3300026142 Bacteria 1857
153 Ga0209589_1001702 3300027357 Bacteria 36938
154 Ga0209489_102545 3300027361 Bacteria 36938
155 Ga0209700_102508 3300027363 Bacteria 36938
156 Ga0268266_10065448 3300028379 Bacteria 3142
157 Ga0268266_10521312 3300028379 Bacteria 1136
158 Ga0268265_10390700 3300028380 Bacteria 1283
159 Ga0307517_10002031 3300028786 Bacteria 32949
160 Ga0265332_10019853 3300031238 Bacteria 2966
161 Ga0265340_10003861 3300031247 Bacteria 8440
162 Ga0265339_10021130 3300031249 Bacteria 3793
163 Ga0265314_10205616 3300031711 Bacteria 1160
164 Ga0265342_10000139 3300031712 Bacteria 81785
165 Ga0315911_1000042 3300033442 Bacteria 49262
166 Ga0373930_0031544 3300034816 Viruses 1093
167 Ga0373926_0020871 3300035083 Bacteria 2265
168 Ga0373934_0042454 3300035086 Bacteria 1796
169 Ga0373940_0048264 3300035088 Bacteria 1189
170 Ga0373951_0010402 3300035091 Bacteria 2088
171 Ga0373923_0000994 3300035111 Bacteria 7669
172 Ga0373936_0000131 3300035113 Bacteria 25984
173 Ga0373936_0194698 3300035113 Bacteria 893
174 Ga0373939_0005892 3300035114 Bacteria 2933
175 Ga0373945_0002931 3300035116 Bacteria 5359
176 Ga0373953_0051323 3300035117 Bacteria 1667
177 Ga0373954_0002536 3300035118 Bacteria 7662
178 Ga0373956_0002019 3300035119 Bacteria 8409
179 Ga0373957_0003320 3300035120 Bacteria 4742
180 Ga0373960_0037910 3300035121 Bacteria 1379
181 Ga0373943_0005070 3300035170 Bacteria 5939
182 Ga0373943_0015656 3300035170 Bacteria 3449
183 Ga0373946_0137782 3300035171 Bacteria 1128
184 Ga0373955_0002890 3300035172 Bacteria 7532
185 Ga0373955_0021120 3300035172 Bacteria 3281
186 Ga0373924_0002153 3300035410 Bacteria 6590
187 Ga0373924_0011790 3300035410 Bacteria 3252
188 Ga0373931_0000511 3300035691 Bacteria 15892
189 Ga0373931_0046420 3300035691 Bacteria 2296
190 Ga0373935_0000482 3300035692 Bacteria 20681
191 Ga0373927_0017006 3300035695 Bacteria 4792
192 Ga0373927_0018350 3300035695 Bacteria 4598
193 Ga0373927_0062317 3300035695 Bacteria 2412
194 Ga0373933_0017835 3300035724 Bacteria 3985
195 Ga0373933_0054519 3300035724 Bacteria 2396
196 Ga0373947_0003527 3300035725 Bacteria 9244
197 Ga0373937_0000005 3300036401 Bacteria 199965
198 Ga0373937_0048805 3300036401 Bacteria 3876
199 Ga0373937_0094344 3300036401 Bacteria 2774
200 Ga0373925_0000007 3300037068 Bacteria 257023
201 Ga0373925_0275859 3300037068 Bacteria 1353
202 Ga0436364_1030114 3300037853 Bacteria 1598
203 Ga0436365_0690350 3300039437 Bacteria 2764
204 Ga0466967_0076891 3300045976 Bacteria 3003
205 Ga0495592_0000241 3300046454 Bacteria 46812
206 Ga0495592_0055952 3300046454 Bacteria 2916
207 Ga0495629_0002565 3300046459 Bacteria 13924
208 Ga0495629_0019034 3300046459 Bacteria 4910
209 Ga0495651_0010131 3300046462 Bacteria 7240
210 Ga0495651_0043072 3300046462 Bacteria 3503
211 Ga0495653_0000034 3300046463 Bacteria 131084
212 Ga0495653_0032634 3300046463 Bacteria 4132
213 Ga0495662_0004119 3300046476 Bacteria 7325
214 Ga0495664_0000003 3300046477 Bacteria 551602
215 Ga0495608_0000131 3300046511 Bacteria 53612
216 Ga0495608_0006700 3300046511 Bacteria 8165
217 Ga0495618_0009398 3300046514 Bacteria 5902
218 Ga0495618_0147611 3300046514 Bacteria 1503
219 Ga0495618_0237662 3300046514 Bacteria 1146
220 Ga0495628_0000001 3300046516 Bacteria 917742
221 Ga0495628_0022338 3300046516 Bacteria 5197
222 Ga0495628_0068135 3300046516 Bacteria 2777
223 Ga0495630_0008375 3300046517 Bacteria 7420
224 Ga0495652_0000006 3300046529 Bacteria 459709
225 Ga0495652_0019375 3300046529 Bacteria 6061
226 Ga0495652_0176696 3300046529 Bacteria 1643
227 Ga0495665_0009431 3300046531 Bacteria 5283
228 Ga0495640_0000002 3300046533 Bacteria 646434
229 Ga0495640_0009283 3300046533 Bacteria 7665
230 Ga0495587_0000001 3300046536 Bacteria 724132
231 Ga0495645_0000009 3300046543 Bacteria 239632
232 Ga0495645_0002559 3300046543 Bacteria 12352
233 Ga0495667_0000021 3300046559 Bacteria 180625
234 Ga0495667_0013692 3300046559 Bacteria 5480
235 Ga0495667_0019663 3300046559 Bacteria 4556
236 Ga0495634_0001506 3300046642 Bacteria 20620
237 Ga0495634_0055645 3300046642 Bacteria 2645
238 Ga0495635_0000001 3300046663 Bacteria 704901
239 Ga0495635_0003584 3300046663 Bacteria 10744
240 Ga0495661_0190605 3300046665 Bacteria 1080
241 Ga0495657_0000088 3300046675 Bacteria 81307
242 Ga0495657_0008868 3300046675 Bacteria 7655
243 Ga0495599_0000025 3300046678 Bacteria 120337
244 Ga0495599_0002056 3300046678 Bacteria 11665
245 Ga0495623_0000018 3300046679 Bacteria 107338
246 Ga0495623_0053535 3300046679 Bacteria 2547
247 Ga0495623_0228162 3300046679 Bacteria 1058
248 Ga0495646_0000003 3300046680 Bacteria 287773
249 Ga0495646_0029394 3300046680 Bacteria 3435
250 Ga0495647_0065721 3300046681 Bacteria 1441
251 Ga0495658_0080106 3300046683 Bacteria 1915
252 Ga0495624_0043351 3300046690 Bacteria 2871
253 Ga0495600_0000025 3300046809 Bacteria 92167
254 Ga0495600_0003865 3300046809 Bacteria 8888
255 Ga0495581_0077154 3300047315 Bacteria 1928
256 Ga0495604_0000008 3300047317 Bacteria 341160
257 Ga0495604_0016767 3300047317 Bacteria 5860
258 Ga0495674_0000028 3300047319 Bacteria 124722
259 Ga0495674_0037665 3300047319 Bacteria 4346
260 Ga0495680_0002089 3300047322 Bacteria 20750
261 Ga0495680_0004771 3300047322 Bacteria 12870
262 Ga0495675_0000045 3300047444 Bacteria 82813
263 Ga0495675_0060228 3300047444 Bacteria 2406
264 Ga0495684_0000002 3300047471 Bacteria 341216
265 Ga0495684_0000701 3300047471 Bacteria 26925
266 Ga0495593_0008651 3300047673 Bacteria 5918
267 Ga0495593_0009630 3300047673 Bacteria 5608
268 Ga0495602_0000022 3300048088 Bacteria 163672
269 Ga0495602_0031131 3300048088 Bacteria 5048
270 Ga0495602_0044496 3300048088 Bacteria 4026
271 Ga0495602_0161035 3300048088 Bacteria 1752
272 Ga0496101_0177775 3300048904 Bacteria 1638
273 Ga0496102_0201608 3300048905 Bacteria 1876
274 Ga0496102_0208998 3300048905 Bacteria 1840
275 Ga0496102_0334745 3300048905 Bacteria 1426
276 Ga0496103_0014359 3300048906 Bacteria 4705
277 Ga0496104_0120119 3300048907 Bacteria 2523
278 Ga0496104_0266398 3300048907 Bacteria 1626
279 Ga0496104_0304745 3300048907 Bacteria 1505
280 Ga0496104_0377602 3300048907 Bacteria 1330
281 Ga0496105_0001797 3300048908 Bacteria 15330
282 Ga0496106_0039671 3300048909 Bacteria 3526
283 Ga0496106_0259889 3300048909 Bacteria 1389
284 Ga0496107_0001223 3300048910 Bacteria 15659
285 Ga0496107_0010724 3300048910 Bacteria 6374
286 Ga0496107_0190407 3300048910 Bacteria 1524
287 Ga0496108_0001270 3300048911 Bacteria 19743
288 Ga0496108_0026382 3300048911 Bacteria 4792
289 Ga0496109_0008952 3300048912 Bacteria 8527
290 Ga0496110_0008410 3300048913 Bacteria 8302
291 Ga0496110_0180806 3300048913 Bacteria 1915
292 Ga0496111_0155616 3300048914 Bacteria 1696
293 Ga0496111_0215588 3300048914 Bacteria 1426
294 Ga0496111_0223673 3300048914 Viruses 1398
295 Ga0496112_0001047 3300048915 Bacteria 20382
296 Ga0496112_0021077 3300048915 Bacteria 6191
297 Ga0496114_0029669 3300048917 Bacteria 4497
298 Ga0496114_0189941 3300048917 Bacteria 1797
299 Ga0496115_0022624 3300048918 Bacteria 4873
300 Ga0496115_0251364 3300048918 Bacteria 1455
301 Ga0496121_0006192 3300048924 Bacteria 14999
302 Ga0496125_0006588 3300048928 Bacteria 12507
303 Ga0496126_0007979 3300048929 Bacteria 11498
304 Ga0496126_0022419 3300048929 Bacteria 6147
305 Ga0496126_0124393 3300048929 Bacteria 2233
306 Ga0496126_0154151 3300048929 Bacteria 1967
307 Ga0496126_0186001 3300048929 Bacteria 1762
308 Ga0496126_0321241 3300048929 Bacteria 1272
309 nmdc:mga0yw44_77310_c1 3300050492 Bacteria 2079
310 nmdc:mga07m45_142762_c1 3300050496 Bacteria 1387
311 nmdc:mga08y16_181940_c1 3300050511 Bacteria 2182
312 nmdc:mga0n895_262222_c1 3300050512 Bacteria 1753
313 nmdc:mga0n895_57513_c1 3300050512 Bacteria 3833
314 Ga0495601_0000001 3300053077 Bacteria 549454
315 Ga0495612_0000003 3300053078 Bacteria 303629
316 Ga0495612_0044383 3300053078 Bacteria 1819
317 Ga0495595_0021113 3300053084 Bacteria 2841
318 Ga0495619_0000004 3300053085 Bacteria 500068
319 Ga0495619_0002102 3300053085 Bacteria 13212
320 Ga0495619_0154455 3300053085 Bacteria 1583
321 Ga0500651_0027444 3300053093 Bacteria 3580
322 Ga0500650_0150357 3300053098 Bacteria 1077
323 Ga0500554_014943 3300053102 Bacteria 2015
324 Ga0500595_000945 3300053119 Bacteria 16377
325 Ga0500595_001412 3300053119 Bacteria 12893
326 Ga0500642_0023096 3300053130 Bacteria 2491
327 Ga0500638_022573 3300053162 Bacteria 2983
328 Ga0500637_0000114 3300053178 Bacteria 29267
329 Ga0500661_001047 3300055283 Bacteria 5220
330 2513673960 2513237098 Bacteria 9902361
331 2513860668 2513237137 Bacteria 9558895
332 2517888398 2517572143 Bacteria 9484767
333 2524468411 2524023210 Bacteria 9029266
334 2671124221 2667528175 Bacteria 7532676
335 2728752095 2728368998 Bacteria 8720350
336 2793067213 2791355197 Bacteria 8420563
337 2793077133
338 2879112768 2879110137 Bacteria 8907982
339 2885392010 2885383462 Bacteria 9473874
340 2889035911 2889033259 Bacteria 9099371
341 2903753267 2903748898 Bacteria 9972761
342 2903777094 2903768456 Bacteria 9749579
343 2904692285 2904690495 Bacteria 9412302
344 2906614243
345 2908746928 2908739725 Bacteria 8628932
346 2908758908 2908756301 Bacteria 8864324
347 2922426068
348 2935632482 2935630451 Bacteria 8169952
349 2941508855 2941507105 Bacteria 8166816
350 2941516684 2941515067 Bacteria 8166720
351 2941524299 2941523033 Bacteria 8169134
352 3005483472 3005474847 Bacteria 9259049
353 8006992483 8006984368 Bacteria 9651211
354 8019571997 8019565922 Bacteria 9639779
355 Ga0209758_1021235
356 JGI24740J21852_10002093
357 JGI24739J22299_10007291
358 JGI24737J22298_10003234
359 JGI25153J46596_10003308
360 rootH1_10061607
361 Ga0070689_100002201
362 Ga0070668_100053698
363 Ga0070671_100101933
364 Ga0070674_100116578
365 Ga0070674_100205347
366 Ga0070688_100239073
367 Ga0070667_100170744
368 Ga0070667_100289790
369 Ga0070709_10051686
370 Ga0070714_100020830
371 Ga0070714_100212866
372 Ga0070714_100382018
373 Ga0070713_100008303
374 Ga0070713_100073018
375 Ga0070713_100210845
376 Ga0070710_10019490
377 Ga0070710_10149847
378 Ga0070711_100024689
379 Ga0070711_100040086
380 Ga0070700_100147368
381 Ga0070678_100241466
382 Ga0070681_10077962
383 Ga0070681_10281968
384 Ga0068867_100107016
385 Ga0070679_100267070
386 Ga0068853_100009176
387 Ga0068853_100174264
388 Ga0068853_100325519
389 Ga0070665_100019635
390 Ga0068855_100034950
391 Ga0068855_100045602
392 Ga0068855_100154745
393 Ga0068855_100262918
394 Ga0068857_100025539
395 Ga0068857_100029534
396 Ga0068854_100031348
397 Ga0068854_100034023
398 Ga0068854_100234590
399 Ga0068856_100007580
400 Ga0068856_100079394
401 Ga0068856_100147029
402 Ga0068852_100009383
403 Ga0068852_100042060
404 Ga0068852_100273229
405 Ga0068859_100146461
406 Ga0068866_10168790
407 Ga0068851_10003386
408 Ga0068863_100235975
409 Ga0068858_100276740
410 Ga0068860_100219591
411 Ga0068862_100650281
412 Ga0081540_1004792
413 Ga0081540_1031472
414 Ga0081539_10000129
415 Ga0075364_10206570
416 Ga0070716_100065335
417 Ga0070716_100170808
418 Ga0070712_100177584
419 Ga0097621_100296627
420 Ga0075370_10121401
421 Ga0075434_100045020
422 Ga0097620_100146466
423 Ga0099822_1006293
424 Ga0105240_10006010
425 Ga0105240_10007471
426 Ga0105240_10272953
427 Ga0105241_10001634
428 Ga0105248_10030839
429 Ga0105248_10173144
430 Ga0105248_10310704
431 Ga0105237_10149766
432 Ga0105237_10157612
433 Ga0105237_10420543
434 Ga0105238_10002664
435 Ga0105238_10020931
436 Ga0105238_10187939
437 Ga0105238_10352548
438 Ga0105249_10226870
439 Ga0105239_10013167
440 Ga0105239_10026772
441 Ga0105239_10373383
442 Ga0157370_10094139
443 Ga0157370_10113979
444 Ga0157369_10076101
445 Ga0163162_10168946
446 Ga0157372_10324763
447 Ga0157375_10280689
448 Ga0163163_10188624
449 Ga0163163_10203786
450 Ga0157379_10026455
451 Ga0157379_10372278
452 Ga0157376_10468649
453 Ga0209758_1001222
454 Ga0207656_10000685
455 Ga0207692_10017420
456 Ga0207642_10041211
457 Ga0207647_10000749
458 Ga0207685_10014818
459 Ga0207699_10273602
460 Ga0207645_10075590
461 Ga0207654_10000073
462 Ga0207707_10242856
463 Ga0207695_10000366
464 Ga0207695_10028375
465 Ga0207671_10095369
466 Ga0207693_10004841
467 Ga0207693_10119160
468 Ga0207663_10022320
469 Ga0207660_10349019
470 Ga0207649_10080762
471 Ga0207652_10134677
472 Ga0207681_10004826
473 Ga0207694_10000139
474 Ga0207694_10033707
475 Ga0207644_10107780
476 Ga0207670_10043654
477 Ga0207669_10048611
478 Ga0207704_10219863
479 Ga0207665_10004430
480 Ga0207665_10084912
481 Ga0207711_10041830
482 Ga0207711_10537730
483 Ga0207667_10015597
484 Ga0207667_10026231
485 Ga0207667_10314574
486 Ga0207667_10443223
487 Ga0207640_10009130
488 Ga0207640_10027881
489 Ga0207658_10215162
490 Ga0207703_10163157
491 Ga0207703_10228942
492 Ga0207639_10001776
493 Ga0207639_10010041
494 Ga0207639_10486586
495 Ga0207678_10055968
496 Ga0207702_10000491
497 Ga0207702_10014883
498 Ga0207641_10119775
499 Ga0207676_10030569
500 Ga0207674_10012447
501 Ga0207674_10012615
502 Ga0207675_100095580
503 Ga0207675_100492818
504 Ga0207698_10002187
505 Ga0207698_10118752
506 Ga0207698_10183258
507 Ga0209589_1001702
508 Ga0209489_102545
509 Ga0209700_102508
510 Ga0268266_10065448
511 Ga0268266_10521312
512 Ga0268265_10390700
513 Ga0307517_10002031
514 Ga0265332_10019853
515 Ga0265340_10003861
516 Ga0265339_10021130
517 Ga0265314_10205616
518 Ga0265342_10000139
519 Ga0315911_1000042
520 Ga0373930_0031544
521 Ga0373926_0020871
522 Ga0373934_0042454
523 Ga0373940_0048264
524 Ga0373951_0010402
525 Ga0373923_0000994
526 Ga0373936_0000131
527 Ga0373936_0194698
528 Ga0373939_0005892
529 Ga0373945_0002931
530 Ga0373953_0051323
531 Ga0373954_0002536
532 Ga0373956_0002019
533 Ga0373957_0003320
534 Ga0373960_0037910
535 Ga0373943_0005070
536 Ga0373943_0015656
537 Ga0373946_0137782
538 Ga0373955_0002890
539 Ga0373955_0021120
540 Ga0373924_0002153
541 Ga0373924_0011790
542 Ga0373931_0000511
543 Ga0373931_0046420
544 Ga0373935_0000482
545 Ga0373927_0017006
546 Ga0373927_0018350
547 Ga0373927_0062317
548 Ga0373933_0017835
549 Ga0373933_0054519
550 Ga0373947_0003527
551 Ga0373937_0000005
552 Ga0373937_0048805
553 Ga0373937_0094344
554 Ga0373925_0000007
555 Ga0373925_0275859
556 Ga0436364_1030114
557 Ga0436365_0690350
558 Ga0466967_0076891
559 Ga0495592_0000241
560 Ga0495592_0055952
561 Ga0495629_0002565
562 Ga0495629_0019034
563 Ga0495651_0010131
564 Ga0495651_0043072
565 Ga0495653_0000034
566 Ga0495653_0032634
567 Ga0495662_0004119
568 Ga0495664_0000003
569 Ga0495608_0000131
570 Ga0495608_0006700
571 Ga0495618_0009398
572 Ga0495618_0147611
573 Ga0495618_0237662
574 Ga0495628_0000001
575 Ga0495628_0022338
576 Ga0495628_0068135
577 Ga0495630_0008375
578 Ga0495652_0000006
579 Ga0495652_0019375
580 Ga0495652_0176696
581 Ga0495665_0009431
582 Ga0495640_0000002
583 Ga0495640_0009283
584 Ga0495587_0000001
585 Ga0495645_0000009
586 Ga0495645_0002559
587 Ga0495667_0000021
588 Ga0495667_0013692
589 Ga0495667_0019663
590 Ga0495634_0001506
591 Ga0495634_0055645
592 Ga0495635_0000001
593 Ga0495635_0003584
594 Ga0495661_0190605
595 Ga0495657_0000088
596 Ga0495657_0008868
597 Ga0495599_0000025
598 Ga0495599_0002056
599 Ga0495623_0000018
600 Ga0495623_0053535
601 Ga0495623_0228162
602 Ga0495646_0000003
603 Ga0495646_0029394
604 Ga0495647_0065721
605 Ga0495658_0080106
606 Ga0495624_0043351
607 Ga0495600_0000025
608 Ga0495600_0003865
609 Ga0495581_0077154
610 Ga0495604_0000008
611 Ga0495604_0016767
612 Ga0495674_0000028
613 Ga0495674_0037665
614 Ga0495680_0002089
615 Ga0495680_0004771
616 Ga0495675_0000045
617 Ga0495675_0060228
618 Ga0495684_0000002
619 Ga0495684_0000701
620 Ga0495593_0008651
621 Ga0495593_0009630
622 Ga0495602_0000022
623 Ga0495602_0031131
624 Ga0495602_0044496
625 Ga0495602_0161035
626 Ga0496101_0177775
627 Ga0496102_0201608
628 Ga0496102_0208998
629 Ga0496102_0334745
630 Ga0496103_0014359
631 Ga0496104_0120119
632 Ga0496104_0266398
633 Ga0496104_0304745
634 Ga0496104_0377602
635 Ga0496105_0001797
636 Ga0496106_0039671
637 Ga0496106_0259889
638 Ga0496107_0001223
639 Ga0496107_0010724
640 Ga0496107_0190407
641 Ga0496108_0001270
642 Ga0496108_0026382
643 Ga0496109_0008952
644 Ga0496110_0008410
645 Ga0496110_0180806
646 Ga0496111_0155616
647 Ga0496111_0215588
648 Ga0496111_0223673
649 Ga0496112_0001047
650 Ga0496112_0021077
651 Ga0496114_0029669
652 Ga0496114_0189941
653 Ga0496115_0022624
654 Ga0496115_0251364
655 Ga0496121_0006192
656 Ga0496125_0006588
657 Ga0496126_0007979
658 Ga0496126_0022419
659 Ga0496126_0124393
660 Ga0496126_0154151
661 Ga0496126_0186001
662 Ga0496126_0321241
663 nmdc:mga0yw44_77310_c1
664 nmdc:mga07m45_142762_c1
665 nmdc:mga08y16_181940_c1
666 nmdc:mga0n895_262222_c1
667 nmdc:mga0n895_57513_c1
668 Ga0495601_0000001
669 Ga0495612_0000003
670 Ga0495612_0044383
671 Ga0495595_0021113
672 Ga0495619_0000004
673 Ga0495619_0002102
674 Ga0495619_0154455
675 Ga0500651_0027444
676 Ga0500650_0150357
677 Ga0500554_014943
678 Ga0500595_000945
679 Ga0500595_001412
680 Ga0500642_0023096
681 Ga0500638_022573
682 Ga0500637_0000114
683 Ga0500661_001047
684 2513673960
685 2513860668
686 2517888398
687 2524468411
688 2671124221
689 2728752095
690 2793067213
691 2793077133
692 2879112768
693 2885392010
694 2889035911
695 2903753267
696 2903777094
697 2904692285
698 2906614243
699 2908746928
700 2908758908
701 2922426068
702 2935632482
703 2941508855
704 2941516684
705 2941524299
706 3005483472
707 8006992483
708 8019571997

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11306

DUF3108

Protein of unknown function (DUF3108)

22

258

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bju-assembly2.cif.gz_C the structure of atzh: a little known member of the atrazine breakdown pathway 0.6384 43 110
2zxk-assembly1.cif.gz_A crystal structure of semet-red chlorophyll catabolite reductase 0.6249 44 120
3agb-assembly1.cif.gz_B f218v mutant of the substrate-free form of red chlorophyll catabolite reductase from arabidopsis thaliana 0.6049 44 120
3f7s-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (pp_4556) from pseudomonas putida kt2440 at 2.11 a resolution 0.5653 43 101
6bju-assembly1.cif.gz_A the structure of atzh: a little known member of the atrazine breakdown pathway 0.5635 43 101
ID Description Score Start End Superfamily
af_Q8IJC0_48_207_3.40.50.10480 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Brix domain 0.7439 103 131 3.40.50.10480
af_E7F1M4_1_172_3.30.500.10 Alpha Beta;2-Layer Sandwich;Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1;MHC class I-like antigen recognition-like 0.558 84 132 3.30.500.10
4r80B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5168 20 109 3.10.450.630
af_Q9JIL8_3_164_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.501 52 112 3.40.50.300
3sluA02 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.4965 84 128 3.10.450.350
ID Description Score Start End GO Terms
AF-A0A023XUQ5-F1-model_v4 deleted 0.9684 34 286
AF-A0A7S7ZMJ8-F1-model_v4 DUF3108 domain-containing protein 0.9684 32 286
AF-A0A1I4MLY2-F1-model_v4 deleted 0.9684 32 286
AF-A0A7U3E6B1-F1-model_v4 deleted 0.9682 32 277
AF-A0A182D0D8-F1-model_v4 DUF3108 domain-containing protein 0.966 28 277

Map